RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD30541.1 ftul2 ACD30541.1 GIB00719CH01 "conserved
hypothetical membrane protein"
         (351 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3ehzA [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 92 / COIL(x) 0]        131   3e-33
3eamA [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 91 / COIL(x) 0]        131   3e-33
3ei0A [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 92 / COIL(x) 0]        130   5e-33
2bg9E [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN[MASQUE...    95   3e-22
2bg9B [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN[MASQUE ...    94   4e-22
2bg9C [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN[MASQUE...    92   3e-21
2bg9A [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN[MASQUE...    74   8e-16
2bypA [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           71   5e-15
3c84A [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           70   1e-14
3c84B [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           70   1e-14
3c84E [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           68   4e-14
3c79C [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           68   5e-14
2bypD [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           67   7e-14
2bypB [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           67   7e-14
2byrB [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            67   1e-13
2bynA [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           66   2e-13
2byqC [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           65   3e-13
2bysG [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            65   3e-13
2bysE [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            64   5e-13
2byrG [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            64   8e-13
2bysF [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            63   1e-12
2byrC [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            63   2e-12
2bypE [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           61   4e-12
2br8A [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           61   4e-12
2bysA [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            61   7e-12
2bj0A [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            60   9e-12
2byrH [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            53   1e-09
2bysC [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            53   2e-09
3c84D [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           51   4e-09
2bysD [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            48   3e-08
2bysB [x.x.x] ACETYLCHOLINE-BINDING PROTEIN                            48   3e-08
3c84C [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           46   1e-07
3c79E [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           45   3e-07
2bynC [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           44   7e-07
2bynD [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR                           43   2e-06

>3ehzA [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 92 / COIL(x) 0]
          Length = 310

 Score =  131 bits (331), Expect = 3e-33
 Identities = 43/202 (21%), Positives = 88/202 (43%), Gaps = 19/202 (9%)

Query: 28  PPQ---KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQ 84
           PP    +P  V T  ++ +   L++  E  +++     SW D+RL FD        K Y+
Sbjct: 1   PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYE 60

Query: 85  GDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFP 144
            +         W P+I  +N           I + P+G + Y E+ +  + +P+   ++P
Sbjct: 61  PE-------AIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYP 113

Query: 145 FDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPI 204
           FD QTL  Y+I    +++ + L V+          V  + ++ +  W + +F    ++P 
Sbjct: 114 FDSQTLHIYLIVRSVDTRNIVLAVDLEK-------VGKNDDVFLTGWDIESFT-AVVKPA 165

Query: 205 KYYYGKPQRISMLEFSISLERK 226
            +     +  S L++ + + R+
Sbjct: 166 NFALE-DRLESKLDYQLRISRQ 186


>3eamA [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 91 / COIL(x) 0]
          Length = 311

 Score =  131 bits (331), Expect = 3e-33
 Identities = 43/202 (21%), Positives = 88/202 (43%), Gaps = 19/202 (9%)

Query: 28  PPQ---KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQ 84
           PP    +P  V T  ++ +   L++  E  +++     SW D+RL FD        K Y+
Sbjct: 4   PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYE 63

Query: 85  GDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFP 144
            +         W P+I  +N           I + P+G + Y E+ +  + +P+   ++P
Sbjct: 64  PE-------AIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYP 116

Query: 145 FDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPI 204
           FD QTL  Y+I    +++ + L V+          V  + ++ +  W + +F    ++P 
Sbjct: 117 FDSQTLHIYLIVRSVDTRNIVLAVDLEK-------VGKNDDVFLTGWDIESFT-AVVKPA 168

Query: 205 KYYYGKPQRISMLEFSISLERK 226
            +     +  S L++ + + R+
Sbjct: 169 NFALE-DRLESKLDYQLRISRQ 189


>3ei0A [x.x.x] GLR4197 PROTEIN[MASQUE : MEMB(X) 92 / COIL(x) 0]
          Length = 310

 Score =  130 bits (329), Expect = 5e-33
 Identities = 43/202 (21%), Positives = 89/202 (44%), Gaps = 19/202 (9%)

Query: 28  PPQ---KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQ 84
           PP    +P  V T  ++ +   L++  E  +++     SW D+RL FD        K Y+
Sbjct: 1   PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYE 60

