hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_13443.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ACD30480.1
Accession:      [none]
Description:    ftul2 ACD30480.1 GIB00719CH01 "transcriptional regulator, ArsR family"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0049777  "Winged helix" DNA-binding domain               63.0    1.4e-18   1
0049944  "Winged helix" DNA-binding domain               64.9    9.1e-18   1
0043095  "Winged helix" DNA-binding domain               63.7    1.8e-16   1
0053261  "Winged helix" DNA-binding domain               56.3    2.4e-16   1
0043669  "Winged helix" DNA-binding domain               58.3    1.7e-15   1
0051170  "Winged helix" DNA-binding domain               56.9    2.8e-15   1
0044258  "Winged helix" DNA-binding domain               54.6    8.7e-14   1
0052364  "Winged helix" DNA-binding domain               44.8    1.1e-11   1
0049384  "Winged helix" DNA-binding domain               41.5    9.4e-11   1
0053027  "Winged helix" DNA-binding domain               37.1    4.6e-09   1
0048703  "Winged helix" DNA-binding domain               34.9    5.7e-08   1
0043935  "Winged helix" DNA-binding domain               27.9    3.6e-07   1
0040266  "Winged helix" DNA-binding domain               24.9    7.9e-07   1
0041905  "Winged helix" DNA-binding domain               27.0      8e-07   1
0051444  "Winged helix" DNA-binding domain               27.5    1.3e-06   1
0043164  "Winged helix" DNA-binding domain               27.8    1.7e-06   1
0045968  "Winged helix" DNA-binding domain               26.5    2.3e-06   1
0052579  "Winged helix" DNA-binding domain               22.8    6.7e-06   1
0051521  "Winged helix" DNA-binding domain               24.5    8.6e-06   1
0051024  "Winged helix" DNA-binding domain               21.9    1.9e-05   1
0052644  "Winged helix" DNA-binding domain               20.4    4.4e-05   1
0048742  Homeodomain-like                                20.0      9e-05   1
0052506  "Winged helix" DNA-binding domain               20.9    0.00012   1
0042156  "Winged helix" DNA-binding domain               21.1    0.00014   1
0040517  "Winged helix" DNA-binding domain               17.9    0.00049   1
0052755  "Winged helix" DNA-binding domain               16.4     0.0008   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043095    1/1       1    91 [.     1    94 []    63.7  1.8e-16
0044258    1/1       1    89 [.     1   100 []    54.6  8.7e-14
0049384    1/1       1    91 [.     1   109 []    41.5  9.4e-11
0049777    1/1       1    80 [.     1   108 []    63.0  1.4e-18
0049944    1/1       1   101 [.     1   190 []    64.9  9.1e-18
0051170    1/1       1    76 [.     1    89 []    56.9  2.8e-15
0043669    1/1       2    89 ..     1    98 []    58.3  1.7e-15
0053261    1/1       2    79 ..     1   194 []    56.3  2.4e-16
0048742    1/1       3    90 ..     1   123 []    20.0    9e-05
0051521    1/1       5    90 ..     8   108 .]    24.5  8.6e-06
0052755    1/1       5    88 ..     9   102 .]    16.4   0.0008
0051444    1/1       6    91 ..     1   114 []    27.5  1.3e-06
0052579    1/1       6    71 ..    10    77 ..    22.8  6.7e-06
0052506    1/1       7    94 ..     1   114 []    20.9  0.00012
0052364    1/1       8    89 ..     1   109 []    44.8  1.1e-11
0051024    1/1      10    88 ..     1   103 []    21.9  1.9e-05
0045968    1/1      12    73 ..     1    63 []    26.5  2.3e-06
0040266    1/1      15   121 ..     1   151 []    24.9  7.9e-07
0040517    1/1      15   118 ..    28   144 .]    17.9  0.00049
0041905    1/1      15    89 ..     1   120 []    27.0    8e-07
0042156    1/1      15    90 ..    33   125 .]    21.1  0.00014
0043164    1/1      15   105 ..     1    90 []    27.8  1.7e-06
0043935    1/1      15    86 ..     1    94 []    27.9  3.6e-07
0048703    1/1      15    84 ..     1    82 []    34.9  5.7e-08
0052644    1/1      15   113 ..     1   172 []    20.4  4.4e-05
0053027    1/1      18    79 ..     1    62 []    37.1  4.6e-09

