RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD30267.1 ftul2 tmk GIB00719CH01 "thymidylate kinase"
         (209 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1e2mA [c.37.1] THYMIDINE KINASE                                        69   2e-14
1e2hA [c.37.1] THYMIDINE KINASE                                        65   2e-13
1e2jA [c.37.1] THYMIDINE KINASE                                        63   8e-13
1e2lA [c.37.1] THYMIDINE KINASE                                        62   1e-12
2a2zA [x.x.x] DEOXYCYTIDINE KINASE                                     58   2e-11
1e2iA [c.37.1] THYMIDINE KINASE                                        57   6e-11
2c95B [x.x.x] ADENYLATE KINASE 1                                       53   6e-10
2a2zD [x.x.x] DEOXYCYTIDINE KINASE                                     52   2e-09
2a2zB [x.x.x] DEOXYCYTIDINE KINASE                                     49   1e-08
2cdnA [x.x.x] ADENYLATE KINASE                                         49   1e-08
1e2lB [c.37.1] THYMIDINE KINASE                                        48   3e-08
1e2nB [c.37.1] THYMIDINE KINASE                                        47   6e-08
2a30B [x.x.x] DEOXYCYTIDINE KINASE                                     45   2e-07
1e2kB [c.37.1] THYMIDINE KINASE                                        44   3e-07
1e2mB [c.37.1] THYMIDINE KINASE                                        43   7e-07
1akyA [x.x.x] ADENYLATE KINASE                                         42   2e-06
1e2nA [c.37.1] THYMIDINE KINASE                                        42   2e-06
1e2iB [c.37.1] THYMIDINE KINASE                                        41   4e-06
1e2kA [c.37.1] THYMIDINE KINASE                                        40   6e-06
3akyA [x.x.x] ADENYLATE KINASE                                         38   3e-05
1e2hB [c.37.1] THYMIDINE KINASE                                        37   4e-05
1e2fA [c.37.1] THYMIDYLATE KINASE                                      37   6e-05
2a30A [x.x.x] DEOXYCYTIDINE KINASE                                     37   6e-05
1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE                               35   2e-04
2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     35   2e-04
2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-                     34   5e-04
2bwjC [x.x.x] ADENYLATE KINASE 5                                       33   0.001
2cckB [x.x.x] THYMIDYLATE KINASE                                       33   0.001

>1e2mA [c.37.1] THYMIDINE KINASE
          Length = 305

 Score = 68.6 bits (166), Expect = 2e-14
 Identities = 26/205 (12%), Positives = 52/205 (25%), Gaps = 22/205 (10%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
               + I+G  G GK+T    +R  +        Y R  G ++    +          E 
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI 62

Query: 62  IHSDSELLMI---------YAGRVQHYRNLIAPALEKGIN--VVSDRFYWSSMAYQG--- 107
              D+ ++M          YA         I           ++ DR   +++       
Sbjct: 63  SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYPAAR 122

Query: 108 -GGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNK 166
                +    + A             ++   +     + R  K       E+  L     
Sbjct: 123 YLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDLAMLAA 180

Query: 167 TRKVFKD-----LVKDSDNAIEIDA 186
            R+V+              +   D 
Sbjct: 181 IRRVYGLLANTVRYLQCGGSWREDW 205


>1e2hA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 65.3 bits (157), Expect = 2e-13
 Identities = 22/190 (11%), Positives = 50/190 (26%), Gaps = 18/190 (9%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLV-----LHN 56
               + I+G  G GK+T    +R  +        Y R  G ++    +            
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI 62

Query: 57  KYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGI-------NVVSDRFYWSSMAYQ--- 106
              +     +   +           ++AP +            ++ DR   +++      
Sbjct: 63  SAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAA 122

Query: 107 -GGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFN 165
                 +    + A             ++   +     + R  K       E+  L    
Sbjct: 123 RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDLAMLA 180

Query: 166 KTRKVFKDLV 175
             R+V+  L 
Sbjct: 181 AIRRVYGLLA 190


>1e2jA [c.37.1] THYMIDINE KINASE
          Length = 306

 Score = 63.0 bits (151), Expect = 8e-13
 Identities = 21/190 (11%), Positives = 50/190 (26%), Gaps = 18/190 (9%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHN----- 56
               + I+G  G GK+T    +R  +        Y R  G ++    +            
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEI 62

