RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ACD31313.1 ftul2 wbtG GIB00719CH01 "glycosyl transferase"
         (366 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3c48B [x.x.x] PREDICTED GLYCOSYLTRANSFERASES                          116   1e-28
3c4qB [x.x.x] PREDICTED GLYCOSYLTRANSFERASES                          113   9e-28
3c48A [x.x.x] PREDICTED GLYCOSYLTRANSFERASES                          111   4e-27
3beoA [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE                     111   5e-27
3c4qA [x.x.x] PREDICTED GLYCOSYLTRANSFERASES                          103   1e-24
2bisA [x.x.x] GLGA GLYCOGEN SYNTHASE                                  100   1e-23
3dzcA [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE                      96   2e-22
2acvA [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE...    92   2e-21
3d1jA [x.x.x] GLYCOGEN SYNTHASE                                        88   4e-20
2c4mA [x.x.x] GLYCOGEN PHOSPHORYLASE                                   87   1e-19
3e3lA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      85   4e-19
2atiA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       83   1e-18
2c4mC [x.x.x] GLYCOGEN PHOSPHORYLASE                                   82   2e-18
3e3nE [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      82   3e-18
3copA [x.x.x] GLYCOGEN SYNTHASE                                        81   5e-18
3e3oD [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      81   6e-18
1c3jA [c.87.1] BETA-GLUCOSYLTRANSFERASE                                79   1e-17
3cuyA [x.x.x] GLUCURONOSYLTRANSFERASE GUMK                             79   1e-17
3e3oA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      79   2e-17
2bgtA [x.x.x] BETA-GLUCOSYLTRANSFERASE                                 79   3e-17
1b4dA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)                      78   5e-17
1e1yA [c.87.1] GLYCOGEN PHOSPHORYLASE                                  78   5e-17
3cv3A [x.x.x] GLUCURONOSYLTRANSFERASE GUMK                             77   8e-17
2bfwA [x.x.x] GLGA GLYCOGEN SYNTHASE                                   76   2e-16
3e3oB [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      75   3e-16
3e3lB [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      75   4e-16
3e3oC [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      74   5e-16
1e4oA [c.87.1] MALTODEXTRIN PHOSPHORYLASE                              74   5e-16
3e3lC [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      74   5e-16
3cejA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       74   7e-16
3cehA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       74   7e-16
3dd1B [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       73   1e-15
3e3lD [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      73   1e-15
3e3nC [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      73   2e-15
2acvB [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE...    73   2e-15
3ddsB [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       72   2e-15
1a8iA [x.x.x] GLYCOGEN PHOSPHORYLASE B                                 72   2e-15
3ddwB [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       72   2e-15
3cuvA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM                      71   6e-15
2bguA [x.x.x] BETA-GLUCOSYLTRANSFERASE                                 70   1e-14
1c8lA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)                        65   2e-13
3ddsA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM                       64   5e-13
3bjxB [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI                    60   1e-11
1bx3A [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)                      58   3e-11
2c4mB [x.x.x] GLYCOGEN PHOSPHORYLASE                                   57   7e-11
3d0rA [x.x.x] PROTEIN CALG3                                            54   5e-10
2c1xA [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE            53   2e-09
2c9zA [x.x.x] UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE           51   5e-09
3bjxD [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI                    49   2e-08
1bc9A [x.x.x] CYTOHESIN-1                                              49   3e-08
2c1zA [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE            48   4e-08
3d0rB [x.x.x] PROTEIN CALG3                                            48   5e-08
1ahpA [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE                       46   2e-07
2ecpA [c.87.1] MALTODEXTRIN PHOSPHORYLASE                              46   2e-07
1dvgA [a.132.1] HEME OXYGENASE-1                                       35   4e-04

>3c48B [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
          Length = 396

 Score =  116 bits (290), Expect = 1e-28
 Identities = 46/382 (12%), Positives = 109/382 (28%), Gaps = 26/382 (6%)

Query: 4   FVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFA-NKLEAYGVKVYTXXXX 62
            + +  +  Q G    +      + K    + + +   R         A  ++V      
Sbjct: 5   MISMHTSPLQQGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAG 64

Query: 63  XXXXXXXXXXY------------IKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYIN 110
                                       ++  D+IH+  + +  +  L +  +R      
Sbjct: 65  PYEGLSKEELPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHT 124

Query: 111 SIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIA---N 167
           +  +           ++       +    +D+   N+++ ++D  +    +   I+    
Sbjct: 125 AHTL----AAVKTPESEARRICEQQLVDNADVLAVNTQEEMQDLMHHYDADPDRISVVSP 180

Query: 168 GFDKDVFKPSFLK-YEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSL 226
           G D +++ P   +  E+ R    +  + K++  + R    K     ++    L   +P  
Sbjct: 181 GADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDR 240

Query: 227 RFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSS--EYLPVLDLYLSTSKVEGFPNIL 284
              +              +        F+     S         D+    S  E F  + 
Sbjct: 241 NLRVIICGGPSTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVA 300

Query: 285 AEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREY- 343
            EA     P++A+ VG     +        +   +       +  L      + RM E  
Sbjct: 301 MEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDA 360

Query: 344 --IINNFSIEAILEKHEKLYHE 363
                 FS  A   +   LY++
Sbjct: 361 VEHARTFSWAATAAQLSSLYND 382


>3c4qB [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
          Length = 393

 Score =  113 bits (282), Expect = 9e-28
 Identities = 45/381 (11%), Positives = 112/381 (29%), Gaps = 25/381 (6%)

Query: 4   FVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLE-AYGVKVYTXXXX 62
            +      + GG    +      + K    + + +   R      +  A  ++V      
Sbjct: 12  PLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAG 71

Query: 63  XXXXXXXXXXY------------IKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYIN 110
                                       ++  D+IH+  + +  +  L +  +R      
Sbjct: 72  PYEGLSKEELPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHT 131

Query: 111 SIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIA---N 167
           +  +   +        +   +        +D+   N+++ ++D  +    +   I+    
Sbjct: 132 AHTLAAVSDTPESEARRICEQQ---LVDNADVLAVNTQEEMQDLMHHYDADPDRISVVSP 188

Query: 168 GFDKDVFKPSFLKYE-KFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSL 226
           G D +++ P   +   + R    +  + K++  + R    K     ++    L   +P  
Sbjct: 189 GADVELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDR 248

Query: 227 RFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAE 286
              +         +   L  +  +         +        D+    S  E F  +  E
Sbjct: 249 NLRVIICGGPYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAME 308

Query: 287 AMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVL----ETTVVMKKRMRE 342
           A     P++A+ VG     +        +   +       +  L    ET + M +   E
Sbjct: 309 AQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDAVE 368

Query: 343 YIINNFSIEAILEKHEKLYHE 363
           +    FS  A   +   LY++
Sbjct: 369 H-ARTFSWAATAAQLSSLYND 388


>3c48A [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
          Length = 399

 Score =  111 bits (277), Expect = 4e-27
 Identities = 40/382 (10%), Positives = 98/382 (25%), Gaps = 25/382 (6%)

Query: 4   FVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXXXX 63
            + +  +  Q G    +      + K    + + +   R      +              
Sbjct: 7   MISMHTSPLQQGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAG 66

Query: 64  XXXXXXXXXYI-------------KIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYIN 110
                                       ++  D+IH+  + +  +  L +  +R      
Sbjct: 67  PYEGLSKEELPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHT 126

Query: 111 SIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTL---NNSKKSLEDHQNIGFKNQCFIAN 167
           +  +           ++       +    +D+         + L  H +        ++ 
Sbjct: 127 AHTLAAVKNSYDTPESEARRICEQQLVDNADVLAVNTQEEMQDLMHHYDADPDRISVVSP 186

Query: 168 GFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLR 227
           G D +++ P   +  +         + K++  + R    K     ++    L   +P   
Sbjct: 187 GADVELYSPGTERSRRELGI---PLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRN 243

Query: 228 FLIAGRECSKIDIGSY---LDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNIL 284
             +                L  +  +         +        D+    S  E F  + 
Sbjct: 244 LRVIICGGPSDTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVA 303

Query: 285 AEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREY- 343
            EA     P++A+ VG     +        +   +       +  L      + RM E  
Sbjct: 304 MEAQASGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDA 363

Query: 344 --IINNFSIEAILEKHEKLYHE 363
                 FS  A   +   LY++
Sbjct: 364 VEHARTFSWAATAAQLSSLYND 385


>3beoA [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
          Length = 375

 Score =  111 bits (276), Expect = 5e-27
 Identities = 37/378 (9%), Positives = 91/378 (24%), Gaps = 22/378 (5%)

Query: 1   MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKV---- 56
           M   + ++           +  L   + K    I  I  +         +   +      
Sbjct: 5   MTERLKVMTIFGTRPEAIKMAPLVLELQKHPEKIESIVTVTAQHRQMLDQVLSIFGITPD 64

Query: 57  ------YTXXXXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYIN 110
                                   K+++  KPD++                FY +    +
Sbjct: 65  FDLNIMKDRQTLIDITTRGLEGLDKVMKEAKPDIVLVHGDTTTTFIASLAAFYNQIPVGH 124

Query: 111 SIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCF--IANG 168
                           +   +L       +DL  + + KS  + Q             N 
Sbjct: 125 VEAGLRTWDKYSPYPEEMNRQL---TGVMADLHFSPTAKSATNLQKENKDESRIFITGNT 181

Query: 169 FDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRF 228
               +       Y    L    ++ + ++    R +  + +    +    L+  +  ++ 
Sbjct: 182 AIDALKTTVKETYSHPVLEKLGNNRLVLMTAHRRENLGEPMRNMFRAIKRLVDKHEDVQV 241

Query: 229 LIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAM 288
           +        +   +            +                 S   +     +  EA 
Sbjct: 242 VYPVHMNPVVRETANDILGDYGRIHLIEPL---DVIDFHNVAARSYLMLTDSGGVQEEAP 298

Query: 289 LCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVV---MKKRMREYII 345
              VP++       +      G +       + I     ++L        M K    Y  
Sbjct: 299 SLGVPVLVLRDTTERPEGIEAGTLKLAGTDEETIFSLADELLSDKEAHDKMSKASNPY-G 357

