RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD30160.1 ftul2 ACD30160.1 GIB00719CH01 "riboflavin
biosynthesis protein ribAB"
         (403 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2bz0A [x.x.x] GTP CYCLOHYDROLASE II                                    70   2e-14
2bz1A [x.x.x] GTP CYCLOHYDROLASE II                                    70   2e-14
1aq0A [c.1.8] 1,3-1,4-BETA-GLUCANASE                                   42   3e-06

>2bz0A [x.x.x] GTP CYCLOHYDROLASE II
          Length = 168

 Score = 69.6 bits (169), Expect = 2e-14
 Identities = 57/164 (34%), Positives = 82/164 (50%), Gaps = 10/164 (6%)

Query: 211 VTKMASSTIPFKKIGELEMSVYKDNFSGDEVVVLSKPYSGN--NPLVRMHSSCMTGDIFG 268
           + ++A + +P    G+  M  +++  +G + V L           L R+HS C+TGD   
Sbjct: 3   LKRVAEAKLPTP-WGDFLMVGFEELATGHDHVALVYGDISGHTPVLARVHSECLTGDALF 61

Query: 269 SLRCDCQDQLHKGIEMISEEGG-FFIYLDQEGRGIGLTNKLKAYNLQMNENMDTLEANLA 327
           SLRCDC  QL   +  I+EEG    +Y  QEGR IGL NK++AY LQ          +  
Sbjct: 62  SLRCDCGFQLEAALTQIAEEGRGILLYHRQEGRNIGLLNKIRAYALQD------QGYDTV 115

Query: 328 LGLPADARKYDLAIQVLKYNNVNRCRLISNNPEKLAALRNVDIE 371
            G  AD R + L   + K   VN  RL++NNP+K+  L    I 
Sbjct: 116 EGFAADERDFTLCADMFKLLGVNEVRLLTNNPKKVEILTEAGIN 159


>2bz1A [x.x.x] GTP CYCLOHYDROLASE II
          Length = 170

 Score = 69.5 bits (169), Expect = 2e-14
 Identities = 60/163 (36%), Positives = 83/163 (50%), Gaps = 5/163 (3%)

Query: 211 VTKMASSTIPFKKIGELEMSVYKDNFSGDEVVVLSK-PYSGNNPLVRMHSSCMTGDIFGS 269
           + ++A + +P    G+  +   +     D V ++          L R+HS C+TGD   S
Sbjct: 2   LKRVAEAKLPTP-WGDFLVGFEELATGHDHVALVYGDISGHTPVLARVHSECLTGDALFS 60

Query: 270 LRCDCQDQLHKGIEMISEEG-GFFIYLDQEGRGIGLTNKLKAYNLQMNENMDTLEANLAL 328
           LRCDC  QL   +  I+EEG G  +Y  QEGR IGL NK++AY LQ      T+EAN  L
Sbjct: 61  LRCDCGFQLEAALTQIAEEGRGILLYHRQEGRNIGLLNKIRAYALQDQGYD-TVEANHQL 119

Query: 329 GLPADARKYDLAIQVLKYNNVNRCRLISNNPEKLAALRNVDIE 371
           G  AD R +       K   VN  RL++NNP+K+  L    I 
Sbjct: 120 GFAADERDFT-LCADFKLLGVNEVRLLTNNPKKVEILTEAGIN 161


>1aq0A [c.1.8] 1,3-1,4-BETA-GLUCANASE
          Length = 306

 Score = 42.0 bits (97), Expect = 3e-06
 Identities = 8/40 (20%), Positives = 14/40 (35%)

Query: 332 ADARKYDLAIQVLKYNNVNRCRLISNNPEKLAALRNVDIE 371
            +       + + K N +   RL + N   L A+    I 
Sbjct: 10  NNLPAASTVVSMFKSNGIKSMRLYAPNQAALQAVGGTGIN 49


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.138    0.406 

Gapped
Lambda     K      H
   0.267   0.0548    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,668,268
Number of extensions: 1348996
Number of successful extensions: 14843
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6149
Number of HSP's successfully gapped: 399
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)