Query: 85  GDFQYDEVFEGWKPQISIINEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFP 144
            +         W P+I  +N           I + P+G + Y E+ +  + +P+   ++P
Sbjct: 61  PE-------AIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYP 113

Query: 145 FDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPI 204
           FD QTL  Y+I    +++ + L V+          V  + ++ +  W + +F    ++P 
Sbjct: 114 FDSQTLHIYLIVRSVDTRNIVLAVDLEK-------VGKNDDVFLTGWDIESFT-AVVKPA 165

Query: 205 KYYYGKPQRISMLEFSISLERK 226
            +   + +  S L++ + + R+
Sbjct: 166 NFAL-EDRLESKLDYQLRISRQ 186


>2bg9E [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, GAMMA CHAIN[MASQUE :
           MEMB(X) 92 / COIL(x) 0]
          Length = 370

 Score = 95.2 bits (236), Expect = 3e-22
 Identities = 39/199 (19%), Positives = 70/199 (35%), Gaps = 15/199 (7%)

Query: 31  KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYD 90
               V     +T++  LNE  E L  +V     WND RL ++ +E +    +        
Sbjct: 26  HVIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVR------I 79

Query: 91  EVFEGWKPQISIINEIGTPQ--IKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQ 148
                W P + + N +           + +Y +G + +          P+ +  FPFD Q
Sbjct: 80  PSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQ 139

Query: 149 TLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYY 208
                     YN+ EV L +     I  +D+ ++       EW + +   K         
Sbjct: 140 NCSLVFRSQTYNAHEVNLQLSAEEGIDPEDFTENG------EWTIRHRPAKKNY-NWQLT 192

Query: 209 GKPQRISMLEFSISLERKP 227
                   + F + ++RKP
Sbjct: 193 KDDIDFQEIIFFLIIQRKP 211


>2bg9B [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, BETA CHAIN[MASQUE :
           MEMB(X) 92 / COIL(x) 0]
          Length = 370

 Score = 94.4 bits (234), Expect = 4e-22
 Identities = 35/199 (17%), Positives = 68/199 (34%), Gaps = 19/199 (9%)

Query: 31  KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYD 90
               V+    +T + ILNE NE++   V    +W D RL++D    +    L        
Sbjct: 27  DKVTVRVGLTLTSLLILNEKNEEMTTSVFLNLAWTDYRLQWDPAAYEGIKDLSIPSDDV- 85

Query: 91  EVFEGWKPQISIINEIGTPQ--IKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQ 148
                W+P I ++N             + +   G + +           +++  FPFD Q
Sbjct: 86  -----WQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWHPSAIYRSSCTIKVMYFPFDWQ 140

Query: 149 TLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYY 208
                   + Y++ EV L    +  I    +                + +++    K + 
Sbjct: 141 NCTMVFKSYTYDTSEVILQHALDAMINQDAF-----------TENGQWSIEHKPSRKNWR 189

Query: 209 GKPQRISMLEFSISLERKP 227
                   + F + ++RKP
Sbjct: 190 SDDPSYEDVTFYLIIQRKP 208


>2bg9C [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, DELTA CHAIN[MASQUE :
           MEMB(X) 114 / COIL(x) 0]
          Length = 369

 Score = 91.6 bits (227), Expect = 3e-21
 Identities = 33/179 (18%), Positives = 60/179 (33%), Gaps = 19/179 (10%)

Query: 51  NEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQ 110
           +E L  +V    +W D RL ++ +E      L             W P I + N      
Sbjct: 49  DETLTTNVWMDHAWYDHRLTWNASEYSDISILRLRPELI------WIPDIVLQNNNDGQY 102

Query: 111 --IKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIV 168
                  + + PNG + +          P+ +  FPFD Q          YN+ E+ +  
Sbjct: 103 NVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYNANEISM-- 160

Query: 169 EPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQRISMLEFSISLERKP 227
             +  I  + + ++       EW + +   K       +         + F + + RKP
Sbjct: 161 --DLIIDPEAFTEN------GEWEIIHKPAKKNIYGDKFPNGTNY-QDVTFYLIIRRKP 210