Query: 346 NNFSIEAILEKHEKLYHE 363
           +  + E I+E   K +++
Sbjct: 358 DGRASERIVEAILKHFNK 375


>3c4qA [x.x.x] PREDICTED GLYCOSYLTRANSFERASES
          Length = 393

 Score =  103 bits (256), Expect = 1e-24
 Identities = 42/378 (11%), Positives = 97/378 (25%), Gaps = 19/378 (5%)

Query: 4   FVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLE-AYGVKVYTXXXX 62
            +      + GG    +      + K    + + +   R      +  A  ++V      
Sbjct: 12  PLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRATRPSQGEIVRVAENLRVINIAAG 71

Query: 63  XXXXXXXXXXYI----------KIIRRIKPDVIHAWMYHAN-VISILCKPFYRKTKYINS 111
                                    RR K        ++              +   I++
Sbjct: 72  PYEGLSKEELPTQLAAFTGGMLSFTRREKVTYDLIHSHYWLSGQVGWLLRDLWRIPLIHT 131

Query: 112 IRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDK 171
                          +   +     +    +      + L  H +        ++ G D 
Sbjct: 132 AHTLAAVDTPESEARRICEQQLVDNADVLAVNTQEEMQDLMHHYDADPDRISVVSPGADV 191

Query: 172 DVFKPSFLKYE-KFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLI 230
           +++ P   +   + R    +  + K++  + R    K     ++    L   +P     +
Sbjct: 192 ELYSPGNDRATERSRRELGIPLHTKVVAFVGRLQPFKGPQVLIKAVAALFDRDPDRNLRV 251

Query: 231 AGRECSKIDIGSYLDNKSNVNKFFVFESV-DSSEYLPVLDLYLSTSKVEGFPNILAEAML 289
                      +         +F       +        D+    S  E F  +  EA  
Sbjct: 252 IICGGPTYRHMAEELGVEKRIRFLDPRPPSELVAVYRAADIVAVPSFNESFGLVAMEAQA 311

Query: 290 CEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVL----ETTVVMKKRMREYII 345
              P++A+ VG     +        +   +       +  L    ET + M +   E+  
Sbjct: 312 SGTPVIAARVGGLPIAVAEGETGLLVDGHSPHAWADALATLLDDDETRIRMGEDAVEH-A 370

Query: 346 NNFSIEAILEKHEKLYHE 363
             FS  A   +   LY++
Sbjct: 371 RTFSWAATAAQLSSLYND 388


>2bisA [x.x.x] GLGA GLYCOGEN SYNTHASE
          Length = 440

 Score = 99.8 bits (247), Expect = 1e-23
 Identities = 44/307 (14%), Positives = 86/307 (28%), Gaps = 25/307 (8%)

Query: 82  PDVIHAWMYHANVISILCKPFYRK-----------TKYINSIRMGLENYDGHKNLTKFMI 130
           PDV+H   +H      L K +++            +K            +          
Sbjct: 124 PDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPE 183

Query: 131 KLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNND- 189
                 +                          ++ NG D   +  S+L   +       
Sbjct: 184 HTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSL 243

Query: 190 -----LDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSY- 243
                +D+ V  + I   +   K +   L+   +L                   ++  + 
Sbjct: 244 LSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWA 303

Query: 244 ----LDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNV 299
                 + +      +       E    +D  +  S  E F  +  EAM      +AS V
Sbjct: 304 RSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAV 363

Query: 300 GDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRM---REYIINNFSIEAILEK 356
           G  +DI+     +   +    E+   I+K LE +     +     +    +FS E   E+
Sbjct: 364 GGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAER 423

Query: 357 HEKLYHE 363
           + K Y  
Sbjct: 424 YVKAYTG 430


>3dzcA [x.x.x] UDP-N-ACETYLGLUCOSAMINE 2-EPIMERASE
          Length = 373

 Score = 96.0 bits (237), Expect = 2e-22
 Identities = 29/377 (7%), Positives = 88/377 (23%), Gaps = 28/377 (7%)

Query: 7   LIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXXXXXXX 66
           ++I          +  L + + +    +  + + G+             +          
Sbjct: 5   VLIVFGTRPEAIKMAPLVQQLCQDNRFVAKVCVTGQHREMLDQVLELFSITPDFDLNIME 64

Query: 67  XXXXXXY---------IKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLE 117
                            +++   +PDV+      A   +     +Y++    +       
Sbjct: 65  PGQTLNGVTSKILLGMQQVLSSEQPDVVLVHGDTATTFAASLAAYYQQIPVGHVEAGLRT 124

Query: 118 NYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQ--CFIANGFDKDVFK 175
                    +   KL    +  +      +  S  +     +  +      N     +  
Sbjct: 125 GNIYSPWPEEGNRKL---TAALTQYHFAPTDTSRANLLQENYNAENIFVTGNTVIDALLA 181

Query: 176 PSFLKYEKFRLNND---------LDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSL 226
                +    L                + ++    R        R  Q      + +P  
Sbjct: 182 VREKIHTDMDLQATLESQFPMLDASKKLILVTGHRRESFGGGFERICQALITTAEQHPEC 241

Query: 227 RFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAE 286
           + L         ++   ++         V              +  +   +     I  E
Sbjct: 242 QILYPVHL--NPNVREPVNKLLKGVSNIVLIEPQQYLPFV-YLMDRAHIILTDSGGIQEE 298

Query: 287 AMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIIN 346
           A     P++       +      G V  +    ++I + +  +L       + M +   N
Sbjct: 299 APSLGKPVLVMRETTERPEAVAAGTVKLVGTNQQQICDALSLLLTDP-QAYQAMSQ-AHN 356

Query: 347 NFSIEAILEKHEKLYHE 363
            +      ++   +  +
Sbjct: 357 PYGDGKACQRIADILAK 373


>2acvA [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
           MEMB(X) 68 / COIL(x) 0]
          Length = 461

 Score = 92.3 bits (228), Expect = 2e-21
 Identities = 42/309 (13%), Positives = 78/309 (25%), Gaps = 37/309 (11%)

Query: 85  IHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSK------ 138
                   +                    +  +             KL  +F        
Sbjct: 156 RQIEEVFDDSDRDHQLLNIPGISNQVPSNVLPDACFNKDGGYIAYYKLAERFRDTKGIIV 215

Query: 139 --FSDLTLNNS---KKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDN 193
             FSDL  ++        E    I          G        +        L+   D +
Sbjct: 216 NTFSDLEQSSIDALYDHDEKIPPIYAVGPLLDLKGQPNPKLDQAQHDLILKWLDEQPDKS 275

Query: 194 VKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKF 253
           V +             S+  +IA  L  S    RFL +     K+    +L+      K 
Sbjct: 276 V-VFLCFGSMGVSFGPSQIREIALGLKHSGV--RFLWSNSAEKKVFPEGFLEWMELEGKG 332

Query: 254 FVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGY---- 309
            +       E L      +         N + E+M   VPI+   +   + +        
Sbjct: 333 MICGWAPQVEVLA--HKAIGGFVSHCGWNSILESMWFGVPILTWPIYAEQQLNAFRLVKE 390

Query: 310 -----------------GEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSIEA 352
                                E+ +G K++++K   V +    MK+  R  +++  S   
Sbjct: 391 WGVGLGLRVDYRKGSDVVAAEEIEKGLKDLMDKDSIVHKKVQEMKEMSRNAVVDGGSSLI 450

Query: 353 ILEKHEKLY 361
            + K     
Sbjct: 451 SVGKLIDDI 459


>3d1jA [x.x.x] GLYCOGEN SYNTHASE
          Length = 475

 Score = 88.1 bits (216), Expect = 4e-20
 Identities = 33/306 (10%), Positives = 77/306 (25%), Gaps = 16/306 (5%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKN--LTKFMI 130
           +              +  H    +           Y + I      Y          + +
Sbjct: 169 FYAHHMNDIQLPWSFFNIHGLEFNGQISFLKAGLYYADHITAVSPTYAREITEPQFAYGM 228

Query: 131 KLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDL 190
           +   +                E   +             D    K    +  +  +   +
Sbjct: 229 EGLLQQRHREGRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKV 288

Query: 191 DDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNV 250
           DD V +  +++R  + K +   L+    LL+    L  L AG    +    +        
Sbjct: 289 DDKVPLFAVVSRLTSQKGLDLVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQ 348

Query: 251 NKFFVFESV-DSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-NG 308
               +      S   +   D+ L  S+ E         +      +    G   D + + 
Sbjct: 349 VGVQIGYHEAFSHRIMGGADVILVPSRFEPCGLTQLYGLKYGTLPLVRRTGGLADTVSDS 408

Query: 309 YGEVFELSQGN------------KEIIEKIMKVLETTVVMKKRMREYIINNFSIEAILEK 356
             E       +               I +   +     + +   R+ +  +FS +   + 
Sbjct: 409 SLENLADGVASGFVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKS 468

Query: 357 HEKLYH 362
           + +LY+
Sbjct: 469 YRELYY 474


>2c4mA [x.x.x] GLYCOGEN PHOSPHORYLASE
          Length = 788

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 37/324 (11%), Positives = 72/324 (22%), Gaps = 38/324 (11%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
                       +H  +  A  ++     +  K     +                     
Sbjct: 395 CYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGV-----TPRRWLRMINPGLS 449

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
           +                 L+  ++              K   K  F ++   R   ++D 
Sbjct: 450 DLLTRLSGSDDWVTDLDELKKLRSYADDKSVLEELRAIKAANKQDFAEWILERQGIEIDP 509

Query: 193 NVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGRECSKIDIGSYL 244
                  I R H  K              +I    L   P+   +   +          +
Sbjct: 510 ESIFDVQIKRLHEYKRQLMNALYVLDLYFRIKEDGLTDIPARTVIFGAKAAPGYVRAKAI 569

Query: 245 DNKSNV--------------NKFFVFESVDSSEYLPVLDL-----YLSTSKVEGFPNILA 285
               N                K    E+ + S    +L        +ST+  E       
Sbjct: 570 IKLINSIADLVNNDPEVSPLLKVVFVENYNVSPAEHILPASDVSEQISTAGKEASGTSNM 629

