RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD30394.1 ftul2 rnc GIB00719CH01 "ribonuclease III"
         (230 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3c4bA [x.x.x] ENDORIBONUCLEASE DICER                                  135   1e-34
2a11A [x.x.x] RIBONUCLEASE III                                        134   2e-34
2eb1C [x.x.x] ENDORIBONUCLEASE DICER                                  130   3e-33
2eb1A [x.x.x] ENDORIBONUCLEASE DICER                                  130   5e-33
2eb1B [x.x.x] ENDORIBONUCLEASE DICER                                  125   2e-31
3c4tA [x.x.x] ENDORIBONUCLEASE DICER                                   67   4e-14
2cpnA [x.x.x] TAR RNA-BINDING PROTEIN 2                                59   1e-11
2dixA [x.x.x] INTERFERON-INDUCIBLE DOUBLE STRANDED RNA-                53   8e-10
1di2A [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A                   52   2e-09
2b7tA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC EDITASE 1                   51   3e-09
2dmyA [x.x.x] SPERMATID PERINUCLEAR RNA-BINDING PROTEIN                51   4e-09
1ekzA [d.50.1] MATERNAL EFFECT PROTEIN (STAUFEN)                       49   1e-08
2b7vA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC EDITASE 1                   43   7e-07
1di2B [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A                   42   2e-06

>3c4bA [x.x.x] ENDORIBONUCLEASE DICER
          Length = 238

 Score =  135 bits (340), Expect = 1e-34
 Identities = 56/239 (23%), Positives = 90/239 (37%), Gaps = 31/239 (12%)

Query: 1   MVPEYSRFYNILGYNFKDYTLLIRALTHRS---KTKKNYERLEFLGDSVLSFVIAEVLYK 57
           ++  +  F   + Y FK+   L++A TH S    T  +Y+RLEFLGD++L ++I + LY+
Sbjct: 9   LISGFETFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYE 68

Query: 58  QFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASE---------------QGG 102
                + G L+ LRS LV  T  A LA      +Y    + E                  
Sbjct: 69  DPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEE 128

Query: 103 HKREKILEDVFEAVIGAIYLDSDFATVKKVILKWYQPIISSINLDTIKVKDSKSKLQEIL 162
                   D+FE++ GAIY       V +V          S N+        +  L+E  
Sbjct: 129 DIEVPKAGDIFESLAGAIYDSGSLEVVWQVYYPQPLIEKFSANVP---RSPVRELLEEPE 185

Query: 163 LQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKMIEML 221
                              ++ +   V V      + K  G S + A+   A + +  L
Sbjct: 186 TAKFSPAERT---------YDGKVR-VTVEVVGKGKFKGVGRSYRIAKSAAARRALRSL 234


>2a11A [x.x.x] RIBONUCLEASE III
          Length = 154

 Score =  134 bits (339), Expect = 2e-34
 Identities = 50/149 (33%), Positives = 76/149 (51%), Gaps = 11/149 (7%)

Query: 7   RFYNILGYNFKDYTLLIRALTHRS-----KTKKNYERLEFLGDSVLSFVIAEVLYKQFTD 61
              + LG +  D  LL  ALTHRS           ERLEFLGD+VL   I + L+ +  D
Sbjct: 6   PLLDALGVDLPD-ELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPD 64

Query: 62  LAEGKLSQLRSKLVKGTTLAQLASSLKMDEYII-----LGASEQGGHKREKILEDVFEAV 116
            +EG L++LR+ +V    LA +A  L  +   +      G +  GG  +  IL D  E++
Sbjct: 65  RSEGDLAKLRASVVNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESL 124

Query: 117 IGAIYLDSDFATVKKVILKWYQPIISSIN 145
           +GAIYL       ++VIL+ + P++ +  
Sbjct: 125 LGAIYLQHGMEKAREVILRLFGPLLDAAP 153


>2eb1C [x.x.x] ENDORIBONUCLEASE DICER
          Length = 169

 Score =  130 bits (329), Expect = 3e-33
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 20/165 (12%)

Query: 1   MVPEYSRFYNILGYNFKDYTLLIRALTHRSK----TKKNYERLEFLGDSVLSFVIAEVLY 56
           ++  +  F   + Y FK+   L++A TH S         Y+RLEFLGD++L ++I + LY
Sbjct: 3   LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLY 62

Query: 57  KQFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASE--------------QGG 102
           +     + G L+ LRS LV  T  A LA      +Y    + E              +  
Sbjct: 63  EDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKED 122

Query: 103 HKREKILEDVFEAVIGAIYLDS--DFATVKKVILKWYQPIISSIN 145
            +  K + D+FE++ GAIY+DS     TV +V     +P+I   +
Sbjct: 123 IEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFS 167


