# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_13451.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ACD31313.1  [L=366]
Description: ftul2 wbtG GIB00719CH01 "glycosyl transferase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.5e-18   68.3   0.3    5.8e-18   67.5   0.2    1.4  1  PF00534  Glycosyl transferases group 1
  ------ inclusion threshold ------
        3.8    9.9   2.1        9.6    8.6   0.8    2.2  1  PF10364  Putative capsular polysaccharide synthesis protein
        4.4    9.8   0.1         11    8.6   0.1    1.6  1  PF10798  Biofilm development protein YmgB/AriR
          7    8.8   0.0         11    8.2   0.0    1.3  1  PF08323  Starch synthase catalytic domain
        8.8    8.8   0.0         43    6.6   0.0    2.0  1  PF04628  Sedlin, N-terminal conserved region
        9.1    8.5   0.0         19    7.5   0.0    1.5  1  PF10391  Fingers domain of DNA polymerase lambda
         23    7.2   0.0         54    6.0   0.0    1.6  1  PF08076  Tetracycline resistance determinant leader peptide
         38    6.9   0.0         88    5.7   0.0    1.6  1  PF08660  Oligosaccharide biosynthesis protein Alg14 like
         42    6.7   0.1         95    5.6   0.0    1.5  1  PF05986  ADAM-TS Spacer 1
         50    6.0   0.0         54    5.9   0.0    1.2  1  PF01915  Glycosyl hydrolase family 3 C terminal domain
         58    6.0   0.1    2.5e+02    3.9   0.0    2.0  1  PF12197  Bacillus cereus group antimicrobial protein
         83    5.8   0.1    1.8e+02    4.7   0.0    1.6  1  PF03800  Nuf2 family
         89    4.6   0.1    1.5e+02    3.8   0.0    1.4  1  PF10149  Carbohydrate (N-acetylglucosamine 6-O) sulfotransfe
    1.2e+02    3.9   0.1    2.1e+02    3.0   0.1    1.3  1  PF05816  Toxic anion resistance protein (TelA)
    1.3e+02    5.3   0.4    2.8e+02    4.3   0.2    1.5  1  PF02757  YLP motif
    1.5e+02    4.8   0.0    3.8e+02    3.5   0.0    1.6  1  PF05486  Signal recognition particle 9 kDa protein (SRP9)
    1.9e+02    3.5   0.0    4.4e+02    2.4   0.0    1.5  1  PF04131  Putative N-acetylmannosamine-6-phosphate epimerase
    2.1e+02    4.9   0.0    6.5e+02    3.4   0.0    1.8  1  PF10362  Cytidylyltransferase C-terminal domain (DUF2432)


Domain and alignment annotation for each model:
>> PF00534  Glycosyl transferases group 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.5   0.2   1.1e-21   5.8e-18       4     165 ..     183     340 ..     180     348 .. 0.80

  Alignments for each domain:
  == domain 1    score: 67.5 bits;  conditional E-value: 1.1e-21
                 HHHHH----TT-EEEEE----------HHHHHHHHCS-HHHHHTEEEEE--....---HHHHHHHHH---GGGEEE------HHHHHHH-SEEEE-.-S CS
     PF00534   4 ekrkklgknekkkiilsvgrlekeKgvdllikafallkeqenpnlklvivGdgeeekelkklaeelelsdnvifvgevpredleelyrnadifvlpsrs 102
                 + r  +  +++ kii+ ++r   +K++ ++++++ ll +  np l+++i+G +  +    +  +++    n +fv e+   d  e++   d+++ +s+ 
  ACD31313.1 183 KFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKS-NPSLRFLIAGRECSKIDIGSYLDNKSN-VNKFFVFESV--DSSEYLPVLDLYLSTSKV 277
                 556677889999*************************995.**********44444444444444444.3444444444..799*************** PP