Query: 286 EAMLCEVPIVASNVGDCKDIL------NGYGEVFELSQGNKEIIEKIMKVLETTVVMKKR 339
           + M+     + +  G   +I+      N Y     + +            L  TV   KR
Sbjct: 630 KFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYKPYELYETVPGLKR 689

Query: 340 MREYIINNFSIEAILEKHEKLYHE 363
             + + N    +        L H 
Sbjct: 690 ALDALDNGTLNDNNSGLFYDLKHS 713


>3e3lA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 809

 Score = 84.6 bits (208), Expect = 4e-19
 Identities = 34/397 (8%), Positives = 84/397 (21%), Gaps = 38/397 (9%)

Query: 2   KRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXX 61
           K   +    +     E     L +++      I                   V       
Sbjct: 343 KTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMS 402

Query: 62  XXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDG 121
                         +       V      H+ ++       +      +  +        
Sbjct: 403 LVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY-ELEPHKFQNKTNGITP 461

Query: 122 HKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKY 181
            + L      L    ++       +    L    +              K   K  F  Y
Sbjct: 462 RRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAY 521

Query: 182 EKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGR 233
            +      ++ N      + R H  K              +I     K       +I G+
Sbjct: 522 LEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGK 581

Query: 234 ECSKIDIGSY-------------LDNKSNVNKFFVF-ESVDSSEYLPVLD-----LYLST 274
                 +                 D         +F E+   S    V+        +ST
Sbjct: 582 AAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQIST 641

Query: 275 SKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-----NGYGEVFELSQGNKEIIEKIMKV 329
           +  E         +   + I   +  + +        N +         + + +++    
Sbjct: 642 AGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMR--VEDVDRLDQRGYN 699

Query: 330 LETTVVMKKRMRE---YIINNFSIEAILEKHEKLYHE 363
            +        +R+    + + F      +  + + + 
Sbjct: 700 AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 736


>2atiA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 791

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 32/325 (9%), Positives = 79/325 (24%), Gaps = 34/325 (10%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
            +  +  +    ++      + I              +  +         + L      L
Sbjct: 400 NMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGL 459

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
               ++            L    +    +         K   K  F ++ +      ++ 
Sbjct: 460 AELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP 519

Query: 193 NVKIIGIIARNHADKNISRFLQIANLLL--------KSNPSLRFLIAG------------ 232
           +      + R H  K           +         K       +I G            
Sbjct: 520 SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMI 579

Query: 233 --RECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLD-----LYLSTSKVEGFPNILA 285
                S  D+ +      +  K    E+   S    V+        +ST+  E       
Sbjct: 580 IKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNM 639

Query: 286 EAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGN-KEIIEKIMKVLETTVVMK--K 338
           + ML     + +  G   ++          +F +   +   + +K  +  E    +   K
Sbjct: 640 KFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELK 699

Query: 339 RMREYIINNFSIEAILEKHEKLYHE 363
            + + I N F      +  + + + 
Sbjct: 700 LVIDQIDNGFFSPKQPDLFKDIINM 724


>2c4mC [x.x.x] GLYCOGEN PHOSPHORYLASE
          Length = 790

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 36/327 (11%), Positives = 71/327 (21%), Gaps = 36/327 (11%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
            + +               A    I+          +   +   +           MI  
Sbjct: 387 TVHMAWIACYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINP 446

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQN---IGFKNQCFIANGFDKDVFKPSFLKYEKFRLNND 189
                       ++    L++ +                  K   K  F ++   R   +
Sbjct: 447 GLSDLLTRLSGSDDWVTDLDELKKLRSYADDKSVLEELRAIKAANKQDFAEWILERQGIE 506

Query: 190 LDDNVKIIGIIARNHADKNISRFLQIANLLL--------KSNPSLRFLIAGRECSKI--- 238
           +D        I R H  K           L            P+   +   +        
Sbjct: 507 IDPESIFDVQIKRLHEYKRQLMNALYVLDLYFRIKEDGLTDIPARTVIFGAKAAPGYVRA 566

Query: 239 -----DIGSYLDNKSNVNKFFVFESVDSSEYLPVLDL-----------YLSTSKVEGFPN 282
                 I S  D  +N  +      V   E   V               +ST+  E    
Sbjct: 567 KAIIKLINSIADLVNNDPEVSPLLKVVFVENYNVSPAEHILPASDVSEQISTAGKEASGT 626

Query: 283 ILAEAMLCEVPIVASNVGDCKDIL---NGYGEVFELSQGNKEIIEKIMKVL---ETTVVM 336
              + M+     + +  G   +I+            ++  +    +          TV  
Sbjct: 627 SNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYKPYELYETVPG 686

Query: 337 KKRMREYIINNFSIEAILEKHEKLYHE 363
            KR  + + N    +        L H 
Sbjct: 687 LKRALDALDNGTLNDNNSGLFYDLKHS 713


>3e3nE [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 802

 Score = 81.6 bits (200), Expect = 3e-18
 Identities = 28/337 (8%), Positives = 77/337 (22%), Gaps = 46/337 (13%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCK--PFYRKTKYINSIRMGLENYDGHKNLTKFMI 130
            + ++       I+           +      + +       +   E            I
Sbjct: 393 RMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGI 452

Query: 131 KLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVF-----------KPSFL 179
                    +        + + +           + +  D + F           K  F 
Sbjct: 453 TPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFA 512

Query: 180 KYEKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIA 231
            Y +      ++ N      + R H  K              +I     K       +I 
Sbjct: 513 AYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIG 572

Query: 232 GRECSKIDIGSYL--------DNKSNVNKFFVFESVDSSEYLPVLDL-----------YL 272
           G+      +   +        D  ++         V   E   V               +
Sbjct: 573 GKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQI 632

Query: 273 STSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE---VFELSQGNKEIIEKIMKV 329
           ST+  E         +   + I   +  + +       E   +F +   + + +++    
Sbjct: 633 STAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYN 692

Query: 330 LETTVVMKKRMRE---YIINNFSIEAILEKHEKLYHE 363
            +        +R+    + + F      +  + + + 
Sbjct: 693 AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 729


>3copA [x.x.x] GLYCOGEN SYNTHASE
          Length = 476

 Score = 81.0 bits (198), Expect = 5e-18
 Identities = 30/300 (10%), Positives = 75/300 (25%), Gaps = 16/300 (5%)

Query: 78  RRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFS 137
           +          +     IS L            +        +  +    + ++   +  
Sbjct: 178 QLPWSFFNIHGLEFNGQISFL--KAGLYYADHITAVSPTYAREITEPQFAYGMEGLLQQR 235

Query: 138 KFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKII 197
                         E   +             D    K    +  +  +   +DD V + 
Sbjct: 236 HREGRLSGVLNGVDEKIWSPETDLLLASRYTRDTLEDKAENKRQLQIAMGLKVDDKVPLF 295

Query: 198 GIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFE 257
            +++R  + K +   L+    LL+    L  L AG    +    +            +  
Sbjct: 296 AVVSRLTSQKGLDLVLEALPGLLEQGGQLALLGAGDPVLQEGFLAAAAEYPGQVGVQIGY 355

Query: 258 SVDSS-EYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELS 316
               S   +   D+ L  S+           +      +    G   D ++         
Sbjct: 356 HEAFSHRIMGGADVILVPSRFAPCGLTQLYGLKYGTLPLVRRTGGLADTVSDCSLENLAD 415

Query: 317 QGN----------KEIIEKIMKVL---ETTVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
                          ++  I +         + +   R+ +  +FS +   + + +LY+ 
Sbjct: 416 GVASGFVFEDSNAWSLLRAIRRAFVLWSRPSLWRFVQRQAMAMDFSWQVAAKSYRELYYR 475


>3e3oD [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 805

 Score = 80.8 bits (198), Expect = 6e-18
 Identities = 28/418 (6%), Positives = 83/418 (19%), Gaps = 62/418 (14%)

Query: 1   MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXX 60
           +     L  +               ++         + L+        L    +++    
Sbjct: 322 LVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLET------LLPRHLQIIYEI 375

Query: 61  XXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSI-------- 112
                          + R  +  ++         ++ LC         +  I        
Sbjct: 376 NQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKT 435

Query: 113 --RMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFD 170
             +   E            I         +        + + +           + +  D
Sbjct: 436 IFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVD 495

Query: 171 KDVFKPSF-----------LKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLL 219
            + F                 Y +      ++ N      + R H  K           L
Sbjct: 496 DEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITL 555

Query: 220 LKSNPSLRFLIAGRECSKIDIGSY----------------------LDNKSNVNKFFVFE 257
                           + +  G                         D         +F 
Sbjct: 556 YNRIKK-EPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFL 614

Query: 258 SVDSSEYLPVL------DLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE 311
                     +         +ST+  E         +   + I   +  + +       E
Sbjct: 615 ENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEE 674

Query: 312 ---VFELSQGNKEIIEKIMKVLETTVVMKKRMRE---YIINNFSIEAILEKHEKLYHE 363
              +F +   + + +++     +        +R+    + + F      +  + + + 
Sbjct: 675 NFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 732


>1c3jA [c.87.1] BETA-GLUCOSYLTRANSFERASE
          Length = 333

 Score = 79.4 bits (194), Expect = 1e-17
 Identities = 27/341 (7%), Positives = 65/341 (19%), Gaps = 35/341 (10%)

Query: 46  ANKLEAYGVKVYTXXXXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRK 105
              +   G  V                  K+I  +  +V    + +        +     
Sbjct: 2   KIAIINMGNNVI---NFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDE-VDVN 57

Query: 106 TKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFI 165
                 +          +                  L  + S     + + +       I
Sbjct: 58  DYDRLIVVNSNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSAYLYTEEELLIKSPIKVI 117

Query: 166 ANGFDKDVFKPSFLKYEKFRLNND-----------------LDDNVKIIGIIARNHADKN 208
           + G + D+ K +  K +                               +       + + 
Sbjct: 118 SQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQR 177