Alignments of top-scoring domains:
0043095: domain 1 of 1, from 1 to 91: score 63.7, E = 1.8e-16
                   *->dellleelaellkaladptrlrilrlLaegelsvgelaealglsqst
                        + l++++++ kal+d+tr+ril+++++  l+ ++la++++l+ st
  ACD30480.1     1    --MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANST 45   

                   vsrhLkvLeeaglvkrrregrrvyyrltdeglaellelllelleliemdrlllalllkalldptrlliLllLaedgeltvseLaellglspstl
                      m+   + ++ kal+d+tr++iL+++++   l+ + La++++l  stl
  ACD30480.1     1    MKLANIVDFQKALGDETRIRILMVIYQ-HQLCLCHLAHIFKLANSTL 46   

                   srhLkrLeeaGlverrrdpedgrrvyysltekgrelleallelleellee
                   s+hL++L+++G++++r++   gr++y++ + ++++ l++l+++l++    
  ACD30480.1    47 SKHLDILRRNGFIHKRKQ---GRFHYFYFNSAYQQQLNWLFDILAD---- 89   

                   lldllrllleelaellkalgldptrlriLllLlenggltvseLaeelgls
                         + l  ++++ kalg d+tr+riL+++++   l+ + La  + l 
  ACD30480.1     1    ---MKLANIVDFQKALG-DETRIRILMVIYQ-HQLCLCHLAHIFKLA 42   

                   rstvsrrlkrLeeaGlvererapldgrkvgysltekgelleelleallel
                    st+s++l++L+++G++++++    gr ++++ +           a+++ 
  ACD30480.1    43 NSTLSKHLDILRRNGFIHKRK---QGRFHYFYFN----------SAYQQQ 79   

                   leellellseeellllllllllllldeedleelaellkaLadptRlrIlrlLaeegelt
                                     + l +++++ kaL+d+tR+rIl++++ +  l+
  ACD30480.1     1    ---------------MKLANIVDFQKALGDETRIRILMVIY-QHQLC 31   

                   vgeLaellglsqstvshhLkvLeeaGlverrregrrvyyrlndeglaall
                    ++La+++ l+ st+s+hL++L++ G+++ r++gr++y++ n ++ ++l 
  ACD30480.1    32 LCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQGRFHYFYFNSAYQQQL- 80   

                   elllellclgemldemleelaelfkaLadptRlrILelLaegeltvseLaellglsqs
                         ++l +++++ kaL+d+tR+rIL+++++  l+ + La ++ l+ s
  ACD30480.1     1    ---MKLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANS 44   

                   tvsrHLkkLeeaGlverrregrdrgrpekyYrltdeglallpdlleellv
                   t+s+HL++L++ G++ +r++gr      +y++ ++ + ++l  l++ l+ 
  ACD30480.1    45 TLSKHLDILRRNGFIHKRKQGR-----FHYFYFNSAYQQQLNWLFDILAD 89   

                   dlleslaellrevlerlgeefdallllelpdkllelllelgellllller
                   d +++ ++ l +                                      
  ACD30480.1    90 DEIIQSDQKLVK-------------------------------------- 101  

                   leelvellreegyvlellpsdgifllnspnclilavaeefplklllllllllllllleelleelarllkaladptRlrILrlLa.gelsv
                                     + l+ ++++ kal+d+tR+rIL+++++  l+ 
  ACD30480.1     1    ---------------MKLANIVDFQKALGDETRIRILMVIYqHQLCL 32   

                   selaellglsqstvshhLkvL.eaglverrregrrvyyrltdegmllllllelleelaellkaladptrlrilrlLaegelsvgeLaealg
                               l++++++ kal+d+tr+ril+++++  l+ + La+++ 
  ACD30480.1     2    --------KLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFK 40   

                   lsqstvsrhLkvLeeaglverrrdgrrvyyrltdeg...laallelllel
                   l  st+s+hL++L++ g+++ r++gr++y++ + +++++l +l+++l + 
  ACD30480.1    41 LANSTLSKHLDILRRNGFIHKRKQGRFHYFYFNSAYqqqLNWLFDILAD- 89   

                   lellmmedlarllkaLgdptrlrILrlLlegpltvseLaeelgisqstvsr
                         +++++ kaLgd+tr+rIL+ +++  l+ + La ++ ++ st+s+
  ACD30480.1     2    KLANIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSK 48   

                   hLkkLeeaGlverrrepedrggrrvyYrltekglallldllaelaealle
                   hL++L++ G++ +r++     gr +y++ +   +++              
  ACD30480.1    49 HLDILRRNGFIHKRKQ-----GRFHYFYFNSAYQQQ-------------- 79   

                   eleellgellelleelleelaellelldellerleelvelleelgymael
                                                                     
  ACD30480.1     - -------------------------------------------------- -    

                   lplgdgyfllelncpilelaedfpsvcrlelglleellgtsvGdlcCllrvnqlgglfvmgrplsvelRlkivllaaeG.lspreiarrlgvsr
                            l ++++  ++l +e+R++i+  +++ +l+ +++a ++++  
  ACD30480.1     3    ------LANIVDFQKALGDETRIRILMVIYQHqLCLCHLAHIFKLAN 43   