                 -----HHHHHHH----EEEETT---CHHHHHHT---EE-SS-HHHHHHHHHHHHH-H.....HHHHHH CS
     PF00534 103 EgfGivllEAmaaglpviasnvggpaeivkdgvtGllvkpkdaealaeaiekllkde.....elrerl 165
                 Egf+  l EAm + +p++asnvg +++i++ +   + + ++  ++++e+i k+l+            +
  ACD31313.1 278 EGFPNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQG-NKEIIEKIMKVLETTvvmkkR----M 340
                 *********************************87777777.599*********988744333....3 PP

>> PF10364  Putative capsular polysaccharide synthesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.8    0.0017       9.6      32      98 ..     159     222 ..     130     226 .. 0.83

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0017
     PF10364  32 YaleWFDneikelfgiDvfkkdfdkeegyqtfqnekasllviklekLsklkeaiedFLdvddvvvvk 98 
                 +  + F   i + f  Dvfk +f k e + + ++ + ++ +i +   ++++++i+ FL++ ++ ++ 
  ACD31313.1 159 FKNQCF---IANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKS 222
                 555544...6677888*********************************************998875 PP

>> PF10798  Biofilm development protein YmgB/AriR
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.1    0.0019        11      23      44 ..     319     338 ..     309     345 .. 0.84

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.0019
     PF10798  23 nKdiIlkLihkletesdvvrad 44 
                 nK+iI k +++let+  vv++ 
  ACD31313.1 319 NKEIIEKIMKVLETT--VVMKK 338
                 9*************9..56555 PP

>> PF08323  Starch synthase catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0019        11     116     162 ..      69     113 ..      12     158 .. 0.77

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0019
     PF08323 116 fsraalelleklgwkpdvihahDWhtalvpallkelykkrglfkkik 162
                      ++++++   kpdviha  +h+ ++ +l k +y+k ++++ i+
  ACD31313.1  69 VLFKYIKIIRR--IKPDVIHAWMYHANVISILCKPFYRKTKYINSIR 113
                 33344566666..48**********************9888777766 PP

>> PF04628  Sedlin, N-terminal conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.6   0.0    0.0078        43      99     120 ..      91     112 ..      81     118 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.6 bits;  conditional E-value: 0.0078
     PF04628  99 helyvklllNPFyeenepiksp 120
                 h++++ +l+ PFy++++ i+s 
  ACD31313.1  91 HANVISILCKPFYRKTKYINSI 112
                 8899*************99985 PP

>> PF10391  Fingers domain of DNA polymerase lambda
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0    0.0034        19      23      45 ..     136     160 ..     132     161 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.0034
     PF10391  23 irtLeDL..keekakLtraQqiGlk 45 
                 ++ + DL  +++k++L+ +Q iG+k
  ACD31313.1 136 FSKFSDLtlNNSKKSLEDHQNIGFK 160
                 67789999777788*********97 PP

>> PF08076  Tetracycline resistance determinant leader peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0    0.0098        54      14      28 .]      28      42 ..      27      42 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.0098
     PF08076 14 DkSiyhWDFlslfGf 28
                DkSiyh   +sl+G+
  ACD31313.1 28 DKSIYHITVISLMGR 42
                9*****999999987 PP

>> PF08660  Oligosaccharide biosynthesis protein Alg14 like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.016        88      63      96 ..      51      85 ..       7     109 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.016
     PF08660 63 arevgqsyl.tsifttllsllsalllllrekpdvi 96
                a+ v+  +l  + f++l+ l++ +++++r+kpdvi
  ACD31313.1 51 AYGVKVYTLnLNKFNVLFVLFKYIKIIRRIKPDVI 85
                55555544414589********************9 PP

>> PF05986  ADAM-TS Spacer 1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.017        95      14      54 ..     307     347 ..     298     362 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.017
     PF05986  14 kgYndvvtIPaGAthIkirelkasknyLalknkdgeylLng 54 
                 +gY +v+++ +G ++I  + +k  +  +++k++ +ey++n 
  ACD31313.1 307 NGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINN 347
                 8***************988999999**************95 PP

