# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_13444.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACD30541.1  [L=351]
Description: ftul2 ACD30541.1 GIB00719CH01 "conserved hypothetical membrane protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    9.1e-26   93.0   1.1    1.2e-25   92.6   0.8    1.1  1  PF02931  Neurotransmitter-gated ion-channel ligand binding d
     0.0025   20.4   3.7     0.0047   19.5   2.3    1.6  1  PF02932  Neurotransmitter-gated ion-channel transmembrane re
  ------ inclusion threshold ------
         12    8.6   0.1         29    7.4   0.0    1.7  1  PF10880  Protein of unknown function (DUF2673)
         17    6.3   1.4         25    5.7   0.9    1.2  1  PF06638  Strabismus protein
         26    6.7   0.0         40    6.1   0.0    1.2  1  PF05315  ICEA Protein
         28    6.9   0.1         94    5.2   0.0    1.9  1  PF11772  DNA-directed RNA polymerase subunit beta
         51    5.3   0.0         72    4.8   0.0    1.2  1  PF08423  Rad51
         65    6.1   0.1    2.6e+02    4.2   0.0    2.0  1  PF09010  Anti-Sigma Factor A
         85    5.6   0.1    1.4e+02    4.9   0.0    1.3  1  PF00754  F5/8 type C domain
    1.1e+02    5.2   0.0    2.4e+02    4.0   0.0    1.6  1  PF12212  Piwi/Argonaute/Zwille siRNA-binding domain
    1.1e+02    4.0   0.1    1.6e+02    3.5   0.0    1.1  1  PF00225  Kinesin motor domain
    1.1e+02    5.0   0.2    6.3e+02    2.6   0.0    1.9  1  PF09769  Apolipoprotein O
    1.5e+02    3.2   0.2    2.3e+02    2.6   0.1    1.2  1  PF03063  Prismane/CO dehydrogenase family
    1.6e+02    4.5   0.0    3.1e+02    3.6   0.0    1.4  1  PF03657  Uncharacterised protein family (UPF0113)
    1.9e+02    4.4   0.0    3.1e+02    3.7   0.0    1.2  1  PF12303  Membrane bound L-sorbosone dehydrogenase
    3.2e+02    3.3   0.0    6.7e+02    2.3   0.0    1.5  1  PF07492  Neutral trehalase Ca2+ binding domain
    3.3e+02    3.6   0.1    7.4e+02    2.4   0.0    1.6  1  PF05534  HicB family
    4.6e+02    3.5   0.0    9.2e+02    2.5   0.0    1.4  1  PF02061  Lambda Phage CIII
      5e+02    1.1   0.0    6.9e+02    0.6   0.0    1.1  1  PF06933  Special lobe-specific silk protein SSP160
    5.9e+02    2.9   6.2    4.4e+02    3.3   1.0    2.4  2  PF04341  Protein of unknown function, DUF485
    1.1e+03    1.6   3.9    4.3e+03   -0.3   2.7    2.1  1  PF12412  Protein of unknown function (DUF3667)
    2.3e+03    1.0   0.0    5.8e+03   -0.4   0.0    1.4  1  PF03205  Molybdopterin guanine dinucleotide synthesis protei
    2.6e+03    1.3   1.1    4.9e+03    0.4   0.7    1.4  1  PF00446  Gonadotropin-releasing hormone
      3e+03    1.0   4.5    9.3e+03   -0.6   3.1    1.9  1  PF03183  Borrelia repeat protein


Domain and alignment annotation for each model:
>> PF02931  Neurotransmitter-gated ion-channel ligand binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   92.6   0.8   2.9e-29   1.2e-25      23     216 .]      30     227 ..      26     227 .. 0.88

  Alignments for each domain:
  == domain 1    score: 92.6 bits;  conditional E-value: 2.9e-29
                 -------------------------------------------CCC------------......--------------------.-------------- CS
     PF02931  23 skpvdVkvelslsqiidvdeknqeltlnvwlrqkWtDerLawdpedyggikslrlpse......kiWlPdivlyNkadeeheittkntnlriesdGkvl 115
                 +kp+ Vk++ +++ i+ ++e n++l+++v++r +W+D+rL++d+++ ++  +l           + W+P+i ++N+  +  +i+    +++i+++G+++
  ACD30541.1  30 QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFqydevfEGWKPQISIINEIGT-PQIK--ARQIKIYPNGDII 125
                 6899***************************************99955554443322245578888*********5444.3343..5899********* PP

