# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_13447.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACD30867.1  [L=196]
Description: ftul2 ACD30867.1 GIB00719CH01 "CBS domain pair protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      4e-08   35.4   0.4      0.022   17.0   0.1    2.3  2  PF00571  CBS domain
  ------ inclusion threshold ------
        2.3   10.4   0.0        6.4    9.0   0.0    1.7  1  PF08711  TFIIS helical bundle-like domain
        3.2   10.1   0.4        6.3    9.1   0.3    1.5  1  PF00564  PB1 domain
        5.6    8.5   0.1        6.3    8.4   0.1    1.2  1  PF01008  Initiation factor 2 subunit family
        6.7    9.1   1.3    1.5e+02    4.8   0.0    2.1  2  PF09114  Transcription factor MotA, activation domain
         15    8.0   0.1         58    6.1   0.0    1.9  1  PF11061  Protein of unknown function (DUF2862)
         20    7.4   0.0         29    6.9   0.0    1.3  1  PF01174  SNO glutamine amidotransferase family
         22    7.3   0.1         38    6.6   0.1    1.4  1  PF04027  Domain of unknown function (DUF371)
         26    7.0   0.1         44    6.3   0.0    1.3  1  PF09416  RNA helicase (UPF2 interacting domain)
         28    7.8   0.2         80    6.3   0.1    1.8  1  PF07764  Omega Transcriptional Repressor
         39    5.4   0.1         60    4.8   0.0    1.2  1  PF06025  Domain of Unknown Function (DUF913)
         58    6.2   0.1      1e+02    5.4   0.1    1.4  1  PF03539  Spumavirus aspartic protease (A9)
         58    6.5   0.5    6.2e+02    3.2   0.0    2.3  2  PF03720  UDP-glucose/GDP-mannose dehydrogenase family, UDP b
         71    6.3   0.0    1.8e+02    5.1   0.0    1.6  1  PF00189  Ribosomal protein S3, C-terminal domain
         76    5.5   0.3    2.5e+02    3.9   0.0    2.0  1  PF00036  EF hand
         83    5.7   1.1    1.4e+02    5.0   0.1    1.8  1  PF09022  Staphostatin A
         85    5.4   0.0    1.6e+02    4.5   0.0    1.5  1  PF12165  Domain of unknown function (DUF3594)
         89    5.7   0.1    2.7e+02    4.1   0.1    1.8  1  PF07453  NUMOD1 domain
      2e+02    3.6   0.0    3.7e+02    2.7   0.0    1.3  1  PF04139  Rad9
    2.2e+02    3.7   0.0    3.6e+02    3.0   0.0    1.3  1  PF09764  Uncharacterized conserved protein
    2.2e+02    4.4   0.0    4.8e+02    3.4   0.0    1.5  1  PF07440  Caerin 1 protein
    2.3e+02    3.6   0.1    3.7e+02    2.9   0.1    1.2  1  PF05890  Eukaryotic rRNA processing protein EBP2
    2.5e+02    3.8   0.2    7.4e+02    2.3   0.1    1.8  1  PF08225  Pseudin antimicrobial peptide
    2.9e+02    4.5   2.4    2.8e+02    4.6   0.3    2.0  1  PF04867  Protein of unknown function (DUF643)
    3.3e+02    3.5   0.2    8.4e+02    2.3   0.1    1.6  1  PF10813  Protein of unknown function (DUF2733)
    4.6e+02    2.2   0.1    8.6e+02    1.4   0.0    1.4  1  PF01531  Glycosyl transferase family 11


Domain and alignment annotation for each model:
>> PF00571  CBS domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   17.0   0.1   5.7e-06     0.022       8      49 ..      48      89 ..      38      93 .. 0.91
   2 !   16.7   0.0   7.1e-06     0.027      14      53 ..     131     174 ..     112     178 .. 0.77

  Alignments for each domain:
  == domain 1    score: 17.0 bits;  conditional E-value: 5.7e-06
                SSEEEETTSBHHHHHHHHHHHTSSEEEEEEETTEB---EEHH CS
     PF00571  8 dvvtvppdetlsealeilrktgvsrlpVvDedgrlvGiitlr 49
                d  +v++d +l+++  +l++++ + ++V+D +++++G i l+
  ACD30867.1 48 DALVVKADVNLKDVKTKLIDNHKDFILVTDGEDKVIGSIALH 89
                8899*************************999******9875 PP

