# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_13450.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACD31158.1  [L=364]
Description: ftul2 rnd GIB00719CH01 "ribonuclease D"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.8e-44  152.5   5.6    7.9e-44  151.8   3.9    1.4  1  PF01612  3'-5' exonuclease
    4.1e-08   35.4   0.0    1.1e-07   34.1   0.0    1.7  1  PF00570  HRDC domain
  ------ inclusion threshold ------
       0.65   12.1   1.4        1.7   10.7   0.9    1.7  1  PF10105  Uncharacterized protein conserved in bacteria (DUF2
        2.9   10.4   0.5        8.2    8.9   0.3    1.8  1  PF12447  Protein of unknown function (DUF3683)
        9.7    8.9   0.1         24    7.6   0.0    1.7  1  PF03828  Poly(A) polymerase
         11    7.1   0.2         16    6.5   0.1    1.3  1  PF05448  Acetyl xylan esterase (AXE1)
         12    7.7   0.0         26    6.6   0.0    1.6  1  PF01871  AMMECR1
         22    7.5   3.5         16    8.0   0.1    2.5  1  PF06523  Protein of unknown function (DUF1106)
         31    7.1   0.1    4.6e+02    3.4   0.0    2.5  2  PF00165  Bacterial regulatory helix-turn-helix proteins, Ara
         37    5.7   0.0         61    5.0   0.0    1.3  1  PF01660  Viral methyltransferase
         41    6.9   0.0    1.3e+02    5.4   0.0    1.8  1  PF09479  Listeria-Bacteroides repeat domain (List_Bact_rpt)
         44    5.9   0.1    1.1e+02    4.6   0.1    1.6  1  PF02562  PhoH-like protein
         51    6.8   0.0    1.2e+02    5.6   0.0    1.7  1  PF10844  Protein of unknown function (DUF2577)
         65    6.5   0.0    3.3e+02    4.3   0.0    2.2  1  PF10362  Cytidylyltransferase C-terminal domain (DUF2432)
         84    5.4   1.3    1.9e+02    4.3   0.6    1.8  1  PF08383  Maf N-terminal region
    1.3e+02    4.5   0.4    3.6e+02    3.1   0.3    1.8  1  PF08557  Sphingolipid Delta4-desaturase (DES)
    1.5e+02    5.3   0.0    3.8e+02    4.0   0.0    1.7  1  PF00525  Alpha crystallin A chain, N terminal
    1.5e+02    4.6   0.0    4.3e+02    3.2   0.0    1.8  1  PF12611  Protein of unknown function (DUF3766)
    1.6e+02    4.2   0.0    2.6e+02    3.5   0.0    1.4  1  PF03886  Protein of unknown function (DUF330)
    2.9e+02    2.7   0.0    6.7e+02    1.5   0.0    1.4  1  PF09609  CRISPR-associated protein, GSU0054 family (Cas_GSU0
    3.2e+02    4.0   0.0    8.7e+02    2.5   0.0    1.7  1  PF09180  Prolyl-tRNA synthetase, C-terminal
    3.7e+02    3.4   0.0    8.8e+02    2.2   0.0    1.5  1  PF02402  Lysis protein
    3.7e+02    2.3   0.0    5.5e+02    1.7   0.0    1.2  1  PF00375  Sodium:dicarboxylate symporter family
    2.6e+03    1.2  10.1      7e+02    3.1   3.1    2.5  2  PF03011  PFEMP DBL domain


Domain and alignment annotation for each model:
>> PF01612  3'-5' exonuclease
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.8   3.9   1.9e-47   7.9e-44       3     173 ..       2     167 ..       1     168 [. 0.99

  Alignments for each domain:
  == domain 1    score: 151.8 bits;  conditional E-value: 1.9e-47
                 EEHSHHHHHHHHHHHTTSSEEEEEEEEC-SSTTTSSBBEEEEEEEECCEEEEECCTTSTTTHHHHHHHHT-TTSEEEE--HHHHHHHHHHHH----SSE CS
     PF01612   3 ivtteeeleelieelknlkvvavDtEttsldlisatlrlaliqigtkeeayiidpleleddlellkklledenitkVghnakfDlevlardfgielenl 101
                 i+ t+++l+++ie lkn + +avDtE+  +++  ++ +l+l+q+ t++e ++id+l++ + ++ lk+++ed+ i k++h+a++D+ +++r f  e+ n+
  ACD31158.1   2 IINTNKQLNNVIEILKNTSQIAVDTEFYWMRT--YYPELCLVQLATENEIFLIDTLKDLE-FKKLKEIFEDKDILKIIHSATNDIPIIKRFFNCEVNNI 97 
                 7899****************************..**************************.************************************** PP