Query: 57  KYDEEIHSDSELLMIYAGRVQHYRNLI-------APALEKGINVVSDRFYWSSMAYQG-- 107
              +     +   +           ++       A +    + ++ DR   +++      
Sbjct: 63  SAGDAAVVMTSANITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAA 122

Query: 108 --GGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFN 165
                 +    + A             ++   +     + R  K       E+  L    
Sbjct: 123 RYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDLAMLA 180

Query: 166 KTRKVFKDLV 175
             R+V+  L 
Sbjct: 181 AIRRVYGLLA 190


>1e2lA [c.37.1] THYMIDINE KINASE
          Length = 304

 Score = 62.2 bits (149), Expect = 1e-12
 Identities = 20/188 (10%), Positives = 46/188 (24%), Gaps = 16/188 (8%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNN---LAAIYTREPGGTKIAEELRNLVLHNKY 58
               + I+G  G GK+T    +              +   E        + R        
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQGEISA 62

Query: 59  DEEIHSDSELLMIYAGRVQHYRNLIAPALEKGIN-------VVSDRFYWSSMAYQ----G 107
            +     +   +           ++AP +            ++ DR   +++        
Sbjct: 63  GDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARY 122

Query: 108 GGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKT 167
               +    + A             ++   +     + R  K       E+  L      
Sbjct: 123 LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDLAMLAAI 180

Query: 168 RKVFKDLV 175
           R+V+  L 
Sbjct: 181 RRVYGLLA 188


>2a2zA [x.x.x] DEOXYCYTIDINE KINASE
          Length = 222

 Score = 58.1 bits (139), Expect = 2e-11
 Identities = 33/220 (15%), Positives = 70/220 (31%), Gaps = 15/220 (6%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I IEG   AGKST ++ +++  E   +           +    L+ +    +    
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGG---RGVELSKI- 117
                  L     ++        P L    +V SDR+ ++S  Y+          + +  
Sbjct: 61  TFQTYACLSRIRAQLASLNGKEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDW 120

Query: 118 -RALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSP----------DRIEKAGLEFFNK 166
              +N+ F    E D +IYL   P   L R    G            +++      +   
Sbjct: 121 HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLH 180

Query: 167 TRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFN 206
                          + +D  +  ++  + +   + +  +
Sbjct: 181 RTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLS 220


>1e2iA [c.37.1] THYMIDINE KINASE
          Length = 300

 Score = 56.7 bits (135), Expect = 6e-11
 Identities = 20/221 (9%), Positives = 55/221 (24%), Gaps = 24/221 (10%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIH 63
             + I+G  G GK+  I +V + +    +                L          +   
Sbjct: 5   LRVYIDGPHGMGKTDDIVYVPEPMTYWRVLGASETIANIYTTQHRLD--QGEISAGDAAV 62

Query: 64  SDSELLMIYAGRVQHYRNLIAP------ALEKGINVVSDRFYWSSMAYQ---GGGRGVEL 114
             +   +           ++AP           + ++ DR   +++          G   
Sbjct: 63  VMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARYLMGSMT 122

Query: 115 S-KIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVF-- 171
              + A             ++   +     + R  K       E+  L      R+V+  
Sbjct: 123 PQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDLAMLAAIRRVYGL 180

Query: 172 --------KDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKH 204
                   +      ++  ++        +   ++ +    
Sbjct: 181 LANTVRYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFRAP 221


>2c95B [x.x.x] ADENYLATE KINASE 1
          Length = 194

 Score = 53.5 bits (127), Expect = 6e-10
 Identities = 31/213 (14%), Positives = 61/213 (28%), Gaps = 30/213 (14%)

Query: 1   MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDE 60
            ++  I + G  G+GK T    + +     +L+       G    +E             
Sbjct: 5   KKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLST------GDLLRSEVSSGSAR--GKKL 56

Query: 61  EIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRAL 120
               +   L+     +   R+ +   +      + D +       +   R          
Sbjct: 57  SEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERR--------- 107

Query: 121 NDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFK-------D 173
                   +P L++Y+D  P    QR  K G          E   K  + +         
Sbjct: 108 ------IGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIA 161

Query: 174 LVKDSDNAIEIDAAKSIQEVEKQIYLILDKHFN 206
             +      +++A  S+  V  Q+   LD   N
Sbjct: 162 FYEKRGIVRKVNAEGSVDSVFSQVCTHLDALLN 194