  == domain 2    score: 16.7 bits;  conditional E-value: 7.1e-06
                 TTSBHHHHHHHHHHHTSSEEEEEEET....TEB---EEHHHHHH CS
     PF00571  14 pdetlsealeilrktgvsrlpVvDed....grlvGiitlrDllk 53 
                 ++ +++ ++++l++ ++++++V D+d    + + G+++l  + +
  ACD30867.1 131 ENSKIGHVVNTLINSDYHHIIVYDKDkngeKYIRGYFSLPYIRR 174
                 7789********************99899666669998866555 PP

>> PF08711  TFIIS helical bundle-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.0   0.0    0.0017       6.4      11      31 ..     125     145 ..     116     158 .. 0.85

  Alignments for each domain:
  == domain 1    score: 9.0 bits;  conditional E-value: 0.0017
                 .STTHHHHHH---HHHH--SS CS
     PF08711  11 itlelLkeTgiGkaVnkLrkh 31 
                 ++ ++++ ++iG++Vn L  +
  ACD30867.1 125 VSFSIIENSKIGHVVNTLINS 145
                 78999***********99766 PP

>> PF00564  PB1 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.3    0.0016       6.3      35      61 ..      56      80 ..      41      81 .. 0.85

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.0016
                HTCSGSSEEEEEEETTCSEEEESSHHH CS
     PF00564 35 fklsdedvklkYpdedgdlvtitsdeD 61
                 +l  +dvk k++d+++d++++t+ eD
  ACD30867.1 56 VNL--KDVKTKLIDNHKDFILVTDGED 80
                444..89****************9887 PP

>> PF01008  Initiation factor 2 subunit family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.1    0.0016       6.3      32     107 ..      20      94 ..       3     152 .. 0.83

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0016
                 HHHHHHHHHHHHTSSTS-HHHHHHHHHHHHHHCCTT-SSHHHHHHHHHHHHHHHHHHHHHHHHH---TGGCCH-SB CS
     PF01008  32 keklrkaidlLkkarPtavslgnairrllkiselksssdvkeakksliekikelikeieeadekigdiaaelikdg 107
                 +++lr+ ++ L   +  a +++   ++  + + +k + ++k++k++li++ k++i      d++ig ia  +i+++
  ACD30867.1  20 VNYLRDDVNHLLYLDSPALDVFRDYKEHDA-LVVKADVNLKDVKTKLIDNHKDFILVTDGEDKVIGSIALHYIQSQ 94 
                 677788888888887778888877777777.67899999**********************************765 PP

>> PF09114  Transcription factor MotA, activation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.039   1.5e+02      47      93 ..      50      97 ..      40     100 .. 0.82
   2 ?    3.3   0.1      0.12   4.6e+02      19      57 ..     113     151 ..     108     167 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.039
                HHHHHH---T.TT---EE------EE---HHHHHHHHHHHHHHHTHHH CS
     PF09114 47 avvnsniGvl.ikkelveksGdGliiteeaddiiveaaelyaqenave 93
                 vv++++ +  +k +l++   d +++t+  d++i   a  y q +a +
  ACD30867.1 50 LVVKADVNLKdVKTKLIDNHKDFILVTDGEDKVIGSIALHYIQSQALN 97
                566666655338999***********************99*9999875 PP

  == domain 2    score: 3.3 bits;  conditional E-value: 0.12
                 HHHHHHHHHSTT--HHHHHH.T-TT---HHHHHH---TT CS
     PF09114  19 aailiqiakkdfitaaevresveaelnkavvnsniGvli 57 
                   i++ iak + ++ + + +s   ++ ++ +ns+   +i
  ACD30867.1 113 NDIMLPIAKANVVSFSIIENSKIGHVVNTLINSDYHHII 151
                 679************999999888999999998866555 PP

>> PF11061  Protein of unknown function (DUF2862)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.015        58      14      49 ..     109     141 ..     105     146 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.015
     PF11061  14 drlpkelveklkkspigtikgyKmtDgkgigvvvel 49 
                 d ++++++  + k   + ++ + ++++++ig vv++
  ACD30867.1 109 DLIANDIMLPIAK---ANVVSFSIIENSKIGHVVNT 141
                 6677777777777...99****************87 PP

>> PF01174  SNO glutamine amidotransferase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0    0.0076        29       6      67 ..      42     103 ..      37     123 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.0076
                 --HHHHHHHHHH---EEEEE-SGGGGGG---EE-----CCCHHHHHHHTT-HHHHHHHHHT- CS
     PF01174   6 GaveehveaikkclaenktvkrkedlaevdaliiPGGestamskliertglyedllefvkns 67 
                  +++eh   + k+ ++ k vk+k   ++ d +++  Ge   ++ ++ ++   ++l e ++ s
  ACD30867.1  42 RDYKEHDALVVKADVNLKDVKTKLIDNHKDFILVTDGEDKVIGSIALHYIQSQALNERARSS 103
                 5789*******************999********************9999999999887765 PP