Query: 209 ISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVL 268
            S+ ++        +  L     G    K                        SE     
Sbjct: 178 ESKMVEFLF-----DTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQA 232

Query: 269 DLYL----STSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-NGYGEVFELSQGNKEII 323
              L               + E M  +  ++     D K  + N             + +
Sbjct: 233 IAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRV 292

Query: 324 EKIMKVLETTVVMKKRMREYIIN----NFSIEAILEKHEKL 360
            ++         M     + +          +   +K   L
Sbjct: 293 NELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL 333


>3cuyA [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
          Length = 364

 Score = 79.4 bits (194), Expect = 1e-17
 Identities = 37/361 (10%), Positives = 87/361 (24%), Gaps = 39/361 (10%)

Query: 12  NQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKV-----YTXXXXXXXX 66
            +G       +    +       TV+S  G   +  +   +                   
Sbjct: 29  LRGTTRFFSLRGDMRLPLDDTANTVVSHNGVDCYLWRTTVHPFNTRRSWLRPVEDAMFRW 88

Query: 67  XXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLT 126
                    +    + DVI      A     L K      K +              N+ 
Sbjct: 89  YAAHPPKQLLDWMRESDVIVFESGIAVAFIELAKRVNPAAKLVYRAS----AGLSTINVA 144

Query: 127 KFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRL 186
            ++ +   + +   D+    S     +  +    N   + +G D ++ +           
Sbjct: 145 SYIEREFDRVAPTLDVIALVSPAMAAEVVS--RDNVFHVGHGVDHNLDQ----------- 191

Query: 187 NNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDN 246
                 +           A  ++    +   +  K+ P + F + G    +     +   
Sbjct: 192 ----LGDPSPYAEGIHAVAVGSMLFDPEFFVVASKAFPQVTFHVIGSGMGR-----HPGY 242

Query: 247 KSNVNKFFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKD-- 304
             NV  +   +   +  Y+      ++    E  P  LA++ +  +      +       
Sbjct: 243 GDNVIVYGEMKHAQTIGYIKHARFGIAPYASEQVPVYLADSSMKLLQYDFFGLPAVCPNA 302

Query: 305 -ILNGYGEVFELSQGNKEIIEKIMKVL---ETTVVMKKRMREYIINNFSIEAILEKHEKL 360
            +                +I  I + L              +         A  E   +L
Sbjct: 303 VVGPYKSRFGYTPGNADSVIAAITQALEAPRVRYRQCLNWSDTTDRVLDPRAYPE--TRL 360

Query: 361 Y 361
           Y
Sbjct: 361 Y 361


>3e3oA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 809

 Score = 78.9 bits (193), Expect = 2e-17
 Identities = 35/411 (8%), Positives = 100/411 (24%), Gaps = 48/411 (11%)

Query: 1   MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXX 60
           +     L  +               ++         + L+   +  +    Y +      
Sbjct: 326 LVDLERLDWDKAWEVTVKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLN 385

Query: 61  XXXXXXXXXXXX-----YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTK------YI 109
                             ++     + ++ H  +  ++ ++ + +      K      + 
Sbjct: 386 RVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY 445

Query: 110 NSIRMGLENYDGHKNLTKFMIKLNAKFSKFSD---LTLNNSKKSLEDHQNIGFKNQCFIA 166
                  +N        ++++  N   ++           S             ++ FI 
Sbjct: 446 ELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR 505

Query: 167 NGFDKDVF-KPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIAN 217
           +        K  F  Y +      ++ N      + R H  K              +I  
Sbjct: 506 DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK 565

Query: 218 LLLKSNPSLRFLIAGRECSK--------IDIGSYLDNKSNVNKFFVFESVDSSEYLPVLD 269
              K       +I G+              I +  D  ++         V   E   V  
Sbjct: 566 EPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSL 625

Query: 270 L-----------YLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE---VFEL 315
                        +ST+  E         +   + I   +  + +       E   +F +
Sbjct: 626 AEKVIPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGM 685

Query: 316 SQGN-KEIIEKIMKVLETTVVMK--KRMREYIINNFSIEAILEKHEKLYHE 363
              +   + ++     E    +   +++ E + + F      +  + + + 
Sbjct: 686 RVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 736


>2bgtA [x.x.x] BETA-GLUCOSYLTRANSFERASE
          Length = 329

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 22/295 (7%), Positives = 58/295 (19%), Gaps = 24/295 (8%)

Query: 74  IKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLN 133
              +      ++     +  ++S        K   I  +   +      +        + 
Sbjct: 53  EVDVNDYDRLIVVNSKPNLAILSAQKFMAKYK-SKIYYLFTDIRLPFSQEEELLIKSPIK 111

Query: 134 AKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDN 193
                 +           +    I F+           + F+ S                
Sbjct: 112 VISQGINLDIAK--AAHKKVDNVIEFEYFPIEQYKIHMNDFQLS-----------KPTKK 158

Query: 194 VKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKF 253
              +       + +  S+ ++           L     G    K                
Sbjct: 159 TLDVIYGGSFRSGQRESKMVEFLFDT-----GLNIEFFGNAREKQFKNPKYPWTKAPVFT 213

Query: 254 FVFESVDSSEYLPVLDLYLS----TSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-NG 308
                   SE        L               + E M  +  ++     D K  + N 
Sbjct: 214 GKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIIND 273

Query: 309 YGEVFELSQGNKEIIEKIMKVLETTVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
                       + + ++         M     + +    + +A  +   K   +
Sbjct: 274 ARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAID 328


>1b4dA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
          Length = 804

 Score = 77.7 bits (190), Expect = 5e-17
 Identities = 38/397 (9%), Positives = 90/397 (22%), Gaps = 35/397 (8%)

Query: 1   MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXX 60
           +K   +    +     E     L +++      I                   V      
Sbjct: 338 VKTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRM 397

Query: 61  XXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYD 120
                          +       V      H+ ++       +      +  +       
Sbjct: 398 SLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY-ELEPHKFQNKTNGIT 456

Query: 121 GHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLK 180
             + L      L    ++       +    L    +              K   K  F  
Sbjct: 457 PRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAA 516

Query: 181 YEKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAG 232
           Y +      ++ N      + R H  K              +I     K       +I G
Sbjct: 517 YLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGG 576

Query: 233 RECSKIDIGSYL--------DNKSNVNKFFVFESVDSSEYLPVLDL-----------YLS 273
           +      +   +        D  ++         V   E   V               +S
Sbjct: 577 KAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQIS 636

Query: 274 TSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE----VFELSQGN-KEIIEKIMK 328
           T+  E       + ML     + +  G   ++    GE    +F +   +   + ++   
Sbjct: 637 TAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYN 696

Query: 329 VLETTVVMKK--RMREYIINNFSIEAILEKHEKLYHE 363
             E    + +  ++ E + + F      +  + + + 
Sbjct: 697 AQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 733


>1e1yA [c.87.1] GLYCOGEN PHOSPHORYLASE
          Length = 813

 Score = 77.7 bits (190), Expect = 5e-17
 Identities = 31/328 (9%), Positives = 76/328 (23%), Gaps = 42/328 (12%)

Query: 78  RRIKPDVIHAWMYHANVISILCKPFYRKTKYINSI----RMGLENYDGHKNLTKFMIKLN 133
           +RI    +     HA            K               +N        ++++  N
Sbjct: 412 KRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCN 471

Query: 134 AKFSKFSDLTLNNSKKSLEDHQNIGFK--NQCFIANGFDKDVFKPSFLKYEKFR--LNND 189
              ++     +     S  D         +         K   +                
Sbjct: 472 PGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVH 531

Query: 190 LDDNVKIIGIIARNHADKNISRFLQIA--------NLLLKSNPSLRFLIAGRECSKIDIG 241
           ++ N      + R H  K                     K       +I G+      + 
Sbjct: 532 INPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMA 591

Query: 242 SYL--------DNKSNVNKFFVFESVDSSEYLPVLDL-----------YLSTSKVEGFPN 282
             +        D  ++         V   E   V               +ST+  E    
Sbjct: 592 KMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGT 651

Query: 283 ILAEAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGNKE-IIEKIMKVLETT--VV 335
              + ML     + +  G   ++          +F +   + + + ++     E    + 
Sbjct: 652 GNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIP 711

Query: 336 MKKRMREYIINNFSIEAILEKHEKLYHE 363
             +++ E + + F      +  + + + 
Sbjct: 712 ELRQIIEQLSSGFFSPKQPDLFKDIVNM 739


>3cv3A [x.x.x] GLUCURONOSYLTRANSFERASE GUMK
          Length = 369

 Score = 76.9 bits (188), Expect = 8e-17
 Identities = 36/292 (12%), Positives = 77/292 (26%), Gaps = 34/292 (11%)

Query: 76  IIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAK 135
           +    + DVI      A     L K      K +              N+  ++ +   +
Sbjct: 106 LDWMRESDVIVFESGIAVAFIELAKRVNPAAKLVYRAS----AGLSTINVASYIEREFDR 161

Query: 136 FSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVK 195
            +   D+    S     +  +    N   + +G D ++ +             D     +
Sbjct: 162 VAPTLDVIALVSPAMAAEVVS--RDNVFHVGHGVDHNLDQL-----------GDPSPYAE 208

Query: 196 IIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFV 255
            I  +A      +   F+       K+ P + F + G    +     +     NV  +  
Sbjct: 209 GIHAVAVGSMLFDPEFFVV----ASKAFPQVTFHVIGSGMGR-----HPGYGDNVIVYGE 259

Query: 256 FESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASN---VGDCKDILNGYGEV 312
            +   +  Y+      ++    E  P  LA++ +  +         V     +       
Sbjct: 260 MKHAQTIGYIKHARFGIAPYASEQVPVYLADSSMKLLQYDFFGLPAVCPNAVVGPYKSRF 319

Query: 313 FELSQGNKEIIEKIMKVL---ETTVVMKKRMREYIINNFSIEAILEKHEKLY 361
                    +I  I + L              +         A  E   +LY
Sbjct: 320 GYTPGNADSVIAAITQALEAPRVRYRQCLNWSDTTDRVLDPRAYPE--TRLY 369