                   stvskwlkryretGsvglkprgg...grprkltpeqverilellrenpdl
                   st sk+l+ +r++G+++ +++g+ ++ + + + ++q++++ ++l+++   
  ACD30480.1    44 STLSKHLDILRRNGFIHKRKQGRfhyFYFNSAYQQQLNWLFDILADD--- 90   

                   tlwelrellaeeggvdvsvstvsriLrrlGpvalaldllgdkwrlliLrlllegplrfseLarllpgisqgtltrrL
                      ++ ++ ++lgd++r++iL+++++  l    La+ +  ++++tl+++L
  ACD30480.1     5    NIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIF-KLANSTLSKHL 50   

                   krLeedGlverevypedprrveysLTekGrallpvllallewgeehllei
                   + L+++G++++++              +Gr  +  + + +++ +++l++i
  ACD30480.1    51 DILRRNGFIHKRK--------------QGRFHYFYFNSAYQQQLNWLFDI 86   

                   lspepvalaldllggkwklliLrlllngplrfseLaralpgisqktlsrrL
                      ++  + ++lg+  ++ iL+++++  l    La+   +++++tls++L
  ACD30480.1     5    NIVDFQKALGDETRIRILMVIYQHQLCLCHLAHIF-KLANSTLSKHL 50   

                   keLeedglverrvypedpprveYsLTelGrellpvllallewgeehllmllldlllllcpvaraldllgdkwrlliLrllldgplrfseLarrl
                                   +  + ++lgd++r++iL+++++  l    La+  
  ACD30480.1     6    -------------IVDFQKALGDETRIRILMVIYQHQLCLCHLAHIF 39   

                   pgisqstlsrrLkrLeedGlverrvypedprrveysLTekGrellpvlla
                     +++stls++L+ L+++G++++r                Gr  +  + +
  ACD30480.1    40 -KLANSTLSKHLDILRRNGFIHKRK--------------QGRFHYFYFNS 74   

                   llewgeehllevlseeevaraldllgdkwrlliLrlllegplrfgeLarrlgiskstLsrrLkr
                      + +  ++lgd++r++iL+++++  l    La+  ++++stLs++L+ 
  ACD30480.1     6    IVDFQKALGDETRIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDI 52   

                   LeeaGlvervypedprrveYrrivlelllgklrlliLalLaegplhgyeLakrleelslgllpgispg
                      +++ + l++ +r++iL++++++ l    La  +         ++  +
  ACD30480.1     7    VDFQKALGDETRIRILMVIYQHQLCLCHLAHIF---------KLANS 44   

                   tlypaLkrLeedGlverevepsdgprrkyYrlTeaGrelleellalleel
                   tl+ +L+ L ++G+++ +++               Gr ++  + + +++ 
  ACD30480.1    45 TLSKHLDILRRNGFIHKRKQ---------------GRFHYFYFNSAYQQQ 79   

                   leallelllelelldllraaraliellaellkalgldptrlriLllLlengepltvseLaellg
                                 ++ kalg d+tr+riL++++++   l+++ La +++
  ACD30480.1     8    -----------DFQKALG-DETRIRILMVIYQH--QLCLCHLAHIFK 40   

                   lskstvsrhlkkLeeaGlverrrsegdgrkvyysltekgrelleellell
                   l  st+s+hl+ L++ G++++r++   gr +y++ + + ++ l+ l+++l
  ACD30480.1    41 LANSTLSKHLDILRRNGFIHKRKQ---GRFHYFYFNSAYQQQLNWLFDIL 87   

                   lelleelleglskelllgllqlliLalLaegplygyelaklleellggllgisegtlyp
                       + l + ++++iL++++++ l    la+++        ++  +tl++
  ACD30480.1    10    QKALGDETRIRILMVIYQHQLCLCHLAHIF--------KLANSTLSK 48   

                   aLkrLekkglveryleesegdrrrkyyrlTekGrelleelleeleellea
                   +L+ L ++g++ ++++                Gr ++  +  ++++ l+ 
  ACD30480.1    49 HLDILRRNGFIHKRKQ----------------GRFHYFYFNSAYQQQLNW 82   

                   llellglllderrlkillllledgrlsveeLaeelgvSrstvrrhlkrLeeaG
                       l de+r++il+++++++ l+   La ++ +  st+++hl++L++ G
  ACD30480.1    12    ALGDETRIRILMVIYQHQ-LCLCHLAHIFKLANSTLSKHLDILRRNG 57   