>2a2zD [x.x.x] DEOXYCYTIDINE KINASE
          Length = 220

 Score = 52.0 bits (123), Expect = 2e-09
 Identities = 38/220 (17%), Positives = 70/220 (31%), Gaps = 17/220 (7%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I IEG   AGKST ++ +++  E   +           +    L+ +    +    
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGG----RGVELSK- 116
                  L     R Q       P L    +V SDR+ ++S  Y+               
Sbjct: 61  TFQTYACLSRI--RAQLASLNEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDW 118

Query: 117 IRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSP--DRIEKAGLEFFNKTRKVFKDL 174
              +N+ F    E D +IYL   P   L R    G      I    LE  +   + +   
Sbjct: 119 HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLH 178

Query: 175 V--------KDSDNAIEIDAAKSIQEVEKQIYLILDKHFN 206
                          + +D  +  ++  + +   + +  +
Sbjct: 179 RTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLS 218


>2a2zB [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 49.3 bits (116), Expect = 1e-08
 Identities = 33/220 (15%), Positives = 65/220 (29%), Gaps = 16/220 (7%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I IEG   AGKST ++ +++  E   +           +    L+  +        
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQM-MYEKPERWS 59

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRG----VELSKI 117
               +   +          N   P L    +V SDR+ ++S  Y+               
Sbjct: 60  FTFQTYACLSRIRAQLASLNGEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQDW 119

Query: 118 RALNDNFLNGCEPD-LVIYLDIDPILGLQRAQKVGSP--DRIEKAGLEFFNKTRKVFKDL 174
               +N          +IYL   P   L R    G      I    LE  +   + +   
Sbjct: 120 HDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLH 179

Query: 175 V--------KDSDNAIEIDAAKSIQEVEKQIYLILDKHFN 206
                          + +D  +  ++  + +   + +  +
Sbjct: 180 RTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLS 219


>2cdnA [x.x.x] ADENYLATE KINASE
          Length = 186

 Score = 49.3 bits (116), Expect = 1e-08
 Identities = 26/201 (12%), Positives = 59/201 (29%), Gaps = 21/201 (10%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIH 63
             +++ G  GAGK T    + + L    ++          +  +           + + +
Sbjct: 6   MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL--------GVEAKRY 57

Query: 64  SDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALNDN 123
            D+  L+      +   + +         ++         A                   
Sbjct: 58  LDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKAL------------HEML 105

Query: 124 FLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNA-I 182
              G + D V+   +   + L+R +  G  D  +   L      R     L++   +   
Sbjct: 106 ERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLK 165

Query: 183 EIDAAKSIQEVEKQIYLILDK 203
            +DA  ++ EV  +    L K
Sbjct: 166 TVDAVGTMDEVFARALRALGK 186


>1e2lB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 47.7 bits (112), Expect = 3e-08
 Identities = 16/175 (9%), Positives = 46/175 (26%), Gaps = 20/175 (11%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNL-----AAIYTREPGGTKIAEELRNLVLHNK- 57
             + I+G  G GK+T    +     ++++        Y R  G ++    +         
Sbjct: 5   LRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIFTTQHRLDQ 64

Query: 58  ----YDEEIHSDSELLMIYAGRVQHYRNLIAPALEKG------INVVSDRFYWSSMAYQG 107
                 +     +   +           ++AP +         + ++ DR   +++    
Sbjct: 65  GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYP 124

Query: 108 G----GRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEK 158
                   +    + A             ++   +     + R  K      +  
Sbjct: 125 AARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA 179


>1e2nB [c.37.1] THYMIDINE KINASE
          Length = 309

 Score = 46.8 bits (109), Expect = 6e-08
 Identities = 21/205 (10%), Positives = 46/205 (22%), Gaps = 29/205 (14%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAI-----YTREPGGTKIAEELRNLVL-- 54
               + I+G  G GK+T    +     ++++  +     Y R  G ++    +       
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL 62

Query: 55  --HNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYW-----------S 101
                   +         I  G      + +      G                      
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC 122

Query: 102 SMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGL 161
             A +     +    + A             ++   +               DR+ K  L
Sbjct: 123 YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPED---------RHIDRLAKLDL 173