>2bfwA [x.x.x] GLGA GLYCOGEN SYNTHASE
          Length = 196

 Score = 75.7 bits (185), Expect = 2e-16
 Identities = 36/186 (19%), Positives = 69/186 (37%), Gaps = 11/186 (5%)

Query: 168 GFDKDVFKPSFLKYEK------FRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLK 221
           G D   +  S+L   +            +D+ V  + I   +   K +   L+   +L  
Sbjct: 1   GIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSS 60

Query: 222 SNPS--LRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVL---DLYLSTSK 276
                 +RF+I G+   +++  +    + + N   + E +       +    D  +  S 
Sbjct: 61  KKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSY 120

Query: 277 VEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVM 336
            E F  +  EAM      +AS VG  +DI+     +   +    E+   I+K LE +   
Sbjct: 121 FEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSD 180

Query: 337 KKRMRE 342
             + RE
Sbjct: 181 LSKFRE 186


>3e3oB [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 811

 Score = 75.1 bits (183), Expect = 3e-16
 Identities = 36/395 (9%), Positives = 86/395 (21%), Gaps = 34/395 (8%)

Query: 2   KRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXX 61
           K   +    +     E     L +++      I                   V       
Sbjct: 345 KTCAYTNHTVIPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMS 404

Query: 62  XXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDG 121
                         +       V      H+ ++       +      +  +        
Sbjct: 405 LVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY-ELEPHKFQNKTNGITP 463

Query: 122 HKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKY 181
            + L      L    ++       +    L    +              K   K  F  Y
Sbjct: 464 RRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAY 523

Query: 182 EKFRLNNDLDDNVKIIGIIARNHADKNISRFLQ--------IANLLLKSNPSLRFLIAG- 232
            +      ++ N      + R H  K               I     K       +I G 
Sbjct: 524 LEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGK 583

Query: 233 -------RECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDL-----------YLST 274
                   +     I +  D  ++         V   E   V               +ST
Sbjct: 584 AAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQIST 643

Query: 275 SKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE---VFELSQGNKE-IIEKIMKVL 330
           +  E         +   + I   +  + +       E   +F +   + + + ++     
Sbjct: 644 AGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQ 703

Query: 331 E--TTVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
           E    +   +++ E + + F      +  + + + 
Sbjct: 704 EYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 738


>3e3lB [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 810

 Score = 74.6 bits (182), Expect = 4e-16
 Identities = 32/398 (8%), Positives = 90/398 (22%), Gaps = 48/398 (12%)

Query: 14  GGAETMLYKLCKSMDKSIYHITVISLMGRGV--FANKLEAYGVKVYTXXXXXXXXXXXXX 71
                       ++         + L+   +      +     +                
Sbjct: 338 EVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRL 397

Query: 72  XYIKIIRRIKPDVIHA---WMYHANVISILCKPFYRKTK----------YINSIRMGLEN 118
             + ++       I+     +  ++ ++ + +      K            +  +     
Sbjct: 398 RRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNG 457

Query: 119 YDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSF 178
               + L      L    ++       +    L    +              K   K  F
Sbjct: 458 ITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKF 517

Query: 179 LKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLI 230
             Y +      ++ N      + R H  K              +I     K       +I
Sbjct: 518 AAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMI 577

Query: 231 AGRECSK--------IDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDL-----------Y 271
            G+              I +  D  ++         V   E   V               
Sbjct: 578 GGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQ 637

Query: 272 LSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE---VFELSQGN-KEIIEKIM 327
           +ST+  E         +   + I   +  + +       E   +F +   +   + ++  
Sbjct: 638 ISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGY 697

Query: 328 KVLETTVVMK--KRMREYIINNFSIEAILEKHEKLYHE 363
              E    +   +++ E + + F      +  + + + 
Sbjct: 698 NAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 735


>3e3oC [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 807

 Score = 74.3 bits (181), Expect = 5e-16
 Identities = 24/336 (7%), Positives = 73/336 (21%), Gaps = 48/336 (14%)

Query: 75  KIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINS--IRMGLENYDGHKNLTKFMIKL 132
            ++       I+           +       ++ +     +   E            I  
Sbjct: 400 SLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITP 459

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLK-----------Y 181
                  +        + + +           + +  D + F     K           Y
Sbjct: 460 RRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAY 519

Query: 182 EKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGR 233
            +      ++ N      + R H  K              +I     K       +I G+
Sbjct: 520 LEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGK 579

Query: 234 ECSKIDIGSYLDN--------KSNVNKFFVFESVDSSEYLPVLDL-----------YLST 274
                 +   +           ++         V   E   V               +ST
Sbjct: 580 AAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQIST 639

Query: 275 SKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-----NGYGEVFEL--SQGNKEIIEKIM 327
           +  E         +   + I   +  + +        N +     +       +      
Sbjct: 640 AGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQ 699

Query: 328 KVLETTVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
           +  +    +++ + + + + F      +  + + + 
Sbjct: 700 EYYDRIPELRQIIEQ-LSSGFFSPKQPDLFKDIVNM 734


>1e4oA [c.87.1] MALTODEXTRIN PHOSPHORYLASE
          Length = 796

 Score = 74.3 bits (181), Expect = 5e-16
 Identities = 33/324 (10%), Positives = 73/324 (22%), Gaps = 62/324 (19%)

Query: 85  IHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTL 144
           +H+ +   ++     + +  K   +                    I       + +    
Sbjct: 423 LHSDLVVKDLFPEYHQLWPNKFHNV-----------------TNGITPRRWIKQCNPALA 465

Query: 145 NNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLK-----------YEKFRLNNDLDDN 193
               KSL+            +    D   F+  + +           + K R   +++  
Sbjct: 466 ALLDKSLQKEWANDLDQLINLEKFADDAKFRDQYREIKQANKVRLAEFVKVRTGIEINPQ 525

Query: 194 VKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGRECSKIDIGSYLD 245
                 I R H  K     L        +I            FL   +      +   + 
Sbjct: 526 AIFDIQIKRLHEYKRQHLNLLHILALYKEIRENPQADRVPRVFLFGAKAAPGYYLAKNII 585

Query: 246 NKSNV--------------NKFFVFESVDSSEYLPVLDL-----YLSTSKVEGFPNILAE 286
              N                K         S    ++        +ST+  E       +
Sbjct: 586 FAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEKLIPAADISEQISTAGKEASGTGNMK 645

Query: 287 AMLCEVPIVASNVGDCKDILNGYGEV--FELSQGN-KEIIEKIMKVLETTVVMKKRMRE- 342
             L     V +  G   +I    GE   F       +                K ++ + 
Sbjct: 646 LALNGALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKAILAKGYDPVKWRKKDKVLDA 705

Query: 343 ---YIINNFSIEAILEKHEKLYHE 363
               + +    +      +++ H 
Sbjct: 706 VLKELESGKYSDGDKHAFDQMLHS 729


>3e3lC [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 806

 Score = 74.3 bits (181), Expect = 5e-16
 Identities = 30/412 (7%), Positives = 87/412 (21%), Gaps = 50/412 (12%)

Query: 1   MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGV--KVYT 58
           +     L  +               ++         + L+   +  +    Y +  +   
Sbjct: 323 LVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLN 382

Query: 59  XXXXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINS--IRMGL 116
                          + ++       I+           +       ++ +     +   
Sbjct: 383 RVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY 442

Query: 117 ENYDGHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKP 176
           E            I         +        + + +           + +  D + F  
Sbjct: 443 ELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIR 502

Query: 177 SF-----------LKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIAN 217
                          Y +      ++ N      + R H  K              +I  
Sbjct: 503 DVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK 562

Query: 218 LLLKSNPSLRFLIAGRE--------CSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLD 269
              K       +I G+              I +  D  ++         V   E   V  
Sbjct: 563 EPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSL 622

Query: 270 LYL-----------STSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-----NGYGEVF 313
                         ST+  E         +   + I   +  + +        N +    
Sbjct: 623 AEKVIPAADLSEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGM 682

Query: 314 ELSQGNKEIIEKIMKVLETTVVMKK--RMREYIINNFSIEAILEKHEKLYHE 363
              +    + ++     E    + +  ++ E + + F      +  + + + 
Sbjct: 683 R-VEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 733


>3cejA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 790

 Score = 74.0 bits (180), Expect = 7e-16
 Identities = 32/325 (9%), Positives = 79/325 (24%), Gaps = 34/325 (10%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
            +  +  +    ++      + I              +  +         + L      L
Sbjct: 399 NMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGL 458

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
               ++            L    +    +         K   K  F ++ +      ++ 
Sbjct: 459 AELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP 518

Query: 193 NVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIA-------GRECSK 237
           +      + R H  K              +I     K       +I              
Sbjct: 519 SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMI 578

Query: 238 IDIGSY------LDNKSNVNKFFVF-ESVDSSEYLPVLD-----LYLSTSKVEGFPNILA 285
           I + +        D         +F E+   S    V+        +ST+  E       
Sbjct: 579 IKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNM 638

Query: 286 EAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGN-KEIIEKIMKVLET--TVVMKK 338
           + ML     + +  G   ++          +F +   +   + +K  +  E    +   K
Sbjct: 639 KFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELK 698

Query: 339 RMREYIINNFSIEAILEKHEKLYHE 363
            + + I N F      +  + + + 
Sbjct: 699 LVIDQIDNGFFSPKQPDLFKDIINM 723


>3cehA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 794

 Score = 74.0 bits (180), Expect = 7e-16
 Identities = 33/326 (10%), Positives = 77/326 (23%), Gaps = 35/326 (10%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
                  I        +   +   +  K F   ++          N    +         
Sbjct: 402 INMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPG 461

Query: 133 NAKFSKFSDLTLNNSKKSLED-HQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLD 191
            A+              S      +    +         K   K  F ++ +      ++
Sbjct: 462 LAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKIN 521

Query: 192 DNVKIIGIIARNHADKNISRFLQIANLLL--------KSNPSLRFLIAGRECSKIDIGSY 243
            +      + R H  K           +         K       +I G+      +   
Sbjct: 522 PSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKM 581