                 ---------------------------------------------.......-----------------------SSSESS.SSSSS.----------- CS
     PF02931 116 lsprlivkssCsidlkkFPfDeqnCslkfeSwtyneeevdlkwkekkevvekeeidlsdflengewelveveakrkekatgeysels.ysditftltlr 213
                 ++ + ++ +  +++l+kFPfD+q+ +  +  ++yn++ev+l ++ +++++ k+ ++ +  ++  ew+l++++ k+ e  +  y +++  s+++f++ l+
  ACD30541.1 126 YTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQrISMLEFSISLE 224
                 *********************************************9999999999999999************999998888888877899******** PP

                 --- CS
     PF02931 214 Rkp 216
                 Rkp
  ACD30541.1 225 RKP 227
                 *96 PP

>> PF02932  Neurotransmitter-gated ion-channel transmembrane region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.5   2.3   1.1e-06    0.0047       2     100 ..     235     334 ..     234     344 .. 0.92

  Alignments for each domain:
  == domain 1    score: 19.5 bits;  conditional E-value: 1.1e-06
                 HHHHHHHHHHHHHHHHHHHH--TTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSHHHHTHHHHHHHHHHHHHHHHHHHHHHHHH--.------------ CS
     PF02932   2 iiPcvliviLsvlvFyLpsdagpekvtLgItvlLtlTvflllireilPktSlvipligkyllftmivvtllieiavvvlnvhhrsp.rthkmpewvrkv 99 
                 +iP +l+v   +  F+++ +a + +  ++   +L+     +li+ ++P + + +  +g++ll + i+++ ++e  +v   +++++    +km    r+v
  ACD30541.1 235 LIPLTLLVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLIEGEMPDIDYLTFTDGFLLLSFSILFSTVLESLAVYWLIKLNKDkLARKMDIFSRFV 333
                 79***********************************************************************99999888888886788887777776 PP

                 - CS
     PF02932 100 f 100
                 f
  ACD30541.1 334 F 334
                 6 PP

>> PF10880  Protein of unknown function (DUF2673)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0    0.0069        29       1      34 [.       1      39 [.       1      53 [. 0.70

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0069
     PF10880  1 mknLlkiLLila....fsaPvfassqqvP..dPasvtttq 34
                m+n++ki+L+l+    f + +f    ++P   P+ v t +
  ACD30541.1  1 MRNIYKIILVLSivaiFYSDIFGY-GDIPpqKPTLVKTSA 39
                99*******998222244445544.567667888888765 PP

>> PF06638  Strabismus protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.9     0.006        25     136     167 ..     231     262 ..     222     277 .. 0.78

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.006
     PF06638 136 lislafklllLlialwalflRkaratlPrlfv 167
                 l+ + + l lL++a+wa+f+  ++a   rl +
  ACD30541.1 231 LLKVLIPLTLLVLAMWAIFWMDTKALSDRLNI 262
                 666778899****************9999865 PP

>> PF05315  ICEA Protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0    0.0097        40     161     186 ..      66      92 ..      34      96 .. 0.69

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.0097
     PF05315 161 nkrfda.kkisgnpyafyegeeeydee 186
                 ++r +  k+    py +y+g+++yde 
  ACD30541.1  66 DQRLEFdKNEEKTPYKLYQGDFQYDEV 92 
                 5555531556778************75 PP

>> PF11772  DNA-directed RNA polymerase subunit beta
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.023        94       3      23 ..       7      27 ..       7      35 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.023
     PF11772  3 iVilLavlalviGlmvGYgvi 23
                i+++L ++a++ + ++GYg i
  ACD30541.1  7 IILVLSIVAIFYSDIFGYGDI 27
                7999**************965 PP

>> PF08423  Rad51
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.017        72     138     184 ..       4      56 ..       1      65 [. 0.73