>2bg9A [x.x.x] ACETYLCHOLINE RECEPTOR PROTEIN, ALPHA CHAIN[MASQUE :
           MEMB(X) 115 / COIL(x) 0]
          Length = 370

 Score = 73.6 bits (180), Expect = 8e-16
 Identities = 28/185 (15%), Positives = 63/185 (34%), Gaps = 28/185 (15%)

Query: 51  NEQLQIDVIFRFSWNDQRLEFDKNEEK-------TPYKLYQGDFQYDEVFEGWKPQISII 103
           N+ ++ +V  R  W D RL ++  +             ++  D       +G    + + 
Sbjct: 47  NQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMT 106

Query: 104 NEIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTLKAYIIPFGYNSKE 163
             +           +   G I++T          + +  FPFD+Q     +  + Y+  +
Sbjct: 107 KLL-----------LDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTK 155

Query: 164 VQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGKPQ-RISMLEFSIS 222
           V +  E +    +  +      +   EW +   D +  +   YY   P      + +   
Sbjct: 156 VSISPESDR-PDLSTF------MESGEWVM--KDYRGWKHWVYYTCCPDTPYLDITYHFI 206

Query: 223 LERKP 227
           ++R P
Sbjct: 207 MQRIP 211


>2bypA [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 210

 Score = 71.0 bits (173), Expect = 5e-15
 Identities = 27/211 (12%), Positives = 59/211 (27%), Gaps = 18/211 (8%)

Query: 18  YSDIF-GYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEE 76
            SD+F  Y       P  V     + DI   +    ++ +    +  W    L +D NE 
Sbjct: 15  KSDLFNRYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEY 74

Query: 77  KTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRTLHLE 135
                            + W P I+  +     Q+   +   +  +G +++   + L   
Sbjct: 75  GNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFM 128

Query: 136 TPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSN 195
                     +  T       + Y+  E+ L  +        D V        +++ + +
Sbjct: 129 CDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILS 180

Query: 196 FDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
                     Y       I  +   +    +
Sbjct: 181 ATQTRQV-QHYSCCPEPYID-VNLVVKFRER 209


>3c84A [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 210

 Score = 69.9 bits (170), Expect = 1e-14
 Identities = 25/214 (11%), Positives = 61/214 (28%), Gaps = 21/214 (9%)

Query: 18  YSDIFGYGDIPP----QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDK 73
            SD+F    + P      P  V     + DI   +    ++ +    +  W    L +D 
Sbjct: 13  KSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDP 72

Query: 74  NEEKTPYKLYQGDFQYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTL 132
           NE                  + W P I+  +       +  +   +  +G +++   + L
Sbjct: 73  NEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRL 126

Query: 133 HLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWH 192
                        +  T       + Y+  E+ L  + +  + +  Y         +++ 
Sbjct: 127 SFMCDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYE 178

Query: 193 LSNFDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
           + +          Y       I  +   +    +
Sbjct: 179 ILSATQTRQV-QHYSCCPEPYID-VNLVVKFRER 210


>3c84B [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 210

 Score = 69.9 bits (170), Expect = 1e-14
 Identities = 21/200 (10%), Positives = 55/200 (27%), Gaps = 17/200 (8%)

Query: 28  PPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDF 87
               P  V     + DI   +    ++ +    +  W    L +D NE            
Sbjct: 26  TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNI------TD 79

Query: 88  QYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFD 146
                 + W P I+  +       +  +   +  +G +++   + L             +
Sbjct: 80  FRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEE 138

Query: 147 KQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKY 206
             T       + Y+  E+ L  + +  + +  Y         +++ + +          Y
Sbjct: 139 GATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHY 190

Query: 207 YYGKPQRISMLEFSISLERK 226
                  I  +   +    +
Sbjct: 191 SCCPEPYID-VNLVVKFRER 209


>3c84E [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 205

 Score = 67.9 bits (165), Expect = 4e-14
 Identities = 22/200 (11%), Positives = 53/200 (26%), Gaps = 17/200 (8%)

Query: 28  PPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDF 87
               P  V     + DI   +    ++ +    +  W    L +D NE            
Sbjct: 22  TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNI------TD 75

Query: 88  QYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFD 146
                 + W P I+  +       +  +   +  +G +++   + L             +
Sbjct: 76  FRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEE 134

