hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_13440.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ACD30141.1
Accession:      [none]
Description:    ftul2 pyrD GIB00719CH01 "diyroorotate dehydrogenase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0050003  FMN-linked oxidoreductases                      75.9      2e-22   1
0051899  FMN-linked oxidoreductases                      63.3    1.1e-19   1
0049708  FMN-linked oxidoreductases                      60.3    1.3e-18   1
0052481  FMN-linked oxidoreductases                      57.2    5.5e-17   1
0047140  FMN-linked oxidoreductases                      55.0    3.1e-16   1
0036258  FMN-linked oxidoreductases                      54.6    1.1e-15   1
0046721  FMN-linked oxidoreductases                      53.1    1.4e-15   1
0046599  FMN-linked oxidoreductases                      48.7    5.1e-14   1
0048029  FMN-linked oxidoreductases                      38.9    1.3e-11   1
0039992  Ribulose-phoshate binding barrel                38.7    1.5e-10   1
0041152  Aldolase                                        36.8    5.7e-10   1
0049146  Ribulose-phoshate binding barrel                30.0    1.2e-08   1
0050135  FMN-linked oxidoreductases                      30.3    2.4e-08   1
0041658  Aldolase                                        32.1    4.1e-08   1
0045712  Ribulose-phoshate binding barrel                27.2    7.7e-08   1
0049739  ThiG-like                                       24.9    8.3e-08   1
0047026  FMN-linked oxidoreductases                      29.0    1.1e-07   1
0049674  Ribulose-phoshate binding barrel                27.3    1.3e-07   1
0044760  FMN-linked oxidoreductases                      28.2      2e-07   1
0049629  Ribulose-phoshate binding barrel                27.1    2.2e-07   1
0052714  Ribulose-phoshate binding barrel                25.8    3.8e-07   1
0047101  Ribulose-phoshate binding barrel                25.5    5.2e-07   1
0049848  Aldolase                                        29.6    5.8e-07   1
0049228  Ribulose-phoshate binding barrel                24.9      7e-07   1
0052610  FMN-linked oxidoreductases                      27.8    8.3e-07   1
0049587  FMN-linked oxidoreductases                      25.6    1.2e-06   1
0051598  Ribulose-phoshate binding barrel                24.7    1.9e-06   1
0049675  Ribulose-phoshate binding barrel                23.1    2.3e-06   1
0052356  Ribulose-phoshate binding barrel                24.9    3.4e-06   1
0048998  Ribulose-phoshate binding barrel                24.5    5.5e-06   1
0036628  Ribulose-phoshate binding barrel                23.9      8e-06   1
0045046  Thiamin phosphate synthase                      21.9    9.2e-06   1
0038072  Ribulose-phoshate binding barrel                22.9    1.2e-05   1
0051442  Ribulose-phoshate binding barrel                22.5    1.2e-05   1
0050201  FMN-linked oxidoreductases                      20.3    1.3e-05   1
0051164  Ribulose-phoshate binding barrel                22.3    2.6e-05   1
0044928  Triosephosphate isomerase (TIM)                 19.9    3.4e-05   1
0048768  Ribulose-phoshate binding barrel                18.8      9e-05   1
0048294  Aldolase                                        17.5      9e-05   1
0047889  Ribulose-phoshate binding barrel                15.9    0.00012   1
0047125  Ribulose-phoshate binding barrel                16.1    0.00016   1
0039781  Ribulose-phoshate binding barrel                17.9    0.00021   1
0049721  CutC-like                                       16.2    0.00035   1
0038429  FMN-linked oxidoreductases                      14.7    0.00045   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0048029    1/1       9   247 ..     1   414 []    38.9  1.3e-11
0036258    1/1      27   240 ..    88   367 .]    54.6  1.1e-15
0046599    1/1      27   228 ..     1   311 []    48.7  5.1e-14
0049708    1/1      27   244 ..     1   409 []    60.3  1.3e-18
0050003    1/1      27   242 ..    80   359 .]    75.9    2e-22
0051899    1/1      29   243 ..     1   312 []    63.3  1.1e-19
0052481    1/1      29   242 ..     1   311 []    57.2  5.5e-17
0047140    1/1      54   247 ..    74   312 .]    55.0  3.1e-16
0039992    1/1      66   244 ..     1   251 []    38.7  1.5e-10
0036628    1/1      74   244 ..     1   239 []    23.9    8e-06
0044760    1/1      75   244 ..    52   305 .]    28.2    2e-07
0044928    1/1      77   246 ..     1   226 []    19.9  3.4e-05
0052356    1/1      79   244 ..     1   206 []    24.9  3.4e-06
0041152    1/1      80   248 ..     1   225 []    36.8  5.7e-10
0051598    1/1      83   244 ..     1   254 []    24.7  1.9e-06
0049587    1/1      86   248 ..   131   349 .]    25.6  1.2e-06
0050135    1/1      92   242 ..   112   310 .]    30.3  2.4e-08
0039781    1/1     106   246 ..   173   323 .]    17.9  0.00021
0046721    1/1     107   244 ..   169   336 .]    53.1  1.4e-15
0049848    1/1     107   228 ..    87   211 .]    29.6  5.8e-07
0045046    1/1     109   244 ..    74   206 .]    21.9  9.2e-06
0049721    1/1     109   244 ..    89   247 .]    16.2  0.00035
0047026    1/1     134   247 ..   227   359 .]    29.0  1.1e-07
0048998    1/1     140   244 ..   142   241 .]    24.5  5.5e-06
0049629    1/1     148   246 ..   157   253 .]    27.1  2.2e-07
0047125    1/1     160   244 ..   169   252 .]    16.1  0.00016
0041658    1/1     162   238 ..   179   251 .]    32.1  4.1e-08
0052610    1/1     167   243 ..   153   231 .]    27.8  8.3e-07
0038429    1/1     170   247 ..   273   364 .]    14.7  0.00045
0049228    1/1     170   244 ..   151   230 .]    24.9    7e-07
0047101    1/1     171   248 ..   145   220 .]    25.5  5.2e-07
0047889    1/1     171   248 ..   140   213 .]    15.9  0.00012
0049146    1/1     171   244 ..   176   261 .]    30.0  1.2e-08
0049674    1/1     171   246 ..   144   221 .]    27.3  1.3e-07
0049675    1/1     171   247 ..   147   221 .]    23.1  2.3e-06
0050201    1/1     171   247 ..   161   229 .]    20.3  1.3e-05
0052714    1/1     171   245 ..   141   217 .]    25.8  3.8e-07
0048294    1/1     174   238 ..   170   234 .]    17.5    9e-05
0048768    1/1     178   242 ..   191   254 .]    18.8    9e-05
0045712    1/1     179   238 ..   187   247 .]    27.2  7.7e-08
0049739    1/1     180   244 ..   163   242 .]    24.9  8.3e-08
0051164    1/1     180   242 ..   162   222 .]    22.3  2.6e-05
0051442    1/1     182   242 ..   173   230 .]    22.5  1.2e-05
0038072    1/1     185   247 ..   183   248 .]    22.9  1.2e-05