>> PF04027  Domain of unknown function (DUF371)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.1    0.0098        38      80     121 ..      31      70 ..       9      76 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.0098
                 -----SSEEEEESSS---TTEEESS-S--GGGS-HHHHHHHH CS
     PF04027  80 LtleddtslviRkSdyvddrtvlikadkaaadldrelveaLk 121
                 L l++++  v+R  dy ++  +++kad   +d++ +l+++ k
  ACD30867.1  31 LYLDSPALDVFR--DYKEHDALVVKADVNLKDVKTKLIDNHK 70 
                 778888888888..8***********************9755 PP

>> PF09416  RNA helicase (UPF2 interacting domain)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.012        44      29      64 ..     131     166 ..     121     170 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.012
     PF09416  29 dktssshivnhlvkskhkevalhkeselgdtvleCy 64 
                 ++++ +h+vn l++s  +++ ++++ + g++ +  y
  ACD30867.1 131 ENSKIGHVVNTLINSDYHHIIVYDKDKNGEKYIRGY 166
                 577899******************999999888766 PP

>> PF07764  Omega Transcriptional Repressor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.1     0.021        80      32      49 ..     143     160 ..     131     165 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.021
                 E-HHHHHHHHHHHHH--- CS
     PF07764  32 vradlhhiikietaknGG 49 
                 + +d hhii  +  knG 
  ACD30867.1 143 INSDYHHIIVYDKDKNGE 160
                 578*************95 PP

>> PF06025  Domain of Unknown Function (DUF913)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.8   0.0     0.016        60       9      73 ..      28      96 ..      25      99 .. 0.77

  Alignments for each domain:
  == domain 1    score: 4.8 bits;  conditional E-value: 0.016
     PF06025  9 dtlvdavrdalallteakGldalidrikyevkksee..nvsrgagikgeekeesld..yqisysrqqll 73
                ++l++ +++al+++++ k  dal+ + ++++k ++    ++ ++ i   + e+++     + y + q+l
  ACD30867.1 28 NHLLYLDSPALDVFRDYKEHDALVVKADVNLKDVKTklIDNHKDFILVTDGEDKVIgsIALHYIQSQAL 96
                7899*************************9999988665666666666666666654555666666665 PP

>> PF03539  Spumavirus aspartic protease (A9)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.1     0.027     1e+02      38      75 ..      41      78 ..      32      99 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.027
                ----EEEEEEEEEEEE---EEEEEEEEESSSSEEE-TT CS
     PF03539 38 ihgekeedvyylelkiegrkveaeviataldyvliaps 75
                  + ke+d   ++  ++ + v++++i  + d++l++ +
  ACD30867.1 41 FRDYKEHDALVVKADVNLKDVKTKLIDNHKDFILVTDG 78
                567899*****************************976 PP

>> PF03720  UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.16   6.2e+02      16      66 ..      34      84 ..      32      95 .. 0.82
   2 ?    0.8   0.0      0.91   3.5e+03      15      39 ..     131     156 ..     128     182 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.16
                T-THHHHHHHHHH---EEEEE-SS---........-----EES-CCCCCTT CS
     PF03720 16 eSpaldiieeLleegaevkiyDPkvkeeaaealleeknvelvsdleealkg 66
                +Spald+ ++ +e++a v+  D + k+ + + + ++k+  lv+d e+ + g
  ACD30867.1 34 DSPALDVFRDYKEHDALVVKADVNLKDVKTKLIDNHKDFILVTDGEDKVIG 84
                69*****************99*99999988887777777777777666655 PP

  == domain 2    score: 0.8 bits;  conditional E-value: 0.91
                 TT-THHHHHHHHHH---E.EEEE-SS CS
     PF03720  15 ReSpaldiieeLleegae.vkiyDPk 39 
                  +S++ +++++L + +++ + +yD  
  ACD30867.1 131 ENSKIGHVVNTLINSDYHhIIVYDKD 156
                 5899999*****99998669999985 PP

>> PF00189  Ribosomal protein S3, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.046   1.8e+02      49      80 ..     160     191 ..     154     193 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.046
     PF00189  49 ekykeGkvplqtleadIdyayseaktkyGviG 80 
                 eky +G+++l  ++ +    + +++ k+G+ +
  ACD30867.1 160 EKYIRGYFSLPYIRRKLSLDVYHVYQKQGISN 191
                 89***************************986 PP

>> PF00036  EF hand
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.066   2.5e+02       8      15 ..     152     159 ..     150     160 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.066
                 HHTTTTSS CS
     PF00036   8 efDkDgdG 15 
                 ++DkD++G
  ACD30867.1 152 VYDKDKNG 159
                 69*****9 PP