>2eb1A [x.x.x] ENDORIBONUCLEASE DICER
          Length = 171

 Score =  130 bits (327), Expect = 5e-33
 Identities = 49/166 (29%), Positives = 78/166 (46%), Gaps = 20/166 (12%)

Query: 1   MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTK----KNYERLEFLGDSVLSFVIAEVLY 56
           ++  +  F   + Y FK+   L++A TH S         Y+RLEFLGD++L ++I + LY
Sbjct: 3   LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLY 62

Query: 57  KQFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASE--------------QGG 102
           +     + G L+ LRS LV  T  A LA      +Y    + E              +  
Sbjct: 63  EDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKED 122

Query: 103 HKREKILEDVFEAVIGAIYLDS--DFATVKKVILKWYQPIISSINL 146
            +  K + D+FE++ GAIY+DS     TV +V     +P+I   + 
Sbjct: 123 IEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSA 168


>2eb1B [x.x.x] ENDORIBONUCLEASE DICER
          Length = 170

 Score =  125 bits (314), Expect = 2e-31
 Identities = 49/165 (29%), Positives = 78/165 (47%), Gaps = 20/165 (12%)

Query: 1   MVPEYSRFYNILGYNFKDYTLLIRALTHRSKTK----KNYERLEFLGDSVLSFVIAEVLY 56
           ++  +  F   + Y FK+   L++A TH S         Y+RLEFLGD++L ++I + LY
Sbjct: 3   LISGFENFEKKINYRFKNKAYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLY 62

Query: 57  KQFTDLAEGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASE--------------QGG 102
           +     + G L+ LRS LV  T  A LA      +Y    + E              +  
Sbjct: 63  EDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKED 122

Query: 103 HKREKILEDVFEAVIGAIYLDS--DFATVKKVILKWYQPIISSIN 145
            +  K + D+FE++ GAIY+DS     TV +V     +P+I   +
Sbjct: 123 IEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFS 167


>3c4tA [x.x.x] ENDORIBONUCLEASE DICER
          Length = 241

 Score = 67.3 bits (163), Expect = 4e-14
 Identities = 63/236 (26%), Positives = 98/236 (41%), Gaps = 31/236 (13%)

Query: 7   RFYNILGYNFKDYTLLIRALTHRSKTKK---NYERLEFLGDSVLSFVIAEVLYKQFTDLA 63
            F   + Y FK+   L++A TH S       +Y+RLEFLGD++L ++I + LY+     +
Sbjct: 15  TFEKKINYRFKNKAYLLQAFTHASYHYNTITDYQRLEFLGDAILDYLITKHLYEDPRQHS 74

Query: 64  EGKLSQLRSKLVKGTTLAQLASSLKMDEYIILGASEQGGHK----------------REK 107
            G L+ LRS LV  T  A LA      +Y    + E                       K
Sbjct: 75  PGVLTDLRSALVNNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVKFQLEKNEEDIEVPK 134

Query: 108 ILEDVFEAVIGAIYLDS--DFATVKKVILKWYQPIISSINLDTIKVKDSKSKLQEILLQN 165
            + D+FE++ GAIY+DS      V +V     QP+I   + +    +    +L E+  + 
Sbjct: 135 AMGDIFESLAGAIYMDSGMSLEVVWQVYYPMMQPLIEKFSAN--VPRSPVRELLEMEPET 192

Query: 166 ALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTAEKMIEML 221
           A   P         +      TV  V K    + K  G S + A+   A + +  L
Sbjct: 193 AKFSPAERTYDGKVR-----VTVEVVGKG---KFKGVGRSYRIAKSAAARRALRSL 240


>2cpnA [x.x.x] TAR RNA-BINDING PROTEIN 2
          Length = 89

 Score = 58.9 bits (142), Expect = 1e-11
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 152 KDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQ 211
            +    LQE+++Q    LPEY++    G  H ++FT+    +         GTS+K A++
Sbjct: 16  CNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVER--FIEIGSGTSKKLAKR 73

Query: 212 KTAEKMIEMLSQQ 224
             A KM+  +S  
Sbjct: 74  NAAAKMLLRVSGP 86


>2dixA [x.x.x] INTERFERON-INDUCIBLE DOUBLE STRANDED RNA-
          Length = 84

 Score = 53.0 bits (127), Expect = 8e-10
 Identities = 20/75 (26%), Positives = 29/75 (38%), Gaps = 3/75 (4%)