Alignments of top-scoring domains:
0048029: domain 1 of 1, from 9 to 247: score 38.9, E = 1.3e-11
                   *->delllllglrllyllelllpelrqylsladleelafrrlprslfdyl
                                                                     
  ACD30141.1     -    ----------------------------------------------- -    

                   dggaddeltlgrnlaafddvllrprvlvdvddvdlsttilglklknPlvl
                                                                  +++
  ACD30141.1     9 -----------------------------------------------III 11   

                   apmgfgglsepieaeialaraaaelgggipiilgemgnvsle.rlaaavs
                   +p  fg++ +       +    +   +g  ++    g + ++++  +++ 
  ACD30141.1    12 SP-PFGKYLK-------FKETSNV--YGSFTVNRRWGLIKQAiKTIRKID 51   

                   gagglgsfglyalgdlevleellrrakaagikpigvnlgkpgeggalaai
                   + + ++ +gl ++g    l++     +a  i+ +++  +++++ +a+  +
  ACD30141.1    52 KNAWRNKIGLRNPG----LANTNPPKRAQDIISLAALDMSDWHSFAETLK 97   

                   kvseagadaidlnlgaplvdpvvdvgsistlggdpelvledlkalreavg
                   +  +a    i++n+g+p+  ++vd+ + ++++                 +
  ACD30141.1    98 LPKFAQHRNIEINIGCPN-ASIVDFPAELAPLFE---------------D 131  

                   vpvivKlvptved...AkaaeeaGaDaivvsga.....GG.tgldvgppt
                     + +K+ ptv++++++++ ++ G+    + +++ +++GG++g +   ++
  ACD30141.1   132 RNISIKMPPTVDHnakIREYLAVGITTFHLCNTiptakGGiSGYPLHKYS 181  

                   lealaevaealgelglrgripviadGGirtgedaakalalGAdaVmvGra
                   l a++ +++ +g     + i +i+ GGi t +da k++++GAd   + + 
  ACD30141.1   182 LPAIKKARQEFG-----DSITIIGGGGIYTLDDAKKYIEAGADHLSLSSI 226  

                   flgapeaggpegvknllealleelrlimallGvrslaelrgsdlllrlll
                   ++      g++ vk++++++l++                           
  ACD30141.1   227 MFNPI--RGKKLVKEIVKFWLDD--------------------------- 247  

                   lklldlsgllllllllldlllllllelevgtvtpdpqagnpvprla..rlralagginrmglnnlgldalleel
                      ++g+ t++ ++g ++  + ++r  +  ++ n +gl+n+gl  +    
  ACD30141.1    27    VYGSFTVNRRWGLIKQAIKtiRKIDKNAWRNKIGLRNPGLANTNPPK 73   

                   ravrlavvkraapdvpvgvnlggnkpaefgvddyelarraleaGadaivl
                   ra           d++ ++ l +++ + f+    e +++ + a    i++
  ACD30141.1    74 RAQ----------DIISLAALDMSDWHSFA----ETLKLPKFAQHRNIEI 109  

                   nvsapnlpglrkdqgggallpdpelvlelikalkeavg.lpvivklapgl
                   n+++p                    ++++ ++l+ ++ +  + +k+ p  
  ACD30141.1   110 NIGCP-----------------NASIVDFPAELAPLFEdRNISIKMPP-- 140  

                   tgvdtvelakraeeaGadavvvsnttggrgldgttrrvaeagglsGaplk
                     vd  + +++ ++ G+   ++ nt             +  gg+sG pl+
  ACD30141.1   141 -TVDHNAKIREYLAVGITTFHLCNTIP-----------TAKGGISGYPLH 178  

                   paslellreiaeavggdipviadGGIrtgedaakalaaGAdaVqvgsall
                    +sl +++  ++ +g++i +i++GGI t +da+k+++aGAd   + s ++
  ACD30141.1   179 KYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMF 228  

                   yagpalveelakelkaameltglaslaelrgkllripkdvpllstlilglklknPiilApmadvtdaelaaalalaggggvlg
                                                                   ++
  ACD30141.1    27    ---------------------------------------------VY 28   

                   ktmtpepqagnpvprarrl....deaginrlgfndlgaaaelrrllkllv
                   +++t  ++ g ++++++   +++ +a+ n +g+ ++g+a  +   ++   
  ACD30141.1    29 GSFTVNRRWGLIKQAIKTIrkidKNAWRNKIGLRNPGLANTNPPKRA--- 75   