Query: 162 EFFNKTRKVFKDLVKDSDNAIEIDA 186
                 R+V+  L           +
Sbjct: 174 AMLAAIRRVYGLLANTVRYLQCGGS 198


>2a30B [x.x.x] DEOXYCYTIDINE KINASE
          Length = 212

 Score = 44.7 bits (104), Expect = 2e-07
 Identities = 41/221 (18%), Positives = 70/221 (31%), Gaps = 29/221 (13%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I IEG   AGKST +         N L      EP       +  N++       E
Sbjct: 1   RIKKISIEGNIAAGKSTFV---------NILKWEVVPEPVARWCNVQSTNVLQMMYEKPE 51

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKG----INVVSDRFYWSSMAYQGGGR-----GV 112
             S +        R++     +  A +       +V SDR+ ++S  Y+          +
Sbjct: 52  RWSFTFQTYACLSRIRAQLASLNDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI 111

Query: 113 ELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSP--DRIEKAGLEFFNKTRKV 170
                  +N+ F    E D +IYL   P   L R    G      I    LE  +   + 
Sbjct: 112 YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHES 171

Query: 171 --------FKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDK 203
                              + +D  +  + + +++   L  
Sbjct: 172 WLLHRTLKTNFDYLQEVPILTLDVNE-YESLVEKVKEFLST 211


>1e2kB [c.37.1] THYMIDINE KINASE
          Length = 316

 Score = 44.4 bits (103), Expect = 3e-07
 Identities = 20/234 (8%), Positives = 59/234 (25%), Gaps = 36/234 (15%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAI-----YTREPGGTKIAEELRN----- 51
               + I+G  G GK+T    +     ++++  +     Y R  G ++    +       
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL 62

Query: 52  LVLHNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGI-------------NVVSDRF 98
                   +     +   +           ++AP +                 + ++   
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAALL 122

Query: 99  YWSSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVG------- 151
            + +  Y  G    +   + A             ++   +     + R  K         
Sbjct: 123 CYPAARYLMGSMTPQA--VLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLDLAML 180

Query: 152 ----SPDRIEKAGLEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLIL 201
                   +    + +        +D  + S  A+    A     +   ++ + 
Sbjct: 181 AAIRRVYGLLANTVRYLQCGGSWREDWGQLSGTAVPQSNAGPRPHIGDTLFTLF 234


>1e2mB [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 43.2 bits (100), Expect = 7e-07
 Identities = 22/192 (11%), Positives = 54/192 (28%), Gaps = 28/192 (14%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNL-----AAIYTREPGGTKIAEELRNLVLHNKY 58
             + I+G  G GK+T    +     ++++        Y R  G ++    +         
Sbjct: 5   LRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQ 64

Query: 59  DEEIHSDSELLMIYAGRVQHYRNLIAPALE-----------KGINVVSDRFYWSSMAYQG 107
            E    D+ ++M  A         +  A+              + ++ DR   +++    
Sbjct: 65  GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLCYP 124

Query: 108 GG----RGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEF 163
                   +    + A             ++   +     + R          ++  L  
Sbjct: 125 AARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLA--------KRLDLAM 176

Query: 164 FNKTRKVFKDLV 175
               R+V+  L 
Sbjct: 177 LAAIRRVYGLLA 188


>1akyA [x.x.x] ADENYLATE KINASE
          Length = 218

 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 28/219 (12%), Positives = 55/219 (25%), Gaps = 17/219 (7%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           +S  +V+ G  GAGK T    +++     +LA          K  +              
Sbjct: 1   ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGL 60

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGV--------- 112
           +  D  + MI      +        L+     +        M  + G             
Sbjct: 61  VSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDD 120

Query: 113 ELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFK 172
           EL   R                  +  P   ++      +  +      +   K    + 
Sbjct: 121 ELLVARITGRLIHPASGRSYHKIFN-PPKEDMKDDVTGEALVQRSDDNADALKKRLAAYH 179

Query: 173 DLVKD-------SDNAIEIDAAKSIQEVEKQIYLILDKH 204
              +        +     +DA++    V   I   L K+
Sbjct: 180 AQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN 218