                 EEHHHHHHHCCHHCT-SHHHHHHHHCSB----HCCCTS-TT.SSS-THHHHHHHHHHHHTHHHHHHHHHHHH CS
     PF01612 102 fdtmlaaavldyeeshsLasLaekllgeleldkeeqiakwqkarplleeqleYAaeDadvllrlfkkLekel 173
                 fdt+laa +l+++ + sL++L+++ l+ +e++ke+q ++w+ +rpl+++ql+YA +D+++l++l ++L+++l
  ACD31158.1  98 FDTQLAATFLGFQTQSSLKTLLKEILD-IEIEKESQFSDWR-NRPLTQNQLNYAIKDVEYLIQLKEYLQQQL 167
                 ***************************.*************.***************************998 PP

>> PF00570  HRDC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.1   0.0   2.6e-11   1.1e-07       9      47 ..     216     254 ..     214     264 .. 0.94

  Alignments for each domain:
  == domain 1    score: 34.1 bits;  conditional E-value: 2.6e-11
                 HHHHHHHHHHHTS-HHHHS-HHHHHHHHHH---SHHHHT CS
     PF00570   9 rewReelAreedvppyvilsdktLleiAeklPttleeLl 47 
                 ++wRe +A+e+++p ++i+++k L  iA  +P++l+ ++
  ACD31158.1 216 AQWRETIAQEKNIPVRFIFNNKILYTIAHINPKSLNSFE 254
                 79********************************99876 PP

>> PF10105  Uncharacterized protein conserved in bacteria (DUF2344)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.7   0.9   0.00042       1.7      83     161 ..     125     201 ..     101     225 .. 0.72

  Alignments for each domain:
  == domain 1    score: 10.7 bits;  conditional E-value: 0.00042
     PF10105  83 ealpegleileveeipkkepslsalieaaeYrvtleeeeeeklee.aveallaaeelvvekktkkgkkrevdirpllkel 161
                  +  ++ ++ + ++ p  +++l+ +i+ +eY ++l+e  +++l + + +++ ++e ++v+k++ ++     +i + + ++
  ACD31158.1 125 IEIEKESQFSDWRNRPLTQNQLNYAIKDVEYLIQLKEYLQQQLAKsEYQDFFEQELIEVQKTQFNS---IENIHAKIGNI 201
                 44555556666677788999999*************66666665559************9884332...33555555555 PP

>> PF12447  Protein of unknown function (DUF3683)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.3     0.002       8.2      63     113 ..     174     224 ..     159     227 .. 0.92

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.002
     PF12447  63 pylqddLldnkkRrkalvealehrlkeiekraegeerveelvaaarkavee 113
                  +++++L++ +k + + +e+++ ++ +i+k  e+++r + l+a+ r+++++
  ACD31158.1 174 DFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQRNAILIAQWRETIAQ 224
                 5899***************************************99998865 PP

>> PF03828  Poly(A) polymerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0    0.0057        24       6      28 ..     300     322 ..     295     343 .. 0.85

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0057
     PF03828   6 LigFFeyYgnkFdyenvvisirt 28 
                 +i+FF+ Y ++  ++ ++i  r 
  ACD31158.1 300 IIDFFDTYTKQLKFDSSIIASRK 322
                 79****************98775 PP

>> PF05448  Acetyl xylan esterase (AXE1)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.1    0.0038        16       8      55 ..     156     202 ..     149     234 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0038
                 HHHHTT--------TTHHHHHHHHHHHHHTS----EEEEE--S----E CS
     PF05448   8 leelkkYrgekeapeDFdefWkkeleelrkldleveleeadfelkave 55 
                 l +lk+Y  ++ a++++++f+++el e++k++ + ++e+ + ++  ++
  ACD31158.1 156 LIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFN-SIENIHAKIGNIQ 202
                 679**************************99654.5666666655555 PP