Query: 147 KQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKY 206
             T       + Y+  E+ L  +        D V        +++ + +          Y
Sbjct: 135 GATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHY 186

Query: 207 YYGKPQRISMLEFSISLERK 226
                  I  +   +    +
Sbjct: 187 SCCPEPYID-VNLVVKFRER 205


>3c79C [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 208

 Score = 67.6 bits (164), Expect = 5e-14
 Identities = 21/200 (10%), Positives = 54/200 (27%), Gaps = 17/200 (8%)

Query: 28  PPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDF 87
               P  V     + DI   +    ++ +    +  W    L +D NE            
Sbjct: 24  TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAA 83

Query: 88  QYDEVFEGWKPQISIINE-IGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFD 146
                   W P I+  +       +  +   +  +G +++   + L             +
Sbjct: 84  DI------WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEE 136

Query: 147 KQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKY 206
             T       + Y+  E+ L  + +  + +  Y         +++ + +          Y
Sbjct: 137 GATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHY 188

Query: 207 YYGKPQRISMLEFSISLERK 226
                  I  +   +    +
Sbjct: 189 SCCPEPYID-VNLVVKFRER 207


>2bypD [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 207

 Score = 67.2 bits (163), Expect = 7e-14
 Identities = 23/198 (11%), Positives = 54/198 (27%), Gaps = 17/198 (8%)

Query: 30  QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQY 89
             P  V     + DI   +    ++ +    +  W    L +D NE              
Sbjct: 25  DDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNI------TDFR 78

Query: 90  DEVFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQ 148
               + W P I+  +     Q+   +   +  +G +++   + L             +  
Sbjct: 79  TSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEEGA 137

Query: 149 TLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYY 208
           T       + Y+  E+ L  +        D V        +++ + +          Y  
Sbjct: 138 TCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYEILSATQTRQV-QHYSC 189

Query: 209 GKPQRISMLEFSISLERK 226
                I  +   +    +
Sbjct: 190 CPEPYID-VNLVVKFRER 206


>2bypB [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 213

 Score = 67.2 bits (163), Expect = 7e-14
 Identities = 25/214 (11%), Positives = 60/214 (28%), Gaps = 21/214 (9%)

Query: 18  YSDIFGYGDIPP----QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDK 73
            SD+F    + P      P  V     + DI   +    ++ +    +  W    L +D 
Sbjct: 15  KSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDP 74

Query: 74  NEEKTPYKLYQGDFQYDEVFEGWKPQISIINE-IGTPQIKARQIKIYPNGDIIYTEQRTL 132
           NE                  + W P I+  +       +  +   +  +G +++   + L
Sbjct: 75  NEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRL 128

Query: 133 HLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWH 192
                        +  T       + Y+  E+ L  +   ++ +  Y          ++ 
Sbjct: 129 SFMCDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSYYASS------KYE 180

Query: 193 LSNFDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
           + +          Y       I  +   +    +
Sbjct: 181 ILSATQTRQV-QHYSCCPEPYID-VNLVVKFRER 212


>2byrB [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 210

 Score = 66.6 bits (162), Expect = 1e-13
 Identities = 29/216 (13%), Positives = 68/216 (31%), Gaps = 23/216 (10%)

Query: 18  YSDIFGYGDIPPQK----PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDK 73
            SD+F    + P      P  V     + DI   +    ++ +    +  W    L +D 
Sbjct: 11  KSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDP 70

Query: 74  NEEKTPYKLYQG-DFQYDEVFEGWKPQISIINEIGTPQIKARQI-KIYPNGDIIYTEQRT 131
           NE       Y           + W P I+  +     Q+ + QI  +  +G +++   + 
Sbjct: 71  NE-------YGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQR 123

Query: 132 LHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEW 191
           L             +  T       + Y+  E+ L  + + ++ +  Y         +++
Sbjct: 124 LSFMCDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTDTD-QVDLSSYYAS------SKY 175

Query: 192 HLSNFDLKNIEPIKYYYGKPQRISMLEFSISLERKP 227
                       +++Y   P+    +   +    + 
Sbjct: 176 --EILSATQTRQVQHYSCCPEPYIDVNLVVKFRERR 209