>> PF09022  Staphostatin A
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.035   1.4e+02      44      70 ..     131     157 ..     118     163 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.035
     PF09022  44 nkditpdyicklinedsrkiilsnkdn 70 
                 +++   + + +lin d ++ii+++kd 
  ACD30867.1 131 ENSKIGHVVNTLINSDYHHIIVYDKDK 157
                 45566778999************9986 PP

>> PF12165  Domain of unknown function (DUF3594)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.041   1.6e+02       5      37 ..      39      71 ..      36     101 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.041
     PF12165  5 evfkdfkarraaivkalttdvedfykqcdpeke 37
                +vf+d+k   a +vka  +  +   k++d  k+
  ACD30867.1 39 DVFRDYKEHDALVVKADVNLKDVKTKLIDNHKD 71
                8**************976544444555666655 PP

>> PF07453  NUMOD1 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.1     0.071   2.7e+02       3      16 ..     150     166 ..     149     170 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.071
     PF07453   3 VyvYdldgn...ligkF 16 
                 ++vYd+d+n   +i  +
  ACD30867.1 150 IIVYDKDKNgekYIRGY 166
                 89******977777655 PP

>> PF04139  Rad9
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0     0.096   3.7e+02      67      97 ..      36      66 ..      12     102 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.096
     PF04139 67 svlsvfrslsakektvekikisidekksrli 97
                + l vfr  +++++ v k ++++++ k++li
  ACD30867.1 36 PALDVFRDYKEHDALVVKADVNLKDVKTKLI 66
                5699*******************99999976 PP

>> PF09764  Uncharacterized conserved protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0     0.093   3.6e+02      55      75 ..     143     163 ..     117     181 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.093
     PF09764  55 vlWDYHVillvkaekegkslv 75 
                 +  DYH i++ +++k+g++++
  ACD30867.1 143 INSDYHHIIVYDKDKNGEKYI 163
                 667999999998999888876 PP

>> PF07440  Caerin 1 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.12   4.8e+02       4      12 ..      81      89 ..      80      91 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.12
     PF07440  4 kVLGSVAKH 12
                kV GS+A H
  ACD30867.1 81 KVIGSIALH 89
                8******99 PP

>> PF05890  Eukaryotic rRNA processing protein EBP2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1     0.097   3.7e+02     113     132 ..      51      70 ..      44      74 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.097
     PF05890 113 mvKsDehMqkvkkkLleeka 132
                  vK+D  ++ vk+kL+++ +
  ACD30867.1  51 VVKADVNLKDVKTKLIDNHK 70 
                 69**************9876 PP

>> PF08225  Pseudin antimicrobial peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.19   7.4e+02      17      22 ..      64      69 ..      62      70 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.19
     PF08225 17 KLvsNH 22
                KL+ NH
  ACD30867.1 64 KLIDNH 69
                9***** PP

>> PF04867  Protein of unknown function (DUF643)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.3     0.072   2.8e+02      18      70 ..      26      74 ..       7      95 .. 0.74

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.072
     PF04867 18 einklyeteqltlkqkkqlysavkkiqeykiktGksveeivddiidpekefik 70
                ++n l   +  +     ++++ +k+    ++k+   ++++  ++id++k+fi 
  ACD30867.1 26 DVNHLLYLDSPA----LDVFRDYKEHDALVVKADVNLKDVKTKLIDNHKDFIL 74
                455554444333....4789999***************************995 PP

>> PF10813  Protein of unknown function (DUF2733)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.22   8.4e+02      15      29 ..      58      72 ..      56      73 .. 0.94

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.22
     PF10813 15 lkDveGepInvekDF 29
                lkDv+ + I+  kDF
  ACD30867.1 58 LKDVKTKLIDNHKDF 72
                89************9 PP

>> PF01531  Glycosyl transferase family 11
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.22   8.6e+02     135     168 ..      42      75 ..       5      76 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.22
     PF01531 135 keftlrDelreeiqnslrelqvelgsrpsefvgv 168
                 + ++ +D l +++   l++++ +l ++ ++f+ v
  ACD30867.1  42 RDYKEHDALVVKADVNLKDVKTKLIDNHKDFILV 75 
                 679999********99*****9999999999976 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (196 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       409  (0.0343351); expected 238.2 (0.02)
Passed bias filter:                      297  (0.0249328); expected 238.2 (0.02)
Passed Vit filter:                        26  (0.00218267); expected 11.9 (0.001)
Passed Fwd filter:                        26  (0.00218267); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              26  [number of targets reported over threshold]
# CPU time: 0.18u 0.05s 00:00:00.23 Elapsed: 00:00:01
# Mc/sec: 2350.80
//