                   ksiaevpiivnlvgggireldaedarllleagadavelnigcpntpv..l
                       +++  + l +++  ++ ae ++l   a    +e+nigcpn   +++
  ACD30141.1    76 ---QDIISLAALDMSDWHSF-AETLKLPKFAQHRNIEINIGCPNASIvdF 121  

                   gallakdpelvaivvaavkkavkvpvvvkivpgvddlveiakaleeaGad
                    a+la  +e             ++ + +k+ p+vd+  + +++ ++ G+ 
  ACD30141.1   122 PAELAPLFE-------------DRNISIKMPPTVDH-NAKIREYLAVGIT 157  

                   aiivtnttagghlglellkpilkvgigglsgrplrplalelvpqlakav.
                    + + nt              + + +gg+sg pl+ ++l ++++ ++++ 
  ACD30141.1   158 TFHLCNT--------------IPTAKGGISGYPLHKYSLPAIKKARQEFg 193  

                   .diPviasGGIrsgedaaealaaGAdaVqvGtaflytpealaeikvklal
                   ++i +i+ GGI +++da+++++aGAd   + ++++               
  ACD30141.1   194 dSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMF--------------- 228  

                   llakdgdtsitelvGglslelllnlldlralalrrllrpllfyldgetahrltlaflrigllprvlvvs
                                                                     
  ACD30141.1     -    ----------------------------------------------- -    

                   dvdlstellglklknPfglapmgdknlelaralaalgaglvvtgtvtpvp
                                                            v g++t+  
  ACD30141.1    27 -----------------------------------------VYGSFTVNR 35   

                   qegnpkpr..lfrlpedealinlyglnnegldallerlkalkalllllll
                   + g +k  ++ +r ++++a+ n  gl+n+gl+++ +  +a          
  ACD30141.1    36 RWGLIKQAikTIRKIDKNAWRNKIGLRNPGLANTNPPKRAQD-------- 77   

                   eaggplivqiggsglfgsrpedlaeaaelle....pladaielnlscPak
                         i+++++      + +d+   ae l+  + ++   ie+n++cP+ 
  ACD30141.1    78 ------IISLAA-----LDMSDWHSFAETLKlpkfAQHRNIEINIGCPN- 115  

                   pglggllgaalledfiaaarraveagadiielgiasgylldgfliplanl
                                                                     
  ACD30141.1     - -------------------------------------------------- -    

                   raleyGndpelllelikalreavg.vPlvivKirpglsvedieeiakale
                              ++++ ++l   + +   +++K+ p  +v++ ++ +++ +
  ACD30141.1   116 ---------ASIVDFPAELAPLFEdRN-ISIKMPP--TVDHNAK-IREYL 152  

                   eaGadgiivsnttagghgrtslegvtgglsglpllpasleliaalrealg
                   + G+  +++ nt++          ++gg+sg+pl+ +sl++i++ r+++g
  ACD30141.1   153 AVGITTFHLCNTIPT---------AKGGISGYPLHKYSLPAIKKARQEFG 193  

                   gripviavGGIrtgedaakalaaGAdgVmvgrallyagpelvleileelk
                   ++i +i+ GGI t +da+k ++aGAd   + + +   +p + +++++e+ 
  ACD30141.1   194 DSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMF--NPIRGKKLVKEIV 241  

                   allallgvssleelvgsdHelgtvtpdpqagnptprl..arlaedagginrlglnnlgldavleel
                      ++g++t++ ++g ++  +++ r +++ ++ n +gl n+gl+ +    
  ACD30141.1    27    VYGSFTVNRRWGLIKQAIktIRKIDKNAWRNKIGLRNPGLANTNP-- 71   

                   relrkelvrelapdiplivnlggnkltedavedyvelarrlee....gad
                                ++  i++l++      +++d++ +a+ l+  + +   
  ACD30141.1    72 -----------PKRAQDIISLAA-----LDMSDWHSFAETLKLpkfaQHR 105  

                   alelnvssPntpglrelqlglalgllpelllevveavkkavglpvivKla
                    +e+n+++Pn          +++   p++l++++e      +  + +K++
  ACD30141.1   106 NIEINIGCPN----------ASIVDFPAELAPLFE------DRNISIKMP 139  

                   pdlteediaeiaraaeeagadgiivtNttggrlldlepllgveagglsga
                   p++   d+ + +r  ++ g+   ++ Nt           + +  gg+sg 
  ACD30141.1   140 PTV---DHNAKIREYLAVGITTFHLCNT-----------IPTAKGGISGY 175  

                   alkplalrlvaevreavggdipiigvGGIrtgedalealaaGAsaVqvgt
                   +l+ ++l +++  r+++g++i iig+GGI+t +da ++++aGA+   + +
  ACD30141.1   176 PLHKYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSS 225  

                   ally..egpalvkeilkeleallalkgfsslselvglllrlDlstellglklknPiglApmgvskdaeaiaalaagglGiielgtvtl
                                                                g++t+
  ACD30141.1    29    ------------------------------------------GSFTV 33   

                   apqegvtdprvrrl....gaglinleglnnrglealllelakaagikglp
                     + g ++ +++ + +++++++ n +gl+n+gl       ++        
  ACD30141.1    34 NRRWGLIKQAIKTIrkidKNAWRNKIGLRNPGLANTNPPKRAQD------ 77   

                   lgvniggsgpeelaeaakllvrlleagadaielnigcpntgggaallldp
                    +++++++++ ++   a+ l  +  a    ie+nigcp          + 
  ACD30141.1    78 -IISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCP----------NA 116  

                   elllelikalreavg.ipvivKirpgidtaedveiakaleeaGladaiiv
                   +++ ++ ++l   + +  + +K+ p +d+      ++  ++ G       
  ACD30141.1   117 SIV-DFPAELAPLFEdRNISIKMPPTVDHNAK---IREYLAVG------- 155  

                   snrtggtlaadigpgsllttrlvehgglsgdalpplalellaevaeavgd
                              i +++l++t  ++ gg+sg +l+ ++l ++++ ++++gd
  ACD30141.1   156 -----------ITTFHLCNTIPTAKGGISGYPLHKYSLPAIKKARQEFGD 194  