>2bynA [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 216

 Score = 65.6 bits (159), Expect = 2e-13
 Identities = 25/214 (11%), Positives = 61/214 (28%), Gaps = 21/214 (9%)

Query: 18  YSDIFGYGDIPP----QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDK 73
            SD+F    + P      P  V     + DI   +    ++ +    +  W    L +D 
Sbjct: 18  KSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDP 77

Query: 74  NEEKTPYKLYQGDFQYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTL 132
           NE                  + W P I+  +       +  +   +  +G +++   + L
Sbjct: 78  NEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRL 131

Query: 133 HLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWH 192
                        +  T       + Y+  E+ L  + +  + +  Y         +++ 
Sbjct: 132 SFMCDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYE 183

Query: 193 LSNFDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
           + +          Y       I  +   +    +
Sbjct: 184 ILSATQTRQV-QHYSCCPEPYID-VNLVVKFRER 215


>2byqC [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 214

 Score = 65.2 bits (158), Expect = 3e-13
 Identities = 22/199 (11%), Positives = 55/199 (27%), Gaps = 17/199 (8%)

Query: 29  PQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQ 88
              P  V     + DI   +    ++ +    +  W    L +D NE             
Sbjct: 31  KDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAAD 90

Query: 89  YDEVFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDK 147
                  W P I+  +     Q+   +   +  +G +++   + L             + 
Sbjct: 91  I------WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEG 143

Query: 148 QTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYY 207
            T       + Y+  E+ L  +   ++ +  Y         +++ + +          Y 
Sbjct: 144 ATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSY------YASSKYEILSATQTRQV-QHYS 195

Query: 208 YGKPQRISMLEFSISLERK 226
                 I  +   +    +
Sbjct: 196 CCPEPYID-VNLVVKFRER 213


>2bysG [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 203

 Score = 65.2 bits (158), Expect = 3e-13
 Identities = 21/197 (10%), Positives = 55/197 (27%), Gaps = 17/197 (8%)

Query: 31  KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYD 90
            P  V     + DI   +    ++ +    +  W    L +D NE               
Sbjct: 22  DPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNI------TDFRT 75

Query: 91  EVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQT 149
              + W P I+  +       +  +   +  +G +++   + L             +  T
Sbjct: 76  SAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEGAT 134

Query: 150 LKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYG 209
                  + Y+  E+ L  + +  + +  Y         +++ + +          Y   
Sbjct: 135 CAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCC 186

Query: 210 KPQRISMLEFSISLERK 226
               I  +   +    +
Sbjct: 187 PEPYID-VNLVVKFRER 202


>2bysE [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 206

 Score = 64.4 bits (156), Expect = 5e-13
 Identities = 23/215 (10%), Positives = 58/215 (26%), Gaps = 21/215 (9%)

Query: 17  FYSDIFGYGDIPPQK----PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFD 72
               +       P      P  V     + DI   +    ++ +    +  W    L +D
Sbjct: 7   NLMRLKSDLFNYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWD 66

Query: 73  KNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRT 131
            NE                  + W P I+  +     Q+   +   +  +G +++   + 
Sbjct: 67  PNEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQR 120

Query: 132 LHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEW 191
           L             +  T       + Y+  E+ L  +   ++ +  Y         +++
Sbjct: 121 LSFMCDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSY------YASSKY 172

Query: 192 HLSNFDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
            + +          Y       I  +   +    +
Sbjct: 173 EILSATQTRQV-QHYSCCPEPYID-VNLVVKFRER 205


>2byrG [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 205

 Score = 63.7 bits (154), Expect = 8e-13
 Identities = 27/215 (12%), Positives = 60/215 (27%), Gaps = 21/215 (9%)

Query: 17  FYSDIFGYGDIPP----QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFD 72
             SD+F    + P      P  V     + DI   +    ++ +    +  W    L +D
Sbjct: 7   LKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWD 66

Query: 73  KNEEKTPYKLYQGDFQYDEVFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRT 131
            NE                  + W P I+  +     Q+   +   +  +G +++   + 
Sbjct: 67  PNEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQR 120

Query: 132 LHLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEW 191
           L             +  T       + Y+  E+ L  +        D V        +++
Sbjct: 121 LSFMCDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKY 172