Query: 152 KDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQ 211
           K     L E  ++     P Y  E  D + H   FT      D+      +GTS+K A+ 
Sbjct: 8   KTPIQVLHEYGMKTKNI-PVYECERSDVQIHVPTFTFRVTVGDI--TCTGEGTSKKLAKH 64

Query: 212 KTAEKMIEMLSQQGL 226
           + AE  I +L     
Sbjct: 65  RAAEAAINILKANAS 79


>1di2A [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A
          Length = 69

 Score = 51.9 bits (124), Expect = 2e-09
 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 155 KSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTA 214
              LQE+ +Q    LPEY++    G  H+++FT+    +         GTS++ A++  A
Sbjct: 3   VGSLQELAVQKGWRLPEYTVAQESGPPHKREFTITCRVET--FVETGSGTSKQVAKRVAA 60

Query: 215 EKMIEML 221
           EK++   
Sbjct: 61  EKLLTKF 67


>2b7tA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC EDITASE 1
          Length = 73

 Score = 51.4 bits (123), Expect = 3e-09
 Identities = 13/69 (18%), Positives = 24/69 (34%), Gaps = 4/69 (5%)

Query: 150 KVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKA 209
                K+ L ++         +Y + +  G  H   F +              G ++KKA
Sbjct: 2   GPVLPKNALMQLNEIK--PGLQYMLLSQTGPVHAPLFVMSVEVNGQVFE--GSGPTKKKA 57

Query: 210 EQKTAEKMI 218
           +   AEK +
Sbjct: 58  KLHAAEKAL 66


>2dmyA [x.x.x] SPERMATID PERINUCLEAR RNA-BINDING PROTEIN
          Length = 97

 Score = 50.8 bits (121), Expect = 4e-09
 Identities = 15/81 (18%), Positives = 29/81 (35%), Gaps = 4/81 (4%)

Query: 150 KVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKA 209
           K  D  + L  +         +Y + +  G  H   FT+           +A G S+K A
Sbjct: 14  KAIDLMNALMRLNQIR--PGLQYKLLSQSGPVHAPVFTMSVDVDGT--TYEASGPSKKTA 69

Query: 210 EQKTAEKMIEMLSQQGLHEKK 230
           +   A K+++ +      +  
Sbjct: 70  KLHVAVKVLQAMGYPTGFDAD 90


>1ekzA [d.50.1] MATERNAL EFFECT PROTEIN (STAUFEN)
          Length = 76

 Score = 49.5 bits (118), Expect = 1e-08
 Identities = 15/76 (19%), Positives = 36/76 (47%), Gaps = 3/76 (3%)

Query: 146 LDTIKVKDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTS 205
           +D    K   S++ EI ++  ++   + +   +G  H + F    +   +    + +G  
Sbjct: 1   MDEGDKKSPISQVHEIGIKRNMT-VHFKVLREEGPAHMKNFITACIVGSI--VTEGEGNG 57

Query: 206 RKKAEQKTAEKMIEML 221
           +K ++++ AEKM+  L
Sbjct: 58  KKVSKKRAAEKMLVEL 73


>2b7vA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC EDITASE 1
          Length = 71

 Score = 43.3 bits (102), Expect = 7e-07
 Identities = 12/70 (17%), Positives = 26/70 (37%), Gaps = 7/70 (10%)

Query: 152 KDSKSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQ 211
           K+    L E+         +Y   +  G+ H + F +  V           G ++K A+ 
Sbjct: 4   KNPVMILNELRPG-----LKYDFLSESGESHAKSFVMSVVVDGQFFE--GSGRNKKLAKA 56

Query: 212 KTAEKMIEML 221
           + A+  +  +
Sbjct: 57  RAAQSALATV 66


>1di2B [d.50.1] DOUBLE STRANDED RNA BINDING PROTEIN A
          Length = 60

 Score = 42.2 bits (99), Expect = 2e-06
 Identities = 18/67 (26%), Positives = 28/67 (41%), Gaps = 11/67 (16%)

Query: 155 KSKLQEILLQNALSLPEYSIETIDGKDHEQQFTVVAVSKDLNLRVKAQGTSRKKAEQKTA 214
              LQE+ +Q    LPEY            QFT+    +         GTS++ A++  A
Sbjct: 3   VGSLQELAVQKGWRLPEY---------TVAQFTITCRVETF--VETGSGTSKQVAKRVAA 51

Query: 215 EKMIEML 221
           EK++   
Sbjct: 52  EKLLTKF 58


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.323    0.141    0.435 

Gapped
Lambda     K      H
   0.267   0.0655    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,474,574
Number of extensions: 1334141
Number of successful extensions: 14851
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6421
Number of HSP's successfully gapped: 434
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.0 bits)