                   .ipviadGGIrsgedaakalalGAdaVmiGraflyggpalleeikkella
                    i++i+ GGI++ +da+k++++GAd   + + ++  +p   ++++ke+++
  ACD30141.1   195 sITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMF--NPIRGKKLVKEIVK 242  

                   amallgvkslselvgllkllllLsttllglklknPlglaaglvdkdaeailalaalgfgiielgtvtl
                                                                g++t+
  ACD30141.1    29    ------------------------------------------GSFTV 33   

                   apmagvtdprlrrl....gagllnreglnndgleaalkllrralkagkpg
                     + g  + ++  + +++ ++++n +gl n+gl  +    r+       +
  ACD30141.1    34 NRRWGLIKQAIKTIrkidKNAWRNKIGLRNPGLANTNPPKRA------QD 77   

                   lpvgvnlggnrpedlaeaarlleeagadailelnlgcp.....ntlggsa
                   ++  + l  ++   +ae ++l+  a    i e+n+gcp++ +++ ++ +a
  ACD30141.1    78 IISLAALDMSDWHSFAETLKLPKFAQHRNI-EINIGCPnasivDFPAELA 126  

                   llkdpelllelleavkeavdvpvivKispgvgiediediakalveaGada
                    l++               d ++ +K+ p v  ++ +  ++  ++ G+  
  ACD30141.1   127 PLFE---------------DRNISIKMPPTV--DHNAK-IREYLAVGITT 158  

                   ivvsntthggrqldiegvdlivaqgpeagglsGnalapaaleliaeiada
                   +++ nt                   + +gg+sG +l+ ++l +i++ +++
  ACD30141.1   159 FHLCNTI-----------------PTAKGGISGYPLHKYSLPAIKKARQE 191  

                   vkgdipviadGGIrsgedaakalalGAdaVmiGraflytgpalveeilke
                   ++++i +i+ GGI++ +da k++++GAd   + + ++  +p ++++++ke
  ACD30141.1   192 FGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMF--NPIRGKKLVKE 239  

                   lrlamallgigsleelvgslkllglinrmglnnlglealleeiralkdaagdlpvivqlgvgsdpedlae
                      ++ n +gl n+gl  +    ra      d++  + l   sd   +ae
  ACD30141.1    54    AWRNKIGLRNPGLANTNPPKRA-----QDIISLAALD-MSDWHSFAE 94   

                   aarraeeaGadaielnlgcPntkvlrgggaallqdpellleivkavreav
                    +++   a    ie+n+gcPn               + + +  ++++  +
  ACD30141.1    95 TLKLPKFAQHRNIEINIGCPN---------------ASIVDFPAELAPLF 129  

                   g.ipvivKlrpggddtvelaraaeeaGadgiivhnrtgtqlidvearkal
                    +  + +K+ p ++d  + +r  ++ G+  +++ n+++            
  ACD30141.1   130 EdRNISIKMPP-TVDHNAKIREYLAVGITTFHLCNTIP------------ 166  

                   lglglgsinetgglsgpaippaaleliaevreavp.gipvianGGIrtge
                           +  gg+sg +++ ++l +i+++r++++++i +i+ GGI t++
  ACD30141.1   167 --------TAKGGISGYPLHKYSLPAIKKARQEFGdSITIIGGGGIYTLD 208  

                   dalealaaGAdaVmvgsallgtgpalveeileglrelleergfgmlakriipaldlkdgrvvrlivglnggdpedpveaakaaeeaGadai
                           + +  + k  + ++  + l ++d++ ++e +k+ + a    i
  ACD30141.1    66    -----LANTNPPKRAQDIISLAALDMSDWHSFAETLKLPKFAQHRNI 107  

                   elndldpallgpealleviraireavgipvivgggirspedaralleaGa
                   e+n+++p                                           
  ACD30141.1   108 EINIGCP------------------------------------------- 114  

                   davivgsalledpellaellealgpevivvaidvkavgvpvtvkirggld
                        ++  ++ p++la l e  ++                         
  ACD30141.1   115 -----NASIVDFPAELAPLFEDRNISIKMPP------------------- 140  

                   ltdvdavelakaleeagadailvt.......gglgggtlggadlelvaei
                     +vd  + ++++++ g+  +++ +++ +++gg +g +l  ++l ++++ 
  ACD30141.1   141 --TVDHNAKIREYLAVGITTFHLCntiptakGGISGYPLHKYSLPAIKKA 188  

                   aeavg..iPviasGGirspedaakalaaGAdaVlvgsal...lggpelvr
                   ++++g+ i +i++GGi +++da+k ++aGAd   + s++ + ++g+ lv+
  ACD30141.1   189 RQEFGdsITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMfnpIRGKKLVK 238  

                   eikegleeggllvrlnkmkisplivalDfpdleealeladalge.gvdvikvgtplvla...f
                      ++   ++  alD+ d++ + e+++    +    i+++++++ a +++
  ACD30141.1    74    RAQDIISLAALDMSDWHSFAETLKLPKFaQHRNIEINIGCPNAsivD 120  

                   gpevvkalrkapglpvildlKladigntveaaaeaaaeaGadaitvhgya
                    p+ ++ l +  ++ +         + tv++ a+   ++ + + t+h + 
  ACD30141.1   121 FPAELAPLFEDRNISIK-------MPPTVDHNAKIREYLAVGITTFHLCN 163  