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.017
     PF08423 138 rfallivdsitalyrtdfsGrGelaerqqklakf......lrklqkladefnv 184
                  +++++v si+a++  d  G G++  ++  l k+      ++ l+++ ++ ++
  ACD30541.1   4 IYKIILVLSIVAIFYSDIFGYGDIPPQKPTLVKTsafitdIQILNEMNEQLQI 56 
                 599*********************99988887752222223445555555555 PP

>> PF09010  Anti-Sigma Factor A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.061   2.6e+02      21      49 ..      87     115 ..      86     119 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.061
                 TTTHHHHTSHHHHHHHHHH---B-.---B CS
     PF09010  21 lgvedivenqknfveflnEiGlrtteGke 49 
                 ++++++ e  k  ++++nEiG  + + ++
  ACD30541.1  87 FQYDEVFEGWKPQISIINEIGTPQIKARQ 115
                 789******************98777665 PP

>> PF00754  F5/8 type C domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.034   1.4e+02      80     115 ..      80     121 ..      41     132 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.034
                 EEEEEEC......BECSCSSSSSEEEEEEEEEEEEEEEEEEE CS
     PF00754  80 Wtevkde......fegntdnstpvkntfdppikaryvrivpt 115
                 ++ ++++      feg++ + ++ ++   p ikar ++i+p 
  ACD30541.1  80 YKLYQGDfqydevFEGWKPQISIINEIGTPQIKARQIKIYPN 121
                 455555566666789999999999999*************95 PP

>> PF12212  Piwi/Argonaute/Zwille siRNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.058   2.4e+02       2      19 ..     246     263 ..     245     264 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.058
                 HHHTTT-HHHHHHHHHHT CS
     PF12212   2 YaillkdskaieeiLkva 19 
                 +ai++ d ka+   L++a
  ACD30541.1 246 WAIFWMDTKALSDRLNIA 263
                 9**********9988886 PP

>> PF00225  Kinesin motor domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.038   1.6e+02      23      67 ..      68     112 ..      43     115 .. 0.77

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.038
                 EECEEEEEEECETTTTEEEEEESEEEETTSTHHHHHHHHTHHHHH CS
     PF00225  23 kkeeekkskkenkeekekeftFdkvfdeeatqeevyeelakplve 67 
                 + e +k+++k+  + ++ +f++d+vf+  + q ++ +e+++p ++
  ACD30541.1  68 RLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQIK 112
                 45566778888889999***********99999999999888776 PP

>> PF09769  Apolipoprotein O
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.15   6.3e+02     115     134 ..     229     248 ..     224     258 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.15
     PF09769 115 sivlRlatPlafgllaasvf 134
                 +i+l++++Pl + +la++  
  ACD30541.1 229 NILLKVLIPLTLLVLAMWAI 248
                 89***************975 PP

>> PF03063  Prismane/CO dehydrogenase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1     0.055   2.3e+02     443     473 ..     241     271 ..     229     280 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.055
                 SSEEEEBTT--SHHHHHHHHHHHH---SEEE CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF03063 443 LplaasalewyeqKAvailltllalGinihl 473
                 L+la+ a+ w+  KA+++ l +  +Gi  ++
  ACD30541.1 241 LVLAMWAIFWMDTKALSDRLNIAFIGILSVI 271
                 78899*********************95544 PP

>> PF03657  Uncharacterised protein family (UPF0113)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.074   3.1e+02       7      30 ..     160     183 ..     158     206 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.074
     PF03657   7 kskElkliekelskygskdflshe 30 
                 +skE++li +  +k++ kd+++  
  ACD30541.1 160 NSKEVQLIVEPNHKITVKDYVKDH 183
                 79******************9864 PP

>> PF12303  Membrane bound L-sorbosone dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0     0.074   3.1e+02      66      83 ..     114     131 ..     101     146 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.074
     PF12303  66 RwlyvlPngDvLVaesna 83 
                 R++   PngD++ +e ++
  ACD30541.1 114 RQIKIYPNGDIIYTEQRT 131
                 99*********9999776 PP

>> PF07492  Neutral trehalase Ca2+ binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.16   6.7e+02      13      20 ..     171     178 ..     170     179 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.16
     PF07492  13 NkQITIeD 20 
                 N++IT+ D
  ACD30541.1 171 NHKITVKD 178
                 9*****99 PP