>1e2nA [c.37.1] THYMIDINE KINASE
          Length = 310

 Score = 41.7 bits (96), Expect = 2e-06
 Identities = 25/194 (12%), Positives = 53/194 (27%), Gaps = 22/194 (11%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLA-----AIYTREPGGTKIAEELRNLVLHN 56
               + I+G  G GK+T    +     ++++        Y R  G ++    +       
Sbjct: 3   TLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRL 62

Query: 57  KYDEEIHSDSELL---------MIYAGRVQHYRNLIAPALEKGIN--VVSDRFYWSSMAY 105
              E    D+ ++         M YA         I           ++ DR   +++  
Sbjct: 63  DQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPALTLIFDRHPIAALLC 122

Query: 106 QGGG----RGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGL 161
                     +    + A             ++   +     + R  K       E+  L
Sbjct: 123 YPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDL 180

Query: 162 EFFNKTRKVFKDLV 175
                 R+V+  L 
Sbjct: 181 AMLAAIRRVYGLLA 194


>1e2iB [c.37.1] THYMIDINE KINASE
          Length = 313

 Score = 40.5 bits (93), Expect = 4e-06
 Identities = 21/194 (10%), Positives = 51/194 (26%), Gaps = 31/194 (15%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNLAAI-----YTREPGGTKIAEELRN-----LV 53
             + I+G  G GK+T    +     ++++  +     Y R  G ++    +         
Sbjct: 5   LRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQ 64

Query: 54  LHNKYDEEIHSDSELLMIYAGRV-------------QHYRNLIAPALEKGINVVSDRFYW 100
                 +     +   +                   + +    A  L    + ++    +
Sbjct: 65  GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAHAPPPALTLIFDRHPIAALLCY 124

Query: 101 SSMAYQGGGRGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAG 160
            +  Y  G    +   + A             ++   +     + R  K    D      
Sbjct: 125 PAARYLMGSMTPQA--VLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRERLD------ 176

Query: 161 LEFFNKTRKVFKDL 174
           L      R+V+  L
Sbjct: 177 LAMLAAIRRVYGLL 190


>1e2kA [c.37.1] THYMIDINE KINASE
          Length = 308

 Score = 40.1 bits (92), Expect = 6e-06
 Identities = 21/225 (9%), Positives = 56/225 (24%), Gaps = 28/225 (12%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKN------NLAAIYTREPGGTKIAEELRNLVLHNK 57
             + I+G  G GK+T    +                 +   E        + R       
Sbjct: 5   LRVYIDGPHGMGKTTTTQLLVADDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEIS 64

Query: 58  YDEEIHSDSELLMIYAGRVQHYRNLIAPALEKG------INVVSDRFYWSSMAYQ--GGG 109
             +     +   +           ++AP +         + ++ DR   +++        
Sbjct: 65  AGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGPPPALTLIFDRHPIAALLCYPAARY 124

Query: 110 RGVELSKIRALNDNFLN--GCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKT 167
               ++    L    L         ++   +     + R  K       E+  L      
Sbjct: 125 LMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQ--RPGERLDLAMLAAI 182

Query: 168 RKVFKDLV----------KDSDNAIEIDAAKSIQEVEKQIYLILD 202
           R+V+  L              ++  ++        +   ++ +  
Sbjct: 183 RRVYGLLANTVRYLQCGGSWREDWGQLSGTGPRPHIGDTLFTLFR 227


>3akyA [x.x.x] ADENYLATE KINASE
          Length = 218

 Score = 37.7 bits (86), Expect = 3e-05
 Identities = 30/236 (12%), Positives = 60/236 (25%), Gaps = 53/236 (22%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           +S  +V+ G  GAGK T    +++     +LA           +             + +
Sbjct: 1   ESIRMVLIGPPGAGKGTQAPNLQERFHAAHLAT--------GDMLRSQIAKGTQLGLEAK 52

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALN 121
              D   L+     V   ++ +          + D F  +    +   + ++        
Sbjct: 53  KIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTP--- 109

Query: 122 DNFLNGCEPDLVIYLDIDPILGLQRAQK-------------------------------V 150
                    +  I L +D  L + R                                  V
Sbjct: 110 --------LEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALV 161

Query: 151 GSPDRIEKAGLEFFNKTRKVFKDLV---KDSDNAIEIDAAKSIQEVEKQIYLILDK 203
              D    A  +         + +V   K +     +DA++    V       L K
Sbjct: 162 QRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADFLNKLGK 217


