hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_13447.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ACD30919.1
Accession:      [none]
Description:    ftul2 folE GIB00719CH01 "GTP cyclohydrolase I"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0034957  Tetrahydrobiopterin biosynthesis enzymes-lik   185.6    8.5e-54   1
0037473  Tetrahydrobiopterin biosynthesis enzymes-lik   167.2    6.7e-53   1
0050713  Tetrahydrobiopterin biosynthesis enzymes-lik   155.9    2.1e-45   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0034957    1/1       6   208 .]     1   221 []   185.6  8.5e-54
0037473    1/1      25   208 .]     1   196 []   167.2  6.7e-53
0050713    1/1      35   206 ..     1   185 []   155.9  2.1e-45

Alignments of top-scoring domains:
0034957: domain 1 of 1, from 6 to 208: score 185.6, E = 8.5e-54
                   *->llllklrlllldalllkglednlllllldledeldleeieeavrelL
                       +++kl + ++++l++ gle++  +   +l+++ ++  i++a+r++L
  ACD30919.1     6    KYCSKLGKSVQEHLIKLGLEQPREF---NLDNDNKITIITKAYRQIL 49   

                   ealgedpdreglleTPkRvakayleelfsGlrydlaevlttflndeglde
                   +alg+    +++ +TP Rva+++++e+f+Gl+y++++++ ++ n++++ +
  ACD30919.1    50 DALGL--YTDEFEKTPFRVARMFTQEIFNGLDYANFPACALYENEFNYTG 97   

                   lvlvkdieftSlCehhllPffgkvhvaYiP.dgkvvGlsklarlvdvfar
                   +++ k+i+++S+Cehh++Pf g++ v++iP++++++Gl +++ ++d+f+r
  ACD30919.1    98 VLTQKNITIMSFCEHHFVPFEGTAEVSFIPkNNNIIGLCRINSICDFFSR 147  

                   rlqvqErltnqIadalvellkprgvaVvieAeHlcmlmRGvkktgsstvt
                   r+q+qEr+t+qI++al+ +l++++v V+i+A+H c+ +RGv +++s t+t
  ACD30919.1   148 RPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACVSLRGVNNQNSQTYT 197  

                   sallGvfkedpslraeflsliresglllllleledeldleeieeavrelLealgedpdreglleTPkrvaka
                       + + ++l+++ ++  i++a+r++L alg+    +++ +TP+rva++
  ACD30919.1    25    EQPREFNLDNDNKITIITKAYRQILDALGL--YTDEFEKTPFRVARM 69   

                   yl.elfsGldldpeevletflneegldelvlvkdieftslCehhllPffg
                   + +e+f+Gld+ +++++ +++ne+++ ++++ k+i+++s+Cehh++Pf g
  ACD30919.1    70 FTqEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEG 119  

                   kvhvaYiP.dgkvvGlsklarlvdsfarrlqvqErltnqIadalvellkp
                   ++ v++iP++++++Gl +++ ++d+f+rr+q+qEr+t+qI++al+ +l++
  ACD30919.1   120 TAEVSFIPkNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILST 169  

                   rgvaVvieAeHlcmtmrGvvktgsltvtsallGlfkedaslraeflslir
                   ++v V+i+A+H c+ +rGv +++s t+t+++ G+f +             
  ACD30919.1   170 EDVSVKIKAKHACVSLRGVNNQNSQTYTQMVGGVFAKXX----------- 208  

                   geldleeieeavrellealgedpdreglleTPkRvakayl.elfsgld
                      + ++  i +a+r++l alg+    +++ +TP Rva+++ +e+f+gld
  ACD30919.1    35    DNKITIITKAYRQILDALGL--YTDEFEKTPFRVARMFTqEIFNGLD 79   

                   ldpaevlelflneegldelvlvkdieftslCehhllPffgkahvaYiP.d
                   + ++++  l+ ne+++ ++++ k+i+++s+Cehh++Pf g+a v++iP++
  ACD30919.1    80 YANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTAEVSFIPkN 129  

                   gkvvGlsklarlvdvfarrlqvqErltnqiadalvellkpkgvaVvieAe
                   ++++Gl +++ ++d+f+rr+q+qEr+t+qi++al  +l++++v V i+A+
  ACD30919.1   130 NNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAK 179  

                   hlcmtmRGviktgsltvtsallGvFkedpalraeflslik