                   liiesvpgkgyrllldiflllraarllikllgellkrlglsptrlriLalLaesdgpltvsel
                                              ++tr+riL++++ +   l +  l
  ACD30480.1    15    ------------------------DETRIRILMVIYQHQ--LCLCHL 35   

                   aeelglskstvsralkrLeelGlvrrerspgdrrrvyysltekglillfl
                   a  ++l  st+s++l+ L ++G++++++ +                    
  ACD30480.1    36 AHIFKLANSTLSKHLDILRRNGFIHKRKQG-------------------- 65   

                   erlrellekllelleelleellsglsdee.....lerllellkkleenle
                      r  +  + +++++ l+ l++ l d+e+++ +++ +++l+ + +e+l 
  ACD30480.1    66 ---RFHYFYFNSAYQQQLNWLFDILADDEiiqsdQKLVKQLIAQELEHLP 112  

                   gleileklgtltqfrvLllLaenggltvseLaerlglsrstvtrllkrLeekGlve
                      + t++r+L+++++++ l +  La ++ l  st++++l+ L ++G+++
  ACD30480.1    15    DETRIRILMVIYQHQ-LCLCHLAHIFKLANSTLSKHLDILRRNGFIH 60   

                   rerdpedrRavllsLTekGrelleellelheelleelleglseeeleall
                   +++               Gr ++   + ++++ l++l++ l ++e+ +  
  ACD30480.1    61 KRKQ--------------GRFHYFYFNSAYQQQLNWLFDILADDEIIQSD 96   

                   rll..eklldnleelidklkgdkelgltplelevllvLwekgpltvkelaeelgeeldlspstvttllk
                           +++++++l+v+++++ l+ + la +++    l+ st++++l+
  ACD30480.1    15    -----DETRIRILMVIYQHQ-LCLCHLAHIFK----LANSTLSKHLD 51   

                   rLekkGlverekdgrrvvyysltekgeellellkelleelfegllellla
                    L ++G+++++k+gr +++y+                             
  ACD30480.1    52 ILRRNGFIHKRKQGRFHYFYFN---------------------------- 73   

                   allddeglseeeleellellekltltqlliLllLaeaeeggltvkelaeklglskstvtrllkrLekkgl
                      + t+++iL++++   +++l+++ la+ + l  st++++l+ L ++g+
  ACD30480.1    15    DETRIRILMVIY---QHQLCLCHLAHIFKLANSTLSKHLDILRRNGF 58   

                   vervrspeDrRvvllsLTekgrelleellelleellkellsglseesrtrlliLllLlealegelsftelaealglsqstvsrhlkkLeelgl
                      ++tr++iL++++   ++ l++++la+++ l  st+s+hl++L+  g+
  ACD30480.1    15    DETRIRILMVIY---QHQLCLCHLAHIFKLANSTLSKHLDILRRNGF 58   

                   ver..egk..yysLTekGeellellrellelleellelllellelllglgltplqlliLllLaegpgltvyelaerlggllslspgtvyrllkr
                          ++++++iL+++++++ l+   la +++    l  +t++++l+ 
  ACD30480.1    15    ----DETRIRILMVIYQHQ-LCLCHLAHIFK----LANSTLSKHLDI 52   

                   LekeGlverrrdrrrkyyslTekGkelleellelleellellleglsllkllklseleleilrlLwklgpltvkeiaeeleeelglspstvstl
                             +e++++il+++++++ l+ + +a ++    +l+ st+s++
  ACD30480.1    15    -------DETRIRILMVIYQHQ-LCLCHLAHIF----KLANSTLSKH 49   

                   LkrLeekglverekegrayiYsalvskeeylallllslsleslllldlldlllldlldmedpdldelelellfllrrlaral
                                                                     
  ACD30480.1     -    ----------------------------------------------- -    

                   rrlldellkelgltpaqfrvLlaLaenggggyltvseLaerlglskstvs
                                + +++r+L+++++++    l    La  + l  st+s
  ACD30480.1    15 -------------DETRIRILMVIYQHQ----LCLCHLAHIFKLANSTLS 47   

                   rllkrLekkGlvererdpeDrRrvlvsLTekGrelleellelleelleel
                   ++l+ L + G++++++               Gr  +  +  ++++ l+ l
  ACD30480.1    48 KHLDILRRNGFIHKRKQ--------------GRFHYFYFNSAYQQQLNWL 83   

                   laglseee.....leallrllekllenleerarilllLlegplsvaeLaealglsqstvsnhLkvLrdaGlvvaeke
                      r ril+++++++l+ + La+ ++l+ st+s+hL++Lr +G+++ +k+
  ACD30480.1    18    RIRILMVIYQHQLCLCHLAHIFKLANSTLSKHLDILRRNGFIHKRKQ 64   

                   grrvlyeltdsllas