                   gsdtlkelleaakelglgvlvllspstegllelllelvllvaylavelgv
                                                             + +++ g+
  ACD30141.1   164 -----------------------------------------TIPTAKGGI 172  

                   dgvvvgatnlellkeirellg.dvplivdgGirtpgdaaealeagadgvv
                    g   +   l+++k+ r+ +g+++ +i +gGi t +da++ +eagad + 
  ACD30141.1   173 SGYPLHKYSLPAIKKARQEFGdSITIIGGGGIYTLDDAKKYIEAGADHLS 222  

                   vGraitkaedpaeaaeaireaikayrdaelaallskgllaaasgllieegrplvvqlagsdpedlaeaaklaee.gadgidlnfgcpvskvrrd
                      +++++ ++ l  sd + +ae+ kl   +    i++n+gcp+      
  ACD30141.1    75    AQDIISLAALDMSDWHSFAETLKLPKFaQHRNIEINIGCPNAS---- 117  

                   gyGaallkdpelvleivkavreavp.ipvtvkirlgwdledtvelakale
                               ++++ +++   + +  +++k+   +d++  +   + + 
  ACD30141.1   118 ------------IVDFPAELAPLFEdRNISIKMPPTVDHNAKI---REYL 152  

                   eaGadaltvhg......rtrsqrytgpadleaikevke....sipvianG
                   + G++ +++ +++ ++++++s+ + + + l aik+ +++  +si +i++G
  ACD30141.1   153 AVGITTFHLCNtiptakGGISGYPLHKYSLPAIKKARQefgdSITIIGGG 202  

                   girtpedaakaleatGadgVmigraal...gnpelfgeikeglggegivv
                   gi+t++da+k +ea Gad +++ +++++ +++  l++ei +++       
  ACD30141.1   203 GIYTLDDAKKYIEA-GADHLSLSSIMFnpiRGKKLVKEIVKFW------- 244  

                   igakevlellleylellleyggellgvlrllkhllrllkglpgagelrlt
                                                                     
  ACD30141.1     - -------------------------------------------------- -    

                   lndadgllegldlleelleevdprkgliagnwkmygdpaelaeliealgaallsvltgvvlfvgpppid
                      +   l a ++    ++ae+++l + +    +++ +g+     +++ +
  ACD30141.1    77    DIISLAALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIVDFPA 123  

                   laavrealdipvlaknvlpnesGaftgevsvellleaGadgvilghserr
                                               + + l  + ++++        +
  ACD30141.1   124 ----------------------------ELAPLFEDRNISIK-------M 138  

                   lalgepdelieaakklglkvivcvgevlearralalgadaiayepveaig
                    +  +  + i+  ++ g++ +++++++ +a+                   
  ACD30141.1   139 PPTVDHNAKIREYLAVGITTFHLCNTIPTAKG------------------ 170  

                   tgkganpellpev.veavrallelap.dvpviagGGigtgndaaaalalG
                      g++ + l+   ++a+++ ++ +++++ +i gGGi t +da +++++G
  ACD30141.1   171 ---GISGYPLHKYsLPAIKKARQEFGdSITIIGGGGIYTLDDAKKYIEAG 217  

                   adgVlvGsallkaedpaaaaralkqavkaarplivalDfadleealeladal.aphvdvikvgfvlflafgpevvkal
                       +  alD+ d++ + e +++ ++     i++++ ++ a  +++ ++l
  ACD30141.1    79    ISLAALDMSDWHSFAETLKLPkFAQHRNIEINIGCPNASIVDFPAEL 125  

                   rk...ktgvpvildlklmdigntvadyaeaaaeagadgvtvhaeagpdtl
                   ++  +  ++ +         + tv++ a++   + + + t+h   ++ t+
  ACD30141.1   126 APlfeDRNISIK-------MPPTVDHNAKIREYLAVGITTFHLCNTIPTA 168  

                   eallglkllilvtvltseealealllgadyvavlavepgldgvvvgatel
                   +                                     g++g  +    l
  ACD30141.1   169 KG------------------------------------GISGYPLHKYSL 182  

                   ellkelrealp.dipvivdgGigtpgedaaealeaGadgvvvGsaifkae
                   +++k++r+ ++++i +i +gGi t  +da++++eaGad +   s  f+  
  ACD30141.1   183 PAIKKARQEFGdSITIIGGGGIYTL-DDAKKYIEAGADHLSLSSIMFNPI 231  

                   dpaeaakalreaielldlanlidltllkpdltledieklidealeygfaavcvnplyvkla
                       l ++++ d+     +l l + ++ ++                    
  ACD30141.1    80    SLAALDMSDWHSFAETLKLPKFAQHRN-------------------- 106  

                   kdllgglkvaavvgfPlGasttedkveeakaaveagadeieinishgnl.
                                                          ieini ++n  
  ACD30141.1   107 ---------------------------------------IEINIGCPNAs 117  

                   ................legdlelllelikaikeavg.gvvvkvilgtvll
                   +++  ++ +   ++ +++  +  + +  ++i+e++ +g +      t+ +
  ACD30141.1   118 ivdfpaelaplfedrnISIKMPPTVDHNAKIREYLAvGITTFHLCNTIPT 167  

                   deeeivelaealieaGaDgikvsgGfggigatlealrliaevvke...ki
                   + +                     G++g ++    l++i+++ +e  ++i
  ACD30141.1   168 AKG---------------------GISGYPLHKYSLPAIKKARQEfgdSI 196  

                   piiadGGIrsgedalkalaaGAdlvgvgsa...laileellglleelggs
                    ii++GGI +++da+k+++aGAd + ++s++ + ++ ++l+++++++ ++
  ACD30141.1   197 TIIGGGGIYTLDDAKKYIEAGADHLSLSSImfnPIRGKKLVKEIVKFWLD 246  