Query: 192 HLSNFDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
            + +          Y       I  +   +    +
Sbjct: 173 EILSATQTRQV-QHYSCCPEPYID-VNLVVKFRER 205


>2bysF [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 204

 Score = 63.3 bits (153), Expect = 1e-12
 Identities = 25/211 (11%), Positives = 60/211 (28%), Gaps = 18/211 (8%)

Query: 18  YSDIF-GYGDIPPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEE 76
            SD+F  Y       P  V     + DI   +    ++ +    +  W    L +D NE 
Sbjct: 9   KSDLFNRYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEY 68

Query: 77  KTPYKLYQGDFQYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLE 135
                            + W P I+  +       +  +   +  +G +++   + L   
Sbjct: 69  GNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFM 122

Query: 136 TPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSN 195
                     +  T       + Y+  E+ L  + +  + +  Y         +++ + +
Sbjct: 123 CDPTG-VDSEEGATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILS 174

Query: 196 FDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
                     Y       I  +   +    +
Sbjct: 175 ATQTRQV-QHYSCCPEPYID-VNLVVKFRER 203


>2byrC [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 210

 Score = 62.6 bits (151), Expect = 2e-12
 Identities = 21/200 (10%), Positives = 55/200 (27%), Gaps = 17/200 (8%)

Query: 28  PPQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDF 87
               P  V     + DI   +    ++ +    +  W    L +D NE            
Sbjct: 26  TKDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNI------TD 79

Query: 88  QYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFD 146
                 + W P I+  +       +  +   +  +G +++   + L             +
Sbjct: 80  FRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEE 138

Query: 147 KQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKY 206
             T       + Y+  E+ L  + +  + +  Y         +++ + +          Y
Sbjct: 139 GATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHY 190

Query: 207 YYGKPQRISMLEFSISLERK 226
                  I  +   +    +
Sbjct: 191 SCCPEPYID-VNLVVKFRER 209


>2bypE [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 212

 Score = 61.4 bits (148), Expect = 4e-12
 Identities = 22/201 (10%), Positives = 54/201 (26%), Gaps = 23/201 (11%)

Query: 30  QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQY 89
             P  V     + DI   +    ++ +    +  W    L +D NE              
Sbjct: 30  DDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDF------R 83

Query: 90  DEVFEGWKPQISIIN----EIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPF 145
               + W P I+  +            A    +  +G +++   + L             
Sbjct: 84  TSAADIWTPDITAYSSTRPVQVLSPQIAV---VTHDGSVMFIPAQRLSFMCDPTG-VDSE 139

Query: 146 DKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIK 205
           +  T       + Y+  E+ L  +   ++ +  Y         +++ + +          
Sbjct: 140 EGATCAVKFGSWVYSGFEIDLKTD-TDQVDLSSY------YASSKYEILSATQTRQV-QH 191

Query: 206 YYYGKPQRISMLEFSISLERK 226
           Y       I  +   +    +
Sbjct: 192 YSCCPEPYID-VNLVVKFRER 211


>2br8A [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 205

 Score = 61.4 bits (148), Expect = 4e-12
 Identities = 26/214 (12%), Positives = 60/214 (28%), Gaps = 21/214 (9%)

Query: 18  YSDIFGYGDIPP----QKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDK 73
            SD+F    + P      P  V     + DI  ++    ++ +    +  W    L +D 
Sbjct: 8   KSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKVDSSTNEVDLVYYEQQRWKLNSLMWDP 67

Query: 74  NEEKTPYKLYQGDFQYDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTL 132
           NE                  + W P I+  +       +  +   +  +G +++   + L
Sbjct: 68  NEYGNI------TDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRL 121

Query: 133 HLETPMRLEKFPFDKQTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWH 192
                        +  T       + Y+  E+ L  +        D V        +++ 
Sbjct: 122 SFMCDPTG-VDSEEGVTCAVKFGSWVYSGFEIDLKTD-------TDQVDLSSYYASSKYE 173

Query: 193 LSNFDLKNIEPIKYYYGKPQRISMLEFSISLERK 226
           + +          Y       I  +   +    +
Sbjct: 174 ILSATQTRQV-QHYSCCPEPYID-VNLVVKFRER 205


