RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD30683.1 ftul2 hfq GIB00719CH01 "host factor I for
bacteriophage Q beta replication"
         (109 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1b34B [b.38.1] PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D2)         52   6e-10

>1b34B [b.38.1] PROTEIN (SMALL NUCLEAR RIBONUCLEOPROTEIN SM D2)
          Length = 74

 Score = 52.5 bits (126), Expect = 6e-10
 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 3/63 (4%)

Query: 10 PFLNALRKEKVNVSVYLVNGIKLQGQVEAFDQFC-IVLRNTVNQMVYKHAISTIVPAKSV 68
            L    K    V +   N  KL G+V+AFD+ C +VL N      Y   +   +   SV
Sbjct: 5  SVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMDRYISKM--FLRGDSV 62

Query: 69 RMV 71
           +V
Sbjct: 63 IVV 65


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0488    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 24,013,048
Number of extensions: 1510100
Number of successful extensions: 18491
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8536
Number of HSP's successfully gapped: 590
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)