Query: 244 -------------LDNKSNVNKFFVF----ESVDSSEYLPVLDL--YLSTSKVEGFPNIL 284
                         D         +F        + + +P  DL   +ST+  E      
Sbjct: 582 IIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGN 641

Query: 285 AEAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGNKE-IIEKIMKVLETTVVMK-- 337
            + ML     + +  G   ++          +F +   +   + +K  +  E    +   
Sbjct: 642 MKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPEL 701

Query: 338 KRMREYIINNFSIEAILEKHEKLYHE 363
           K + + I N F      +  + + + 
Sbjct: 702 KLVIDQIDNGFFSPKQPDLFKDIINM 727


>3dd1B [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 805

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 32/327 (9%), Positives = 79/327 (24%), Gaps = 44/327 (13%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
            +          IH+ +    V     +    K +   +           + L      L
Sbjct: 421 IVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITP------RRWLLLCNPGL 474

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKN--QCFIANGFDKDVFKPSFLKYEKFRLNNDL 190
               ++            L    +    +     +A    ++  K S  ++ +      +
Sbjct: 475 AELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFS--QFLETEYKVKI 532

Query: 191 DDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGRECSKIDIGS 242
           + +      + R H  K              +I     K       +I G+      +  
Sbjct: 533 NPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAK 592

Query: 243 Y-------------LDNKSNVNKFFVFESVDSSEYLPVLD------LYLSTSKVEGFPNI 283
                          D         +F           +         +ST+  E     
Sbjct: 593 MIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTG 652

Query: 284 LAEAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGN-KEIIEKIMKVLETTVVMK- 337
             + ML     + +  G   ++          +F +   +   + +K  +  E    +  
Sbjct: 653 NMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPE 712

Query: 338 -KRMREYIINNFSIEAILEKHEKLYHE 363
            K + + I N F      +  + + + 
Sbjct: 713 LKLVIDQIDNGFFSPKQPDLFKDIINM 739


>3e3lD [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 805

 Score = 73.1 bits (178), Expect = 1e-15
 Identities = 32/400 (8%), Positives = 83/400 (20%), Gaps = 52/400 (13%)

Query: 14  GGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXXXXXXXXXXXXXXY 73
                       ++         + L+   +  +    Y +                   
Sbjct: 335 EVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRL 394

Query: 74  -------IKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMG----LENYDGH 122
                     ++RI    +     HA            K               +N    
Sbjct: 395 RRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNG 454

Query: 123 KNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCF--IANGFDKDVF--KPSF 178
               ++++  N   ++     +     S  D                   K     K  F
Sbjct: 455 ITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKF 514

Query: 179 LKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLR--------FLI 230
             Y +      ++ N      + R H  K           L                 +I
Sbjct: 515 AAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMI 574

Query: 231 AGRECSKIDIGSYLDNKSNV--------------NKFFVFESVDSSEYLPVLD-----LY 271
            G+      +   +                     +    E+   S    V+        
Sbjct: 575 GGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQ 634

Query: 272 LSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-----NGYGEVFELSQGNKEIIEKI 326
           +ST+  E         +   + I   +  + +        N +         + + +++ 
Sbjct: 635 ISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMR--VEDVDRLDQR 692

Query: 327 MKVLETTVVMKKRMRE---YIINNFSIEAILEKHEKLYHE 363
               +        +R+    + + F      +  + + + 
Sbjct: 693 GYNAQEYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 732


>3e3nC [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 801

 Score = 72.7 bits (177), Expect = 2e-15
 Identities = 34/329 (10%), Positives = 82/329 (24%), Gaps = 38/329 (11%)

Query: 73  YIKIIRRIKPDVIHAWMYH---ANVISILCKPFYRKTKYINSIRM-GLENYDGHKNLTKF 128
            +K I      +  +   +        IL K  ++    +   +     N    +     
Sbjct: 400 AVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVL 459

Query: 129 MIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIA-NGFDKDVFKPSFLKYEKFRLN 187
                A+           S             ++ FI      K   K  F  Y +    
Sbjct: 460 CNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYK 519

Query: 188 NDLDDNVKIIGIIARNHADKNISRFLQIANL--------LLKSNPSLRFLIAGR------ 233
             ++ N      + R H  K                     K       +I G+      
Sbjct: 520 VHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYH 579

Query: 234 -ECSKIDIGSYLDNKSNV-------NKFFVFESVDSSEYLPVLD-----LYLSTSKVEGF 280
                I + + + +  N         +    E+   S    V+        +ST+  E  
Sbjct: 580 MAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEAS 639

Query: 281 PNILAEAMLCEVPIVASNVGDCKDILNGYGE---VFELSQGNKEIIEKIMKVLETTVVMK 337
                  +   + I   +  + +       E   +F +   + + +++     +      
Sbjct: 640 GTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRI 699

Query: 338 KRMRE---YIINNFSIEAILEKHEKLYHE 363
             +R+    + + F      +  + + + 
Sbjct: 700 PELRQIIEQLSSGFFSPKQPDLFKDIVNM 728


>2acvB [x.x.x] TRITERPENE UDP-GLUCOSYL TRANSFERASE UGT71G1[MASQUE :
           MEMB(X) 68 / COIL(x) 0]
          Length = 456

 Score = 72.7 bits (177), Expect = 2e-15
 Identities = 33/308 (10%), Positives = 70/308 (22%), Gaps = 34/308 (11%)

Query: 85  IHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSK------ 138
                   +                    +  +             KL  +F        
Sbjct: 151 RQIEEVFDDSDRDHQLLNIPGISNQVPSNVLPDACFNKDGGYIAYYKLAERFRDTKGIIV 210

Query: 139 --FSDLTLNNS---KKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDN 193
             FSDL  ++        E    I          G        +        L+   D +
Sbjct: 211 NTFSDLEQSSIDALYDHDEKIPPIYAVGPLLDLKGQPNPKLDQAQHDLILKWLDEQPDKS 270

Query: 194 VKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKF 253
           V +             S+  +IA  L  S     +  +  +    +              
Sbjct: 271 V-VFLCFGSMGVSFGPSQIREIALGLKHSGVRFLWSNSAEKKVFPEGFLEWMELEGKGMI 329

Query: 254 FVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGY---- 309
             +               +         N + E+M   VPI+   +   + +        
Sbjct: 330 CGWAPQVEVLA----HKAIGGFVSHCGWNSILESMWFGVPILTWPIYAEQQLNAFRLVKE 385

Query: 310 GEVFELSQGN----------KEIIEKIMKVLETTVV---MKKRMREYIINN-FSIEAILE 355
             V    + +          +EI + +  +++   +     + M+E   N      + L 
Sbjct: 386 WGVGLGLRVDYRKGSDVVAAEEIEKGLKDLMDKDSIVHKKVQEMKEMSRNAVVDGGSSLI 445

Query: 356 KHEKLYHE 363
              KL  +
Sbjct: 446 SVGKLIDD 453


>3ddsB [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 802

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 34/325 (10%), Positives = 81/325 (24%), Gaps = 37/325 (11%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
           ++ I+     + +           +       +     +   G       + L      L
Sbjct: 415 HLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNG---ITPRRWLLLCNPGL 471

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
               ++            L    +    +         K   K  F ++ +      ++ 
Sbjct: 472 AELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINP 531

Query: 193 NVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGR-----ECSKID 239
           +      + R H  K              +I     K       +I G+       +K+ 
Sbjct: 532 SSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMI 591

Query: 240 IGSYLDNKSNVNKFFVFESVDSSEYLPVLD--------------LYLSTSKVEGFPNILA 285
           I         VN   +  S     +L                    +ST+  E       
Sbjct: 592 IKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNM 651

Query: 286 EAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGNKE-IIEKIMKVLETTVVMK--K 338
           + ML     + +  G   ++          +F +   +   + +K  +  E    +   K
Sbjct: 652 KFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELK 711

Query: 339 RMREYIINNFSIEAILEKHEKLYHE 363
            + + I N F      +  + + + 
Sbjct: 712 LVIDQIDNGFFSPKQPDLFKDIINM 736


>1a8iA [x.x.x] GLYCOGEN PHOSPHORYLASE B
          Length = 812

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 30/342 (8%), Positives = 79/342 (23%), Gaps = 56/342 (16%)

Query: 77  IRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSI-------RMGLENYDGHKNLTKFM 129
            R  +  ++         ++ LC         +  I        +  + Y+   +  +  
Sbjct: 401 DRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNK 460

Query: 130 IKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQC---FIANGFDKDVFKPSFLKYE---- 182
                            ++   E        +      + +  D + F     K +    
Sbjct: 461 TNGITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENK 520

Query: 183 -------KFRLNNDLDDNVKIIGIIARNHADKNISRFLQ--------IANLLLKSNPSLR 227
                  +      ++ N      + R H  K               I     K      
Sbjct: 521 LKFAAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRT 580

Query: 228 FLIAGRECSKIDIGSY-------------LDNKSNVNKFFVF-ESVDSSEYLPVLD---- 269
            +I G+      +                 D         +F E+   S    V+     
Sbjct: 581 VMIGGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADL 640

Query: 270 -LYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-------NGYGEVFELSQGNKE 321
              +ST+  E         +   + I   +  + +            +G   E      +
Sbjct: 641 SEQISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQ 700

Query: 322 IIEKIMKVLETTVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
                 +  +    + +++ E + + F      +  + + + 
Sbjct: 701 RGYNAQEYYDRIPEL-RQIIEQLSSGFFSPKQPDLFKDIVNM 741


>3ddwB [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 800

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 39/397 (9%), Positives = 89/397 (22%), Gaps = 35/397 (8%)

Query: 1   MKRFVHLIINLNQGGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVYTXX 60
            K F +    +     E     L + +      I              L    V      
Sbjct: 339 QKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRM 398

Query: 61  XXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYD 120
                          +       V      H++++       + + +             
Sbjct: 399 SLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITP 458

Query: 121 GHKNLTKFMIKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLK 180
               L      L    ++            L    +    +         K   K  F +
Sbjct: 459 RRW-LLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQ 517