>2bysA [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 205

 Score = 60.6 bits (146), Expect = 7e-12
 Identities = 21/199 (10%), Positives = 55/199 (27%), Gaps = 17/199 (8%)

Query: 29  PQKPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQ 88
              P  V     + DI   +    ++ +    +  W    L +D NE             
Sbjct: 22  KDDPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAAD 81

Query: 89  YDEVFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDK 147
                  W P I+  +       +  +   +  +G +++   + L             + 
Sbjct: 82  I------WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEG 134

Query: 148 QTLKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYY 207
            T       + Y+  E+ L  + +  + +  Y         +++ + +      +   Y 
Sbjct: 135 ATCAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTR-QVQHYS 186

Query: 208 YGKPQRISMLEFSISLERK 226
                 I  +   +    +
Sbjct: 187 CCPEPYID-VNLVVKFRER 204


>2bj0A [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 203

 Score = 60.2 bits (145), Expect = 9e-12
 Identities = 26/197 (13%), Positives = 68/197 (34%), Gaps = 17/197 (8%)

Query: 31  KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYD 90
            P  V  +  + +I   +   +Q+++ +  + SW         +   +   L Q      
Sbjct: 23  TPLNVSLNFKLMNIVEADTEKDQVEVVLWTQASWKVPYY----SSLLSSSSLDQVSLPVS 78

Query: 91  EVFEGWKPQISIIN-EIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQT 149
           ++   W P +S  N       + A ++ +  +G +IY   + +     +          T
Sbjct: 79  KM---WTPDLSFYNAIAAPELLSADRVVVSKDGSVIYVPSQRVRFTCDLIN-VDTEPGAT 134

Query: 150 LKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYG 209
            +  +  + +++K+  LI      + + +Y       +  ++ L +         K Y  
Sbjct: 135 CRIKVGSWTHDNKQFALITGEEGVVNIAEY------FDSPKFDLLSATQSLNR--KKYSC 186

Query: 210 KPQRISMLEFSISLERK 226
                  +E + +  +K
Sbjct: 187 CENMYDDIEITFAFRKK 203


>2byrH [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 204

 Score = 53.0 bits (126), Expect = 1e-09
 Identities = 22/197 (11%), Positives = 54/197 (27%), Gaps = 17/197 (8%)

Query: 31  KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYD 90
            P  V     + DI   +    ++ +    +  W    L +D NE               
Sbjct: 24  DPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI- 82

Query: 91  EVFEGWKPQISIINEIGTPQIKA-RQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQT 149
                W P I+  +     Q+ + +   +  +G +++   + L             +  T
Sbjct: 83  -----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEEGAT 136

Query: 150 LKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYG 209
                  + Y+  E+ L  + +        V        +++ + +          Y   
Sbjct: 137 CAVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCC 188

Query: 210 KPQRISMLEFSISLERK 226
               I +    +    +
Sbjct: 189 PEPYIDV-NLVVKFRER 204


>2bysC [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 203

 Score = 52.6 bits (125), Expect = 2e-09
 Identities = 22/196 (11%), Positives = 54/196 (27%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 23  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 80

Query: 92  VFEGWKPQISIINEIGTPQIKA-RQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +     Q+ + +   +  +G +++   + L             +  T 
Sbjct: 81  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEGATC 135

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +        V        +++ + +          Y    
Sbjct: 136 AVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP 187

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 188 EPYIDV-NLVVKFRER 202


>3c84D [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 209

 Score = 51.5 bits (122), Expect = 4e-09
 Identities = 21/196 (10%), Positives = 54/196 (27%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 29  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 86

Query: 92  VFEGWKPQISIIN-EIGTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +       +  +   +  +G +++   + L             +  T 
Sbjct: 87  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEGATC 141

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +  + +  Y         +++ + +          Y    
Sbjct: 142 AVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP 193

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 194 EPYIDV-NLVVKFRER 208


>2bysD [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 205

 Score = 48.4 bits (114), Expect = 3e-08
 Identities = 22/196 (11%), Positives = 55/196 (28%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 25  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 82

Query: 92  VFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +     Q+   +   +  +G +++   + L             +  T 
Sbjct: 83  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEGATC 137

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +  + +  Y         +++ + +          Y    
Sbjct: 138 AVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP 189