                   siqgggidpedpaelaraaeeaGadaielndgcpfdsrlldgsgllpdp
                       + ++d + +ae  +    a    ie+n+gcp  s++          
  ACD30141.1    83    ALDMSDWHSFAETLKLPKFAQHRNIEINIGCPNASIV---------- 119  

                   eiikavrkavsvpvivkgrigsdedvelalaagadgvtvgtlagedpeel
                                                               + p+el
  ACD30141.1   120 --------------------------------------------DFPAEL 125  

                   leaakelglpvivgardakealraarlgrealrtkgikllpdvvttveaa
                     + +  ++ + +                             + t  + a
  ACD30141.1   126 APLFEDRNISIKM-----------------------------PPTVDHNA 146  

                   raaeeaGadvigvtg........gdltgtkrlagaglelvrevkeavp..
                   ++ e + +++ +++  +++ +++g+++g  +l  ++l ++++ ++++++ 
  ACD30141.1   147 KIREYLAVGITTFHLcntiptakGGISGY-PLHKYSLPAIKKARQEFGds 195  

                   ipvinfaaGGIgtpedaaaalelGAdgVlvGsaifk...apdpveaaral
                   i +i  ++GGI t +da++++e+GAd   + s  f  + ++  v+++ ++
  ACD30141.1   196 ITII--GGGGIYTLDDAKKYIEAGADHLSLSSIMFNpirGKKLVKEIVKF 243  

                   veaveagrlaylagriskrlskdrgvlaelleraeeagadaivltvdspllgqrardlrggfllglk
                      ++d++  ae l++ + a+ + i++++++p+++               
  ACD30141.1    86    MSDWHSFAETLKLPKFAQHRNIEINIGCPNAS--------------- 117  

                   vtaeilalrlvppgealispahgdpilsledlkalrealg.vpvivkgvl
                                              ++++ ++l+ ++ +  + +k+ +
  ACD30141.1   118 ---------------------------IVDFPAELAPLFEdRNISIKMPP 140  

                   tved...allaaeaGadaivvsgh......ggggldvgvptlealpevae
                   tv+++++++  +++G+    + +++ +++ g +g +    +l a+  +++
  ACD30141.1   141 TVDHnakIREYLAVGITTFHLCNTiptakgGISGYPLHKYSLPAIKKARQ 190  

                   avggdipviadGGirtggDvakalalGAdaVmiGraflyaleapgeegvk
                     g++i++i+ GGi t  D+ k++++GAd   + + ++      g + vk
  ACD30141.1   191 EFGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMFNPI--RGKKLVK 238  

                   nlleallgelrlamallGarsleelrgkllvlveeaaraaeeagadalelnvdlpqlgsreldrprlllellealreav
                      ++e +++ + a    +e+n+++p             +++ ++l+ ++
  ACD30141.1    92    FAETLKLPKFAQHRNIEINIGCP---------NASIVDFPAELAPLF 129  

                   g.vpvivKlvggvltvedaralleaGadaivvsgggggghidvetlravg
                    +  + +K++++v++ + +r+ l+ G+   ++ ++  +            
  ACD30141.1   130 EdRNISIKMPPTVDHNAKIREYLAVGITTFHLCNTIPTA----------- 168  

                   aattggllgvgv..ptlallaevrealg.dipviadGGirtgedaakala
                       gg++g+++++ +l +++ +r+++g++i++i+ GGi+t +da k+++
  ACD30141.1   169 ---KGGISGYPLhkYSLPAIKKARQEFGdSITIIGGGGIYTLDDAKKYIE 215  

                   lGAdaVlvgrallyaleaggegvpkllealleelrlamallGarsleelr
                   +GAd   + + ++        ++ kl++++++                  
  ACD30141.1   216 AGADHLSLSSIMFNPI-----RGKKLVKEIVK------------------ 242  

                   grllllgidakrgkggaallddpelveaiveavkeavpvpvtvkirggtelgd
                      +i ++ g ++a+++d+p  ++ + e    ++++p+tv          
  ACD30141.1   106    NIEINIGCPNASIVDFPAELAPLFEDRNISIKMPPTV---------- 142  

                   idavelakaleeaGadailvtgr..trdgtlsg.....adlelirevkea
                    d  +  +++ + G+  + + + + t+ g+ sg+  +++ l++i++ ++ 
  ACD30141.1   143 -DHNAKIREYLAVGITTFHLCNTipTAKGGISGyplhkYSLPAIKKARQE 191  

                   v..kiPViasGGigtpedaaaaleelGadgvlvgsallggpe...ileea
                     ++i +i +GGi t++da++++e +Gad   + s+++     +++++e+
  ACD30141.1   192 FgdSITIIGGGGIYTLDDAKKYIE-AGADHLSLSSIMFNPIRgkkLVKEI 240  

                   kalleeggllvrpllvielnfssPnlpnlrsdeyggslenrprllleiikavreavgedvpvi
                      ie+n+++Pn                   ++++ +++  ++ +   + 
  ACD30141.1   107    IEINIGCPN-----------------ASIVDFPAELAPLFED-RNIS 135  

                   vKlspgldvediedlakaleeaGadaiivsngigggtgltplelagvhgg
                   +K+ p  +v++ ++ ++  ++ G+  +++ n+i               gg
  ACD30141.1   136 IKMPP--TVDHNAK-IREYLAVGITTFHLCNTIPTA-----------KGG 171  

                   lsglplapaslevlaelreavggripviadGGirsgedaakalalGAdaV
                   +sg pl+ +sl+++++ r+++g++i +i+ GGi++ +da k +++GAd  
  ACD30141.1   172 ISGYPLHKYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHL 221  