>> PF05534  HicB family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.18   7.4e+02       2      21 ..      69      88 ..      68      89 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.18
     PF05534  2 ledckepgkepekpysGkFn 21
                le+ k ++k p+k y G F+
  ACD30541.1 69 LEFDKNEEKTPYKLYQGDFQ 88
                7889999***********96 PP

>> PF02061  Lambda Phage CIII
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.22   9.2e+02      30      45 .]      94     109 ..      92     109 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.22
     PF02061  30 aGWKRLvDilNqPGVP 45 
                 +GWK  + i+N  G P
  ACD30541.1  94 EGWKPQISIINEIGTP 109
                 6**********99987 PP

>> PF06933  Special lobe-specific silk protein SSP160
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0      0.17   6.9e+02       4      24 ..       6      26 ..       2      33 .. 0.84

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.17
     PF06933  4 kvilvcalvaiffaqvaeggp 24
                k+ilv ++vaif++++   g 
  ACD30541.1  6 KIILVLSIVAIFYSDIFGYGD 26
                99***********99876665 PP

>> PF04341  Protein of unknown function, DUF485
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   1.0      0.11   4.4e+02      30      69 ..     238     277 ..     228     279 .. 0.81
   2 ?    1.5   0.2      0.38   1.6e+03      14      35 ..     329     350 ..     317     351 .] 0.80

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.11
     PF04341  30 fgfillvafapellgtklaeGaitvgillglgqfvltfll 69 
                 +++++l+  a  +++tk  +++++++++  l +++  fl+
  ACD30541.1 238 LTLLVLAMWAIFWMDTKALSDRLNIAFIGILSVIAYQFLI 277
                 5677788888889999999899999999999999998876 PP

  == domain 2    score: 1.5 bits;  conditional E-value: 0.38
     PF04341  14 rrrfalpltalmlvlYfgfill 35 
                  +rf++p++ l+l++ + fi l
  ACD30541.1 329 FSRFVFPISYLVLITSLYFIYL 350
                 579*********9988777765 PP

>> PF12412  Protein of unknown function (DUF3667)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.3   2.7         1   4.3e+03      29      46 .]     331     348 ..     330     348 .. 0.93

  Alignments for each domain:
  == domain 1    score: -0.3 bits;  conditional E-value: 1
     PF12412  29 kYvnPfrlfliasiiyfi 46 
                 ++v P+ +++++  +yfi
  ACD30541.1 331 RFVFPISYLVLITSLYFI 348
                 8999*************8 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   0.0       1.4   5.8e+03      65      96 ..      29      60 ..      27      68 .. 0.86

  Alignments for each domain:
  == domain 1    score: -0.4 bits;  conditional E-value: 1.4
                SSCEEEEEEE-SSS----HHHHHHCCT-SEEE CS
     PF03205 65 ieeplalvtgvllekeadLeallsvlsvDlvl 96
                 ++p +++t+++ ++ + L+++ ++l++D+++
  ACD30541.1 29 PQKPTLVKTSAFITDIQILNEMNEQLQIDVIF 60
                57788899999999999999999******997 PP

>> PF00446  Gonadotropin-releasing hormone
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.4   0.7       1.2   4.9e+03       6       9 ..      95      98 ..      95      98 .. 0.95

  Alignments for each domain:
  == domain 1    score: 0.4 bits;  conditional E-value: 1.2
     PF00446  6 gWkP 9 
                gWkP
  ACD30541.1 95 GWKP 98
                9**9 PP

>> PF03183  Borrelia repeat protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   3.1       2.2   9.3e+03       9      18 .]     294     303 ..     294     303 .. 0.92

  Alignments for each domain:
  == domain 1    score: -0.6 bits;  conditional E-value: 2.2
     PF03183   9 SLisdfisas 18 
                 +L+s++i++s
  ACD30541.1 294 LLLSFSILFS 303
                 69******98 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (351 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       428  (0.0359302); expected 238.2 (0.02)
Passed bias filter:                      218  (0.0183009); expected 238.2 (0.02)
Passed Vit filter:                        27  (0.00226662); expected 11.9 (0.001)
Passed Fwd filter:                        27  (0.00226662); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              24  [number of targets reported over threshold]
# CPU time: 0.24u 0.05s 00:00:00.28 Elapsed: 00:00:01
# Mc/sec: 3157.39
//