Query: 181 YEKFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAG 232
           + +      ++ +      + R H  K              +I     K       +I G
Sbjct: 518 FLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGG 577

Query: 233 RECSKIDIGSYLDNKSNV--------------NKFFVFESVDSSEYLPVLDL-----YLS 273
           +      +   +                     K    E+   S    V+        +S
Sbjct: 578 KAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQIS 637

Query: 274 TSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGNKE-IIEKIMK 328
           T+  E       + ML     + +  G   ++          +F +   +   + +K  +
Sbjct: 638 TAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYE 697

Query: 329 VLET--TVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
             E    +   K + + I N F      +  + + + 
Sbjct: 698 AKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINM 734


>3cuvA [x.x.x] GLYCOGEN PHOSPHORYLASE, MUSCLE FORM
          Length = 811

 Score = 70.8 bits (172), Expect = 6e-15
 Identities = 29/399 (7%), Positives = 81/399 (20%), Gaps = 50/399 (12%)

Query: 14  GGAETMLYKLCKSMDKSIYHITVISLMGRGVFANKLEAYGVKVY--TXXXXXXXXXXXXX 71
                       ++         + L+   +  +    Y +                   
Sbjct: 343 EVTVKTCAYTNHTVLPEALERWPVHLLETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRL 402

Query: 72  XYIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFM-- 129
             + ++       I+           +       ++ +                      
Sbjct: 403 RRMSLVEEGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNG 462

Query: 130 IKLNAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFK-----------PSF 178
           I         +        + + +           + +  D + F              F
Sbjct: 463 ITPRRWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKF 522

Query: 179 LKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIA--------NLLLKSNPSLRFLI 230
             Y +      ++ N      + R H  K                     K       +I
Sbjct: 523 AAYLEREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMI 582

Query: 231 AG-------------RECSKIDIGSYLDNKSNVNKFFVF-ESVDSSEYLPVLDL-----Y 271
            G             +  + I      D         +F E+   S    V+        
Sbjct: 583 GGKAAPGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQ 642

Query: 272 LSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-------NGYGEVFELSQGNKEIIE 324
           +ST+  E         +   + I   +  + +            +G   E      +   
Sbjct: 643 ISTAGTEASGTGNMFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGY 702

Query: 325 KIMKVLETTVVMKKRMREYIINNFSIEAILEKHEKLYHE 363
              +  +    +++   E + + F      +  + + + 
Sbjct: 703 NAQEYYDRIPELRQI-IEQLSSGFFSPKQPDLFKDIVNM 740


>2bguA [x.x.x] BETA-GLUCOSYLTRANSFERASE
          Length = 328

 Score = 69.8 bits (169), Expect = 1e-14
 Identities = 22/333 (6%), Positives = 59/333 (17%), Gaps = 24/333 (7%)

Query: 46  ANKLEAYGVKVYTXXXXXXXXXXXXXXYIKIIRRIKPDVIHAWMYHANVISILCKPFYRK 105
              +   G  V                 I     +  D+I                    
Sbjct: 2   KIAIINMGNNVINFKTVPSSETIYLFKVISE-MGLNVDIISLKNGVYTKSFDEVDVNDYD 60

Query: 106 TKYINSIRMGLENYDGHKNLTKFMIKLNAKFSK---------FSDLTLNNSKKSLEDHQN 156
              + +  + + +        K  I       +             +         +   
Sbjct: 61  RLIVVNSNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSEEELLIKSPIKVISQGINLDI 120

Query: 157 IGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIA 216
               ++        +      +  +      +        +       + +  S+ ++  
Sbjct: 121 AKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFL 180

Query: 217 NLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYL---- 272
                 +  L     G    K                        SE        L    
Sbjct: 181 F-----DTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGD 235

Query: 273 STSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-NGYGEVFELSQGNKEIIEKIMKVLE 331
                      + E M  +  ++     D K  + N             + + ++     
Sbjct: 236 KNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDV 295

Query: 332 TTVVMKKRMREYIIN----NFSIEAILEKHEKL 360
               M     + +          +   +K   L
Sbjct: 296 LRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL 328


>1c8lA [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE)
          Length = 811

 Score = 65.5 bits (158), Expect = 2e-13
 Identities = 29/326 (8%), Positives = 75/326 (23%), Gaps = 39/326 (11%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
           ++ I      + +          +I    +  +     +   G+      + L      L
Sbjct: 419 HLCIAGSHAVNGVARIHSEILKKTIFKDFYELEPHKFQNKTNGI---TPRRWLVLCNPGL 475

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
               ++       +    L    +              K   K  F  Y +      ++ 
Sbjct: 476 AEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINP 535

Query: 193 NVKIIGIIARNHADKNISRFLQ--------IANLLLKSNPSLRFLIAG------------ 232
           N      + R H  K               I     K       +I G            
Sbjct: 536 NSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKAAPGYHMAKMI 595

Query: 233 -RECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLD------LYLSTSKVEGFPNILA 285
            +  + I      D         +F           +         +ST+  E       
Sbjct: 596 IKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNM 655

Query: 286 EAMLCEVPIVASNVGDCKDIL------NGYGEVFEL--SQGNKEIIEKIMKVLETTVVMK 337
           + ML     + +  G   ++       N +     +       +      +  +    ++
Sbjct: 656 KFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQEYYDRIPELR 715

Query: 338 KRMREYIINNFSIEAILEKHEKLYHE 363
           + + + + + F      +  + + + 
Sbjct: 716 QIIEQ-LSSGFFSPKQPDLFKDIVNM 740


>3ddsA [x.x.x] GLYCOGEN PHOSPHORYLASE, LIVER FORM
          Length = 810

 Score = 64.4 bits (155), Expect = 5e-13
 Identities = 33/323 (10%), Positives = 74/323 (22%), Gaps = 39/323 (12%)

Query: 76  IIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAK 135
           I+     + +           +       +     +   G+      + L      L   
Sbjct: 426 IVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITP---RRWLLLCNPGLAEL 482

Query: 136 FSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVK 195
            ++            L    +    +         K   K  F ++ +      ++ +  
Sbjct: 483 IAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSM 542

Query: 196 IIGIIARNHADKNISRFLQ--------IANLLLKSNPSLRFLIAGRECSKIDIGSYLDNK 247
               + R H  K               I     K       +I G+      +   +   
Sbjct: 543 FDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKL 602

Query: 248 SNV--------------NKFFVFESVDSSEYLPV-----LDLYLSTSKVEGFPNILAEAM 288
                             K    E+   S    V     L   +ST+  E       + M
Sbjct: 603 ITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFM 662

Query: 289 LCEVPIVASNVGDCKDIL------NGYGEVFELSQGNKEIIEKIMKVLETTVV--MKKRM 340
           L     + +  G   ++       N +            + +K  +  E        K +
Sbjct: 663 LNGALTIGTMDGANVEMAEEAGEENLFIFGMR-IDDVAALDKKGYEAKEYYEALPELKLV 721

Query: 341 REYIINNFSIEAILEKHEKLYHE 363
            + I N F      +  + + + 
Sbjct: 722 IDQIDNGFFSPKQPDLFKDIINM 744


>3bjxB [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
          Length = 288

 Score = 59.6 bits (143), Expect = 1e-11
 Identities = 16/152 (10%), Positives = 32/152 (21%), Gaps = 7/152 (4%)

Query: 170 DKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFL 229
              + +      E    +  L   V  +    R  A      +L +A          R+ 
Sbjct: 6   FPQLSQLDVSGEESTYEDIRLTLRVPWVAFGCRVLATFPG--YLPLAWRRSAEALITRYA 63

Query: 230 IAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSE---YLPVLDLYLSTSKVEGFPNILAE 286
               +  +      +    N+ +       D  E      VL  +   +           
Sbjct: 64  EQAADELRERSLLNIGPLPNLKERLYAAGFDDGEIEKVRRVLYAFNYGNPKYLLLITALS 123

Query: 287 AMLCEVPIVASNVGDCKDILNGYGEVFELSQG 318
                 P+  + V          G        
Sbjct: 124 ESQ--RPVGGAEVSSELRASIPKGHPKGDPLL 153


>1bx3A [c.87.1] PROTEIN (GLYCOGEN PHOSPHORYLASE B)
          Length = 801

 Score = 58.5 bits (140), Expect = 3e-11
 Identities = 26/335 (7%), Positives = 82/335 (24%), Gaps = 46/335 (13%)

Query: 74  IKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLN 133
           ++     + ++ H  +  ++ ++ +    + +       +   E            I   
Sbjct: 397 VEEGAVKRINMAHLCIAGSHAVNGVA-RIHSEILKKTIFKDFYELEPHKFQNKTNGITPR 455

Query: 134 AKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFL-----------KYE 182
                 +        + + +           + +  D + F                 Y 
Sbjct: 456 RWLVLCNPGLAEIIAERIGEEYISDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYL 515

Query: 183 KFRLNNDLDDNVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGR- 233
           +      ++ N      + R H  K              +I     K       +I G+ 
Sbjct: 516 EREYKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKKEPNKFVVPRTVMIGGKA 575

Query: 234 ------------------ECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTS 275
                             +    D       +    + +     +       L   +ST+
Sbjct: 576 APGYHMAKMIIKLITAIGDVVNHDPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTA 635

Query: 276 KVEGFPNILAEAMLCEVPIVASNVGDCKDIL----NGYGEVFELSQGN-KEIIEKIMKVL 330
             E       + ML     + +  G   ++          +F +   +   + ++     
Sbjct: 636 GTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFGMRVEDVDRLDQRGYNAQ 695

Query: 331 ETTVVMKK--RMREYIINNFSIEAILEKHEKLYHE 363
           E    + +  ++ E + + F      +  + + + 
Sbjct: 696 EYYDRIPELRQIIEQLSSGFFSPKQPDLFKDIVNM 730


>2c4mB [x.x.x] GLYCOGEN PHOSPHORYLASE
          Length = 788

 Score = 57.4 bits (137), Expect = 7e-11
 Identities = 37/323 (11%), Positives = 69/323 (21%), Gaps = 33/323 (10%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
              I       +      H  +I       +                             
Sbjct: 389 MAWIACYAAYSINGVAALHTEIIKAETLADWYALWPEKFNNKTNGVTPRRWLRMINPGLS 448