>> PF01871  AMMECR1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0    0.0062        26      68     102 ..     129     163 ..     110     185 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.0062
                 HHHHHT-TTS----GGGGGGEEEEEEEE---EE-- CS
     PF01871  68 iaaAleDpRFspvtkeeLdkleveVsvLselekie 102
                  ++ ++D+R  p+t+++L+    +V++L +l++  
  ACD31158.1 129 KESQFSDWRNRPLTQNQLNYAIKDVEYLIQLKEYL 163
                 5789*************************999865 PP

>> PF06523  Protein of unknown function (DUF1106)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.1    0.0039        16      57      83 ..      45      72 ..      38      79 .. 0.78

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.0039
     PF06523 57 nrkhvllyn.kkeyvfdklkelfpdeai 83
                 ++ ++l +  k+  f klke+f d+ i
  ACD31158.1 45 TENEIFLIDtLKDLEFKKLKEIFEDKDI 72
                5667777652699************987 PP

>> PF00165  Bacterial regulatory helix-turn-helix proteins, AraC family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.11   4.6e+02      17      34 ..     106     124 ..     103     126 .. 0.88
   2 ?    0.5   0.1      0.95     4e+03       5      24 ..     318     337 ..     315     337 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.11
                 HHTS.-HHHHHHHHHHH-- CS
     PF00165  17 evgf.SpsyfsrlFkkytG 34 
                  +gf  +s +++l+k+++ 
  ACD31158.1 106 FLGFqTQSSLKTLLKEILD 124
                 58*************9986 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 0.95
                 TS..--HHHHHHHHTS-HHH CS
     PF00165   5 lstnwsiadiAeevgfSpsy 24 
                 ++++  i+++A++++++ +y
  ACD31158.1 318 IASRKDIRSLAYNLNIDTNY 337
                 689999*********98876 PP

>> PF01660  Viral methyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.015        61     121     151 ..      47      77 ..      15      80 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.015
     PF01660 121 kyafahdslhdlslkeladallrkgkletly 151
                 + +f++d+l dl++k l + +++k +l+ ++
  ACD31158.1  47 NEIFLIDTLKDLEFKKLKEIFEDKDILKIIH 77 
                 349*********************9996655 PP

>> PF09479  Listeria-Bacteroides repeat domain (List_Bact_rpt)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0      0.03   1.3e+02      21      40 ..     202     221 ..     195     221 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.03
     PF09479  21 ydfsttvtgditLYAkWtkn 40 
                  +f+ ++  + +L A+W ++
  ACD31158.1 202 QKFDEKTQRNAILIAQWRET 221
                 56888889*********875 PP

>> PF02562  PhoH-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.1     0.026   1.1e+02      77     112 ..     153     188 ..     137     189 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.026
     PF02562  77 dpylrplydaLkdllgaekvekllekgkievaplaf 112
                   yl  l++ L++ l ++++++++e++ iev +++f
  ACD31158.1 153 VEYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQF 188
                 57999**************************99876 PP

>> PF10844  Protein of unknown function (DUF2577)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.029   1.2e+02       4      41 ..     264     301 ..     261     344 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.029
     PF10844   4 aikklavgavdaekpvdilfgevvsvsplevkidqkli 41 
                  ikk +v a++++k  d +  e +s s l+  +++k+i
  ACD31158.1 264 WIKKGVVTALNSSKSLDQVTLEQTSGSKLSTELNDKII 301
                 69**********************************98 PP

>> PF10362  Cytidylyltransferase C-terminal domain (DUF2432)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.078   3.3e+02       4      16 ..     350     362 ..     349     363 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.078
     PF10362   4 lVPpeIldYIlne 16 
                 +V+++ ++YIl++
  ACD31158.1 350 IVGKKLKEYILSN 362
                 799********76 PP

>> PF08383  Maf N-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.6     0.045   1.9e+02       5      13 ..      27      35 ..      26      38 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.045
     PF08383  5 dLYWmatyq 13
                ++YWm ty+
  ACD31158.1 27 EFYWMRTYY 35
                79***9975 PP

>> PF08557  Sphingolipid Delta4-desaturase (DES)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.3     0.088   3.6e+02       3      12 ..      25      34 ..      23      36 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.088
     PF08557  3 rddFyWtyte 12
                 ++FyW++t 
  ACD31158.1 25 DTEFYWMRTY 34
                689****985 PP