                   migrally..agpdlvrkileglidlvincgalkagdpelvlelikavreavg...gvpvkviletgllt
                      i+++i+c++         +++++   e+++  ++  +  ++ +    
  ACD30141.1   107    IEINIGCPN---------ASIVDFPAELAPlfeDRNISIKMPP---- 140  

                   veeiveaaraaveaGadfiktst......gggsg....gatlevlalive
                     +  + +r  ++ G+   ++ +++ +++gg sg+  + ++l++++  ++
  ACD30141.1   141 TVDHNAKIREYLAVGITTFHLCNtiptakGGISGyplhKYSLPAIKKARQ 190  

                   avggkipviaaGGirtaedalkalaaGAdavgvgsalaileleagadgvhlgg.pdllleaarelglgvivgvsvhtleealeaeelg
                      +++g+   ++ + p++l+ +++  ++ ++  ++v++ + ++e+++ g
  ACD30141.1   109    INIGCPNASIVDfPAELAPLFEDRNISIKMPPTVDHNAKIREYLAVG 155  

                   adyill..gpvfptgtkpgf..gplglellrelveav..kipviasGGi.
                   +  + l ++  ++ g+ +g+  +  +l +++++++++ ++i +i  GGi+
  ACD30141.1   156 ITTFHLcnTIPTAKGGISGYplHKYSLPAIKKARQEFgdSITIIGGGGIy 205  

                   tpenaaealeaGadgvavgsailgapdpaeaakalleavkeyrgvvlGaldldgpldvelleellgaagglgvtfhraldaaldaeealed
                      + +G+ +++     ++ +el+ ++ + +++  + + +++d  + +++
  ACD30141.1   109    INIGCPNASIV---DFPAELAPLFEDRNIS--IKMPPTVDHNAKIRE 150  

                   lielGvvrilt...........sGgaagaleglellkelvela.gripiv
                   ++ +G++     +++ +++  +sG +     +l+ +k+ ++ + ++i+i+
  ACD30141.1   151 YLAVGITTFHLcntiptakggiSGYPLHKY-SLPAIKKARQEFgDSITII 199  

                   agGGit.lenikelleagadgvhvgsallrasdilaaaealrmllerlld
                    gGGi +l+++k+ +eagad + ++s+++++   ++ +++++  +     
  ACD30141.1   200 GGGGIYtLDDAKKYIEAGADHLSLSSIMFNPIRGKKLVKEIVKFW----- 244  

                   elsllvvdadlvrellslldellddvivkgvatved...araaaeaGadaivvsg......gggggldvgvp
                      + +k+ +tv++++++r  ++ G+    + +++ +++gg++g +    
  ACD30141.1   134    ISIKMPPTVDHnakIREYLAVGITTFHLCNtiptakGGISGYPLHKY 180  

                   tlealpevaeavggdipviadGGIrtgedvakalalGAdgVlvGtaflya
                   +l a++ +++ +g++i +i++GGI t +d+ k++++GAd   + + ++  
  ACD30141.1   181 SLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMFNP 230  

                   leapgeegvkealealleelrltmallGapsieelrgkllvvrittgvdavelakrleelgadeilvtsi..drdgtlsgp.....dlellk
                      + vd  + +++++++g+  +++ +++ ++ g+ sg+  ++++l ++k
  ACD30141.1   140    PTVDHNAKIREYLAVGITTFHLCNTipTAKGGISGYplhkySLPAIK 186  

                   klaeavs..ipviasGGigsledlkellelsnlletgadgvlvgsal...
                   k ++++++ i +i +GGi +l+d+k+ +e+      gad + + s+  + 
  ACD30141.1   187 KARQEFGdsITIIGGGGIYTLDDAKKYIEA------GADHLSLSSIMfnp 230  

                   lggpltleeakellkakaaeeaGadailvtsi..drdgtlsgp.....dlellkevaeavs.
                      ++++++ G+  + + +++ ++ g+ sg+  ++++l ++k+ ++++++
  ACD30141.1   148    IREYLAVGITTFHLCNTipTAKGGISGYplhkySLPAIKKARQEFGd 194  

                   .ipviasGGigsledaaellaaGadavlvGsal...lggplllkeikell
                    i +i+ GGi +l+da++ ++aGad + + s+  + ++g+ l+kei++++
  ACD30141.1   195 sITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMfnpIRGKKLVKEIVKFW 244  

                   eelgievrllgpailltsrtvtgtlsgpd.....lellkevaeavs..ipviasGGigt
                      +++ t+ t+ g+ sg++ +++ l ++k+ ++ +++ i +i +GGi t
  ACD30141.1   160    HLCNTIPTAKGGISGYPlhkysLPAIKKARQEFGdsITIIGGGGIYT 206  

                   pedaaklleaGadgvivGsalfg...gplileeakalleelgkevrladfiktstGfggg....gatlealrlilevvkdkipviaaGGIrtge
                      ++ i t  G+ +g+  +  +l+a++  ++  +d+i +i++GGI+t++
  ACD30141.1   162    CNTIPTAKGGISGyplhKYSLPAIKKARQEFGDSITIIGGGGIYTLD 208  

