RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD31006.1 ftul2 ACD31006.1 GIB00719CH01 "drug:H+ antiporter-1
(DHA2) family protein"
         (509 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2d33D [x.x.x] GLUTAMATE--CYSTEINE LIGASE                               41   1e-05

>2d33D [x.x.x] GLUTAMATE--CYSTEINE LIGASE
          Length = 499

 Score = 40.7 bits (94), Expect = 1e-05
 Identities = 7/117 (5%), Positives = 22/117 (18%), Gaps = 1/117 (0%)

Query: 79  KYGIKRVALVSSVIFGISSIMCGLSTSLAEMIVFRAFQGMGGAFLPSVAQTYISTSFKNE 138
                 +       +         + S     +     G       +V Q          
Sbjct: 227 TNSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIEKDGKRLQINSNVLQIENELYAPIR 286

Query: 139 EYNKMMTIYSMVIVMGPIIGPVLG-GAICENMSWEWIFYVNVPLCIVAFIIIAFMME 194
                 +  S    +       +   ++  N              +  F++   + +
Sbjct: 287 PKRVTRSGESPSDALLRGGIEYIEVRSLDINPFSPIGVDEQQVRFLDLFMVWCALAD 343


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.314    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0524    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 27,137,653
Number of extensions: 1642339
Number of successful extensions: 17499
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 6600
Number of HSP's successfully gapped: 281
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)