>1e2hB [c.37.1] THYMIDINE KINASE
          Length = 311

 Score = 37.5 bits (85), Expect = 4e-05
 Identities = 17/176 (9%), Positives = 47/176 (26%), Gaps = 21/176 (11%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNLAAI-----YTREPGGTKIAEEL-----RNLV 53
             + I+G  G GK+T    +     ++++  +     Y R  G ++    +     R   
Sbjct: 5   LRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQ 64

Query: 54  LHNKYDEEIHSDSELLMIYAGRVQHYRNLIAPALEKGIN-------VVSDRFYWSSMAYQ 106
                 +     +   +           ++AP +            ++ DR   +++   
Sbjct: 65  GEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCY 124

Query: 107 GGG----RGVELSKIRALNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEK 158
                    +    + A             ++   +     + R  K      +  
Sbjct: 125 PAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRLDLAMLAA 180


>1e2fA [c.37.1] THYMIDYLATE KINASE
          Length = 210

 Score = 36.9 bits (84), Expect = 6e-05
 Identities = 34/201 (16%), Positives = 69/201 (34%), Gaps = 11/201 (5%)

Query: 4   KFIVIEGLDGAGKSTAISFV-RKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEI 62
             IV+EG+D AGKST    +        + A +       T+I + L + +      E+ 
Sbjct: 5   ALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEIGKLLSSYLQKKSDVEDH 64

Query: 63  HSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALND 122
                       +V   +  ++  +   ++  +      + A +             L  
Sbjct: 65  SVHLLFSANRWEQVPLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDVGL-- 122

Query: 123 NFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNAI 182
                 +PDLV++L +      +R                      ++ KD    + N  
Sbjct: 123 -----PKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDT---TLNWK 174

Query: 183 EIDAAKSIQEVEKQIYLILDK 203
            +DA+KSI+ V + I ++ + 
Sbjct: 175 MVDASKSIEAVHEDIRVLSED 195


>2a30A [x.x.x] DEOXYCYTIDINE KINASE
          Length = 221

 Score = 36.6 bits (83), Expect = 6e-05
 Identities = 28/221 (12%), Positives = 58/221 (26%), Gaps = 20/221 (9%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           + K I IEG   AGKST ++ +++  E   +           +    L+ +    +    
Sbjct: 1   RIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNVLQMMYEKPERWSF 60

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKG--------INVVSDRFYWSSMAYQGGGRGVE 113
                  L     ++      +  A +           +                     
Sbjct: 61  TFQTYACLSRIRAQLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTI 120

Query: 114 LS-KIRALNDNFLNGCEPDLVIYLDIDPILGLQ--RAQKVGSPDRIEKAGLEFFNKTRKV 170
                  +N+ F    E D +IYL   P   L     +       I    LE  +   + 
Sbjct: 121 YQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHES 180

Query: 171 --------FKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDK 203
                              + +D  +  + + +++   L  
Sbjct: 181 WLLHRTLKTNFDYLQEVPILTLDVNE-YESLVEKVKEFLST 220


>1dvrA [c.37.1 - g.41.2] ADENYLATE KINASE
          Length = 220

 Score = 35.2 bits (79), Expect = 2e-04
 Identities = 28/224 (12%), Positives = 54/224 (24%), Gaps = 31/224 (13%)

Query: 4   KFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEEIH 63
             +V+ G  GAGK T    +++     +LA                         + +  
Sbjct: 5   IRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRS--------QIAKGTQLGLEAKKI 56

Query: 64  SDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQ---------GGGRGVEL 114
            D   L+     V   ++ +          +   F  +    +         G      +
Sbjct: 57  MDQGGLVSDDIMVNMIKDELTNNPACKNGFILVGFPRTIPQAEKLDQMLKEQGTPLEKAI 116

Query: 115 SKI--------RALNDNFLNGCEPDLVIYLD------IDPILGLQRAQKVGSPDRIEKAG 160
                      R                  +       D + G    Q         K  
Sbjct: 117 ELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDNADALKKR 176

Query: 161 LEFFNKTRKVFKDLVKDSDNAIEIDAAKSIQEVEKQIYLILDKH 204
           L  ++   +   D  K +     +DA++    V   I   L K+
Sbjct: 177 LAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKN 220