                   DalkalaaGadriGtssllallaglelgvvavaeglsglliiyleadgtpvdlelvkevkkavp.dipvivgGGIss
                      +  +g+sg+++         ++l ++k++++ ++++i +i+gGGI +
  ACD30141.1   167    TAKGGISGYPLH-------KYSLPAIKKARQEFGdSITIIGGGGIYT 206  

                   pedakelle.gAdgvvvGsaiyk...gpdilkeikelgdgag..geganlelieaireavg..ipviasGgi.tpedaeealaa
                      g+++g+ ++ + l++i++ r+++g+ i++i++Ggi+t++da+++++a
  ACD30141.1   170    GGISGypLHKYSLPAIKKARQEFGdsITIIGGGGIyTLDDAKKYIEA 216  

                   gladlValGrall...anpdlvaklaeglpleiyvridfygglvagytdy
                   g ad   l +++++ +++  lv+++++ + ++                  
  ACD30141.1   217 G-ADHLSLSSIMFnpiRGKKLVKEIVKFWLDD------------------ 247  

                   ptlpgftgqkfipgvleklkalrkligelgldipiivdGGI.npenikka
                      +g++g   ++ +l+ +k++r+ +g+   +i ii  GGI++++++kk 
  ACD30141.1   170    GGISGYPLHKYSLPAIKKARQEFGD---SITIIGGGGIyTLDDAKKY 213  

                   ieaGAdgvvvGsaifgaedpkeaikelrkslrgagftgqkfipaslekikelrklig.dipiivdGGI.npetikeaieaG
                      g++g   +  sl+ ik++r+ +g++i ii  GGI++++++k+ ieaG
  ACD30141.1   171    GISGYPLHKYSLPAIKKARQEFGdSITIIGGGGIyTLDDAKKYIEAG 217  

                   adgvvvGsaitkaedpaeaikalreelkeglggdgvvfgpaglellrelre...ldipvivdGGi.tpedaaealeaG
                      g  g + + + l++++++r++   +i +i  GGi+t++da++ +eaG
  ACD30141.1   171    GISGYPLHKYSLPAIKKARQefgDSITIIGGGGIyTLDDAKKYIEAG 217  

                   adgvvvGsaitkaedpaeaaralrealkearGvtGqktgfipevlelvkevkkat..dipvivggGIstpedakeale
                      G++G    +    l  +k++++ + ++i +i ggGI t +dak+++e
  ACD30141.1   171    GISGYP--LHKYSLPAIKKARQEFgdSITIIGGGGIYTLDDAKKYIE 215  

                   aGAdgvvvGsaivkaidgalaieelleavkelvealkeliggfggqkfipasleklkelrkligelgldipivvdGGi.npenikkal
                      g++g   ++ sl+ +k++r+ +g+   +i i+  GGi++++++kk +
  ACD30141.1   171    GISGYPLHKYSLPAIKKARQEFGD---SITIIGGGGIyTLDDAKKYI 214  

                   eaGadgvvvGsaifkaddpkeaikelrellrggfggqkfipsvlekikelrklig.dipiivdGGin.petikkaieaG
                      g++g   ++++l++ik++r+ +g++i ii  GGi +++++kk ieaG
  ACD30141.1   171    GISGYPLHKYSLPAIKKARQEFGdSITIIGGGGIYtLDDAKKYIEAG 217  

                   adivvvGsaifkaedpeeaikalrkalkeagvtGtls...diellkalreavgipv.viagGGistpedaaelle.g
                      g++G   +++ + ++k+ r+ +g  +++i gGGi t++da++++e+g
  ACD30141.1   171    GISGYPLhkySLPAIKKARQEFGDSItIIGGGGIYTLDDAKKYIEaG 217  

                   AdgvvvGsaifk...gedplkeaieflkaegftgqkfipsslekikalrkligelgldipivvdGGi.npetikkai
                      g++g   ++ sl+ ik++r+ +g+   +i i+  GGi++++++kk i
  ACD30141.1   171    GISGYPLHKYSLPAIKKARQEFGD---SITIIGGGGIyTLDDAKKYI 214  

                   eaGadgvvvGsaifkaedpkeaikelrealkGfllggatledvllmleavggldvgvkaaGGirtledalkllaaGad
                      G+ l+  +l++++  ++  g+ ++ ++ +GGi tl+da+k+++aGad
  ACD30141.1   174    GYPLHKYSLPAIKKARQEFGD-SITIIGGGGIYTLDDAKKYIEAGAD 219  

                   riGtssll.eilaelekgvlevdldtllellklvpedipvvaegGIstpedvakl.aagadgvlvG
                      ++++l+++++ ++ ++++i+++ +gGI+t++d++k+++agad     
  ACD30141.1   178    HKYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYiEAGADHLSLS 224  

                   salmraddpgeavrellggvdlellkelaeavpkdipviasGGisspediaelleaGadgvlvGs
                      +++l ++k+ ++ ++++i +i +GGi++++d+++++eaGad   + s
  ACD30141.1   179    KYSLPAIKKARQEFGDSITIIGGGGIYTLDDAKKYIEAGADHLSL-S 224  

                   almkapdplkeareadlellrevaeav..diPviadGGIgtpedaakalelGAdgVlvGsa
                      ++l ++++ ++   ++i +i +GGI t++da+k +e+GAd   + s+
  ACD30141.1   180    YSLPAIKKARQEFgdSITIIGGGGIYTLDDAKKYIEAGADHLSLSSI 226  

                   iagaedPgemaralklaveagrlaalaglgskdrypdlellkevveav..dipviaeGgIntpedakkalalGadavmvGsa
                      ++l ++k+ ++ + ++i +i  GgI t++dakk +++Gad   + s 
  ACD30141.1   180    YSLPAIKKARQEFgdSITIIGGGGIYTLDDAKKYIEAGADHLSLSSI 226  

                   ilgnpeileaakellelellrevve...vgipviadGGIrtpedaakalaaGAdgvlvGsall
                      l+++++++++   +i +i +GGI t++da+k+++aGAd   + s  +
  ACD30141.1   182    LPAIKKARQefgDSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMF 228  

                   gapeppgeakelleirrireav..dvpvivggGistpedvaelleaGAdgvvvGsaivkll
                      i+++r+ + +++ +i ggGi t++d+++++eaGAd +   s  ++  
  ACD30141.1   185    IKKARQEFgdSITIIGGGGIYTLDDAKKYIEAGADHLSLSSIMFN-- 229  

                   aedpeeaikellelikgvldl