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 190 EPYIDV-NLVVKFRER 204


>2bysB [x.x.x] ACETYLCHOLINE-BINDING PROTEIN
          Length = 206

 Score = 48.4 bits (114), Expect = 3e-08
 Identities = 22/197 (11%), Positives = 55/197 (27%), Gaps = 17/197 (8%)

Query: 31  KPTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYD 90
            P  V     + DI   +    ++ +    +  W    L +D NE               
Sbjct: 25  DPLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI- 83

Query: 91  EVFEGWKPQISIINEIGTPQI-KARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQT 149
                W P I+  +     Q+   +   +  +G +++   + L             +  T
Sbjct: 84  -----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTG-VDSEEGAT 137

Query: 150 LKAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYG 209
                  + Y+  E+ L  + +  + +  Y         +++ + +          Y   
Sbjct: 138 CAVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCC 189

Query: 210 KPQRISMLEFSISLERK 226
               I +    +    +
Sbjct: 190 PEPYIDV-NLVVKFRER 205


>3c84C [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 208

 Score = 46.2 bits (108), Expect = 1e-07
 Identities = 21/196 (10%), Positives = 52/196 (26%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 29  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 86

Query: 92  VFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +       +  +   +  +G +++   + L             +  T 
Sbjct: 87  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEEGATC 141

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +        V        +++ + +          Y    
Sbjct: 142 AVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP 193

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 194 EPYIDV-NLVVKFRER 208


>3c79E [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 211

 Score = 45.3 bits (106), Expect = 3e-07
 Identities = 21/196 (10%), Positives = 52/196 (26%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 31  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 88

Query: 92  VFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +       +  +   +  +G +++   + L             +  T 
Sbjct: 89  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEEGATC 143

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +        V        +++ + +          Y    
Sbjct: 144 AVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP 195

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 196 EPYIDV-NLVVKFRER 210


>2bynC [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 212

 Score = 43.8 bits (102), Expect = 7e-07
 Identities = 21/196 (10%), Positives = 52/196 (26%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 32  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 89

Query: 92  VFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +       +  +   +  +G +++   + L             +  T 
Sbjct: 90  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEEGATC 144

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +        V        +++ + +          Y    
Sbjct: 145 AVKFGSWVYSGFEIDLKTDTDQ-------VDLSSYYASSKYEILSATQTRQV-QHYSCCP 196

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 197 EPYIDV-NLVVKFRER 211


>2bynD [x.x.x] SOLUBLE ACETYLCHOLINE RECEPTOR
          Length = 213

 Score = 42.7 bits (99), Expect = 2e-06
 Identities = 21/196 (10%), Positives = 54/196 (27%), Gaps = 17/196 (8%)

Query: 32  PTLVKTSAFITDIQILNEMNEQLQIDVIFRFSWNDQRLEFDKNEEKTPYKLYQGDFQYDE 91
           P  V     + DI   +    ++ +    +  W    L +D NE                
Sbjct: 33  PLTVTLGFTLQDIVKADSSTNEVDLVYYEQQRWKLNSLMWDPNEYGNITDFRTSAADI-- 90

Query: 92  VFEGWKPQISIINEI-GTPQIKARQIKIYPNGDIIYTEQRTLHLETPMRLEKFPFDKQTL 150
               W P I+  +       +  +   +  +G +++   + L             +  T 
Sbjct: 91  ----WTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDP-TGVDSEEGATC 145

Query: 151 KAYIIPFGYNSKEVQLIVEPNHKITVKDYVKDHPNINVAEWHLSNFDLKNIEPIKYYYGK 210
                 + Y+  E+ L  + +  + +  Y         +++ + +          Y    
Sbjct: 146 AVKFGSWVYSGFEIDLKTDTDQ-VDLSSY------YASSKYEILSATQTRQV-QHYSCCP 197

Query: 211 PQRISMLEFSISLERK 226
              I +    +    +
Sbjct: 198 EPYIDV-NLVVKFRER 212


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.136    0.357 

Gapped
Lambda     K      H
   0.267   0.0482    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 18,616,135
Number of extensions: 1116838
Number of successful extensions: 11867
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4482
Number of HSP's successfully gapped: 315
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)