>> PF01915  Glycosyl hydrolase family 3 C terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0    0.0097        54     103     151 ..     309     355 ..     144     358 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.0097
                 -----SSTTHHHHHHHHHHHHHT--EEEEE-S-GGGGGG-T.T-SEEEE CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF01915 103 drtdlalpenqdeLieavaaankpvvvvlhsggpvdmepwaekvkAila 151
                 + + ++l ++ +e+ie+++++   +vv+    + + ++++   ++Ail+
  ACD31313.1 309 YGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFS--IEAILE 355
                 456789**********************9999999999998..888886 PP

>> PF12197  Bacillus cereus group antimicrobial protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.045   2.5e+02      10      24 ..      43      57 ..      40      58 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.045
     PF12197 10 GvFAnsFsqdgttwy 24
                GvFAn+ +  g + y
  ACD31313.1 43 GVFANKLEAYGVKVY 57
                9*******9999877 PP

>> PF03800  Nuf2 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.032   1.8e+02      49     108 ..     295     354 ..     246     361 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.032
     PF03800  49 lellmgitresleeameaaaedieypelyeeslqllallkalkklleacgvndFtlsDll 108
                 + + +g  ++ l+++ e  + ++ ++e++e+ +++l  ++ +kk +++  +n+F+++ +l
  ACD31313.1 295 VASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSIEAIL 354
                 555666678889999999999999********************************9887 PP

>> PF10149  Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.028   1.5e+02      48     115 ..     142     209 ..     126     226 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.028
     PF10149  48 yglwskervlyEQPkvkfqyqyllvaetdteedteslvacSsFssfNqltedtlrisaikvieeDtnl 115
                   l + +++l++  ++ f+ q  +    d++  + s++ +  F   N l ++ + i  i   + D+n 
  ACD31313.1 142 LTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNI 209
                 55667788999999*******988888899888************************99999999997 PP

>> PF05816  Toxic anion resistance protein (TelA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.1     0.039   2.1e+02     207     226 ..     317     336 ..     314     341 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.039
     PF05816 207 knNqeLiekiqsaittTipa 226
                 ++N+e+ieki ++++tT+ +
  ACD31313.1 317 QGNKEIIEKIMKVLETTVVM 336
                 79***************965 PP

>> PF02757  YLP motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.2      0.05   2.8e+02       1       6 [.     261     266 ..     261     266 .. 0.94

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.05
     PF02757   1 snEYLP 6  
                 s+EYLP
  ACD31313.1 261 SSEYLP 266
                 89***9 PP

>> PF05486  Signal recognition particle 9 kDa protein (SRP9)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.069   3.8e+02       3      21 ..     207     225 ..     206     231 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.069
     PF05486   3 ktwdeFleqSskLleanPs 21 
                 k++  Fl+ + +Ll+ nPs
  ACD31313.1 207 KNISRFLQIANLLLKSNPS 225
                 68999*************8 PP

>> PF04131  Putative N-acetylmannosamine-6-phosphate epimerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0     0.079   4.4e+02      32      48 ..     193     209 ..     188     224 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.079
                 -S--B---B---TTS-- CS
     PF04131  32 dlPiiGivkrdlpdsev 48 
                 ++ iiGi+ r+  d+++
  ACD31313.1 193 NVKIIGIIARNHADKNI 209
                 689********998875 PP

>> PF10362  Cytidylyltransferase C-terminal domain (DUF2432)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.12   6.5e+02       7      16 ..     338     347 ..     338     348 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.12
     PF10362   7 peIldYIlne 16 
                 +++++YI+n+
  ACD31313.1 338 KRMREYIINN 347
                 589****975 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (366 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       468  (0.0392881); expected 238.2 (0.02)
Passed bias filter:                      230  (0.0193083); expected 238.2 (0.02)
Passed Vit filter:                        18  (0.00151108); expected 11.9 (0.001)
Passed Fwd filter:                        18  (0.00151108); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              18  [number of targets reported over threshold]
# CPU time: 0.25u 0.03s 00:00:00.28 Elapsed: 00:00:00
# Mc/sec: 3160.63
//