>> PF00525  Alpha crystallin A chain, N terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0     0.091   3.8e+02       7      30 ..     262     285 ..     260     304 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.091
     PF00525   7 hPwlrRplfpsffpsrifdQvFGE 30 
                 +Pw+++ +   + +s+ +dQv  E
  ACD31158.1 262 KPWIKKGVVTALNSSKSLDQVTLE 285
                 6*******************8655 PP

>> PF12611  Protein of unknown function (DUF3766)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0       0.1   4.3e+02       2      15 ..     269     282 ..     269     282 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.1
     PF12611   2 VITAmDreelkenv 15 
                 V+TA++++ + ++v
  ACD31158.1 269 VVTALNSSKSLDQV 282
                 9*****99888877 PP

>> PF03886  Protein of unknown function (DUF330)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.064   2.6e+02      97     117 ..     200     220 ..     158     231 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.064
     PF03886  97 dvqrFesdpggtavlsaqwrl 117
                 ++q+F+ + +++a+l aqwr 
  ACD31158.1 200 NIQKFDEKTQRNAILIAQWRE 220
                 69*****************95 PP

>> PF09609  CRISPR-associated protein, GSU0054 family (Cas_GSU0054)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.16   6.7e+02     364     401 ..     246     283 ..     233     289 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.16
     PF09609 364 eleedddkllvgllgLdpgsekrkiiplsssrswasvT 401
                 + +  +  ++  l++L+p+ +k  ++ l+ss+s   vT
  ACD31158.1 246 NPKSLNSFEHSELKSLKPWIKKGVVTALNSSKSLDQVT 283
                 555556678999*********************99998 PP

>> PF09180  Prolyl-tRNA synthetase, C-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.21   8.7e+02       2      28 ..     202     228 ..     201     242 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.21
     PF09180   2 eefkkalekkgfvlapwcgdeeceeki 28 
                 ++f ++++++ + +a+w ++ + e++i
  ACD31158.1 202 QKFDEKTQRNAILIAQWRETIAQEKNI 228
                 57888999999***********99988 PP

>> PF02402  Lysis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.21   8.8e+02      18      28 ..      91     101 ..      85     102 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.21
     PF02402  18 aCQaNyiRDvq 28 
                  C +N+i D+q
  ACD31158.1  91 NCEVNNIFDTQ 101
                 5********98 PP

>> PF00375  Sodium:dicarboxylate symporter family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0      0.13   5.5e+02     234     262 ..      90     118 ..      73     122 .. 0.81

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.13
     PF00375 234 tklnplkflkkilpalltAfsTsSSaatL 262
                  + ++  ++ + l a +++f T+SS  tL
  ACD31158.1  90 FNCEVNNIFDTQLAATFLGFQTQSSLKTL 118
                 34477788899999***********9998 PP

>> PF03011  PFEMP DBL domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.1       1.3   5.5e+03      51      69 ..      56      74 ..      53     134 .. 0.66
   2 ?    3.1   3.1      0.17     7e+02      54     112 ..     154     212 ..     148     237 .. 0.77

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.3
     PF03011 51 KkkeWkkikehfkkqkkik 69
                K  e+kk ke f++++  k
  ACD31158.1 56 KDLEFKKLKEIFEDKDILK 74
                6678888888888776554 PP

  == domain 2    score: 3.1 bits;  conditional E-value: 0.17
     PF03011  54 eWkkikehfkkqkkikkkakedldlesvleklllqkeikkakgdakelkkikellkkek 112
                 e+    + + +q+  k++ ++ ++ e ++ +++++++i++ + +  +++k+ e ++++ 
  ACD31158.1 154 EYLIQLKEYLQQQLAKSEYQDFFEQELIEVQKTQFNSIENIHAKIGNIQKFDEKTQRNA 212
                 55555677888877777799999999999999999*********999999999887765 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (364 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       831  (0.0697616); expected 238.2 (0.02)
Passed bias filter:                      240  (0.0201478); expected 238.2 (0.02)
Passed Vit filter:                        24  (0.00201478); expected 11.9 (0.001)
Passed Fwd filter:                        24  (0.00201478); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              24  [number of targets reported over threshold]
# CPU time: 0.25u 0.03s 00:00:00.28 Elapsed: 00:00:00
# Mc/sec: 3143.36
//