>2ax4A [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 198

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 24/204 (11%), Positives = 55/204 (26%), Gaps = 32/204 (15%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           +   + + GL GAGK+T    + +YL  + +                       ++ +  
Sbjct: 21  RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLDGDNVRHGLNRNLGFSPGDREENI 80

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALN 121
                   +     +    + I+P  +       DR     +    G             
Sbjct: 81  RRIAEVAKLFADAGLVCITSFISPFAK-------DRENARKIHESAG------------- 120

Query: 122 DNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNA 181
                   P   I++D    +   R  K G   R     ++ F      ++         
Sbjct: 121 -------LPFFEIFVDAPLNICESRDVK-GLYKRARAGEIKGFTGIDSDYEKPETP---E 169

Query: 182 IEIDAAK-SIQEVEKQIYLILDKH 204
             +     ++ +   Q+  +L + 
Sbjct: 170 RVLKTNLSTVSDCVHQVVELLQEQ 193


>2ax4B [x.x.x] BIFUNCTIONAL 3'-PHOSPHOADENOSINE 5'-
          Length = 195

 Score = 33.8 bits (76), Expect = 5e-04
 Identities = 26/204 (12%), Positives = 63/204 (30%), Gaps = 32/204 (15%)

Query: 2   QSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIAEELRNLVLHNKYDEE 61
           +   + + GL GAGK+T    + +YL  + +              + +R+ +     +  
Sbjct: 18  RGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSLD-------GDNVRHGL-----NRN 65

Query: 62  IHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRALN 121
           +            R+     L A A   G+  ++                 +    R ++
Sbjct: 66  LGFSPGDREENIRRIAEVAKLFADA---GLVCITSF---------ISPFAKDRENARKIH 113

Query: 122 DNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSDNA 181
           +   +   P   I++D    +   R  K G   R     ++ F      ++         
Sbjct: 114 E---SAGLPFFEIFVDAPLNICESRDVK-GLYKRARAGEIKGFTGIDSDYEKPETP---E 166

Query: 182 IEIDAAK-SIQEVEKQIYLILDKH 204
             +     ++ +   Q+  +L + 
Sbjct: 167 RVLKTNLSTVSDCVHQVVELLQEQ 190


>2bwjC [x.x.x] ADENYLATE KINASE 5
          Length = 193

 Score = 32.8 bits (73), Expect = 0.001
 Identities = 28/206 (13%), Positives = 66/206 (32%), Gaps = 18/206 (8%)

Query: 1   MQSKFIVIEGLDGAGKSTAISFVRKYLEKNNLAAIYTREPGGTKIA-EELRNLVLHNKYD 59
            + K I I G  G+GK T    + +         + T E    ++A E  R+ ++ +  +
Sbjct: 5   RKCKIIFIIGGPGSGKGTQCEKLVEKYGFT---HLSTGELLREELASESERSKLIRDIME 61

Query: 60  EEIHSDSELLMIYAGRVQHYRNLIAPALEKGINVVSDRFYWSSMAYQGGGRGVELSKIRA 119
                 S +       ++  +  +  +L      + D   +     QG   G  +   + 
Sbjct: 62  RGDLVPSGI------VLELLKEAMVASLGDTRGFLID--GYPREVKQGEEFGRRIGDPQL 113

Query: 120 LNDNFLNGCEPDLVIYLDIDPILGLQRAQKVGSPDRIEKAGLEFFNKTRKVFKDLVKDSD 179
           +     +              +   + +  V    +     LE + +         +   
Sbjct: 114 VICMDCSADTM------TNRLLQMSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKT 167

Query: 180 NAIEIDAAKSIQEVEKQIYLILDKHF 205
              +I+A  + ++V  Q+   +D  F
Sbjct: 168 QLHKINAEGTPEDVFLQLCTAIDSIF 193


>2cckB [x.x.x] THYMIDYLATE KINASE
          Length = 192

 Score = 32.7 bits (73), Expect = 0.001
 Identities = 9/16 (56%), Positives = 12/16 (75%)

Query: 3  SKFIVIEGLDGAGKST 18
          S FI  EG +G+GK+T
Sbjct: 1  SAFITFEGPEGSGKTT 16


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.138    0.412 

Gapped
Lambda     K      H
   0.267   0.0494    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 32,562,162
Number of extensions: 2050672
Number of successful extensions: 22879
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 9614
Number of HSP's successfully gapped: 458
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)