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
           +                 L+  ++              K   K  F ++   R   ++D 
Sbjct: 449 DLLTRLSGSDDWVTDLDELKKLRSYADDKSVLEELRAIKAANKQDFAEWILERQGIEIDP 508

Query: 193 NVKIIGIIARNHADKNISRFL--------QIANLLLKSNPSLRFLIAGRECSKIDIGSYL 244
                  I R H  K              +I    L   P+   +   +          +
Sbjct: 509 ESIFDVQIKRLHEYKRQLMNALYVLDLYFRIKEDGLTDIPARTVIFGAKAAPGYVRAKAI 568

Query: 245 DNKSNV--------------NKFFVFESVDSSEYLPVLDL-----YLSTSKVEGFPNILA 285
               N                K    E+ + S    +L        +ST+  E       
Sbjct: 569 IKLINSIADLVNNDPEVSPLLKVVFVENYNVSPAEHILPASDVSEQISTAGKEASGTSNM 628

Query: 286 EAMLCEVPIVASNVGDCKDIL------NGYGEVFELSQGNKEIIEKIMKVLETTVVMKKR 339
           + M+     + +  G   +I+      N Y     + +            L  TV   KR
Sbjct: 629 KFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRESYKPYELYETVPGLKR 688

Query: 340 MREYIINNFSIEAILEKHEKLYH 362
             + + N    +        L H
Sbjct: 689 ALDALDNGTLNDNNSGLFYDLKH 711


>3d0rA [x.x.x] PROTEIN CALG3
          Length = 378

 Score = 54.5 bits (129), Expect = 5e-10
 Identities = 20/297 (6%), Positives = 72/297 (24%), Gaps = 30/297 (10%)

Query: 73  YIKIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKL 132
            + ++   +PD++         +    +      +   S       +    +    ++  
Sbjct: 103 TMALVDDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLTDLMDK 162

Query: 133 NAKFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDD 192
           +         T+ +   SL            ++  G    +                   
Sbjct: 163 HQVSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPV----------PA 212

Query: 193 NVKIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNK 252
             ++   +            ++             F++A  +     +G+   N      
Sbjct: 213 RPEVAITMGTIELQAFGIGAVEPIIAAAGEVD-ADFVLALGDLDISPLGTLPRN------ 265

Query: 253 FFVFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDI------L 306
                       L      +      G    +  A+   +P + +     +        +
Sbjct: 266 VRAVGWTPLHTLLRTCTAVVH----HGGGGTVMTAIDAGIPQLLAPDPRDQFQHTAREAV 321

Query: 307 NGYGEVFELSQGNKEIIEKIMKVLETTVVMKK--RMREYIINNFSIEAILEKHEKLY 361
           +  G     S  +K   + + +++    +      +RE ++   +    + +  +  
Sbjct: 322 SRRGIGLV-STSDKVDADLLRRLIGDESLRTAAREVREEMVALPTPAETVRRIVERI 377


>2c1xA [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
          Length = 434

 Score = 52.8 bits (125), Expect = 2e-09
 Identities = 26/292 (8%), Positives = 70/292 (23%), Gaps = 31/292 (10%)

Query: 88  WMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKFSKFSDLTLNNS 147
                    +L             ++ G+   + +   ++ + ++     K +     NS
Sbjct: 150 SGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPK-ATAVFINS 208

Query: 148 KKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIARNHADK 207
            + L+D      K++                       L    +     +  I+      
Sbjct: 209 FEELDDSLTNDLKSKLKTYLNIGPF-------NLITGCLQWLKERKPTSVVYISFGTVTT 261

Query: 208 NISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDN-KSNVNKFFVFESVDSSEYLP 266
                +   +  L+++          +        +L+  +       V      +E L 
Sbjct: 262 PPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYG---MVVPWAPQAEVLA 318

Query: 267 VLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-------NGYGEVFELSQGN 319
                +         N L E++   VP++       + +           G   E     
Sbjct: 319 --HEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFT 376

Query: 320 KE-IIEKIMKVLE---------TTVVMKKRMREYIINNFSIEAILEKHEKLY 361
           K  ++    ++L              +++     +    S          L 
Sbjct: 377 KSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLV 428


>2c9zA [x.x.x] UDP GLUCOSE\:FLAVONOID 3-O-GLUCOSYLTRANSFERASE
          Length = 438

 Score = 51.3 bits (121), Expect = 5e-09
 Identities = 24/239 (10%), Positives = 54/239 (22%), Gaps = 28/239 (11%)

Query: 140 SDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKIIGI 199
           +     NS + L+D      K++                L++ K R          +   
Sbjct: 205 ATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKER-----KPTSVVYIS 259

Query: 200 IARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESV 259
                        +   +  L+++          +        +L+         V    
Sbjct: 260 FGTVTTPPPAE--VVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRG--YGMVVPWA 315

Query: 260 DSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDIL-------NGYGEV 312
             +E L      +         N L E++   VP++       + +           G  
Sbjct: 316 PQAEVLA--HEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVR 373

Query: 313 FELSQGNKEIIEKIMKVL----------ETTVVMKKRMREYIINNFSIEAILEKHEKLY 361
            E     K  +      +          E    +++     +    S          L 
Sbjct: 374 IEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLV 432


>3bjxD [x.x.x] HALOCARBOXYLIC ACID DEHALOGENASE DEHI
          Length = 302

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 18/186 (9%), Positives = 41/186 (22%), Gaps = 10/186 (5%)

Query: 165 IANGFDKDVFKPS-------FLKYEKFRLNNDLDDNVKIIGIIARNHADKNISRFLQIAN 217
           +                       E    +  L   V  +    R  A      +L +A 
Sbjct: 8   LVPRGSHTNPAYFPQLSQLDVSGEESTYEDIRLTLRVPWVAFGCRVLATFPG--YLPLAW 65

Query: 218 LLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESVDSSEYLPVLDLYLSTSKV 277
                    R+     +  +      +    N+ +       D  E   V  +  + +  
Sbjct: 66  RRSAEALITRYAEQAADELRERSLLNIGPLPNLKERLYAAGFDDGEIEKVRRVLYAFNYG 125

Query: 278 EGFPNILAEAMLC-EVPIVASNVGDCKDILNGYGEVFELSQGNKEIIEKIMKVLETTVVM 336
                +L  A+   + P+  + V          G              K    ++  +  
Sbjct: 126 NPKYLLLITALSESQRPVGGAEVSSELRASIPKGHPKGDPLLPLVDATKASTEVQGLLKR 185

Query: 337 KKRMRE 342
              +  
Sbjct: 186 VADLHY 191


>1bc9A [x.x.x] CYTOHESIN-1
          Length = 200

 Score = 48.7 bits (115), Expect = 3e-08
 Identities = 24/183 (13%), Positives = 54/183 (29%), Gaps = 20/183 (10%)

Query: 200 IARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVFESV 259
           +     +K ++   +  N+  K            + +  DI  +L     +NK  + + +
Sbjct: 1   MKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYL 60

Query: 260 DSSEYLPVLDLYLSTSKVEGFPNILAEAM--LCEVPIVASNVGDCKDIL--------NGY 309
              +   +  L+      E     L +A+        +         ++           
Sbjct: 61  GERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCN 120

Query: 310 GEVFELSQGNKEIIEKIMKVLETT-----VVMKKRMREYIIN----NFSIEAILEKHEKL 360
             VF+ S     ++   + +L T+     V  K  +  +I      N   +   E    L
Sbjct: 121 NGVFQ-STDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNL 179

Query: 361 YHE 363
           Y  
Sbjct: 180 YES 182


>2c1zA [x.x.x] UDP-GLUCOSE FLAVONOID 3-O GLYCOSYLTRANSFERASE
          Length = 439

 Score = 48.2 bits (113), Expect = 4e-08
 Identities = 26/304 (8%), Positives = 77/304 (25%), Gaps = 30/304 (9%)

Query: 77  IRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNAKF 136
           I  I+  +  + +       +   P          ++ G+   + +   ++ + ++    
Sbjct: 146 IDEIREKIGVSGIQGREDELLNFIPGMS-KVRFRDLQEGIVFGNLNSLFSRMLHRMGQVL 204

Query: 137 SKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNVKI 196
            K +     NS + L+D      K++                L++ K R          +
Sbjct: 205 PK-ATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITGCLQWLKER-----KPTSVV 258

Query: 197 IGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFFVF 256
                           +   +  L+++          +        +L+          +
Sbjct: 259 YISFGTVTTPPPAE--VVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPW 316

Query: 257 ESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGY------- 309
               + +   +    +         N L E++   VP++       + +           
Sbjct: 317 ----APQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEI 372

Query: 310 GEVFELSQGNKE-IIEKIMKVLE---------TTVVMKKRMREYIINNFSIEAILEKHEK 359
           G   E     K  ++    ++L              +++     +    S          
Sbjct: 373 GVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVD 432

Query: 360 LYHE 363
           L  +
Sbjct: 433 LVSK 436


>3d0rB [x.x.x] PROTEIN CALG3
          Length = 381

 Score = 47.9 bits (112), Expect = 5e-08
 Identities = 20/294 (6%), Positives = 69/294 (23%), Gaps = 30/294 (10%)

Query: 75  KIIRRIKPDVIHAWMYHANVISILCKPFYRKTKYINSIRMGLENYDGHKNLTKFMIKLNA 134
            ++   +PD++         +    +      +   S       +    +    ++  + 
Sbjct: 109 ALVDDYRPDLVVYEQGATVGLLAADRAGVPAVQRNQSAWRTRGMHRSIASFLTDLMDKHQ 168

Query: 135 KFSKFSDLTLNNSKKSLEDHQNIGFKNQCFIANGFDKDVFKPSFLKYEKFRLNNDLDDNV 194
                   T+ +   SL            ++  G    +                     
Sbjct: 169 VSLPEPVATIESFPPSLLLEAEPEGWFMRWVPYGGGAVLGDRLPPV----------PARP 218

Query: 195 KIIGIIARNHADKNISRFLQIANLLLKSNPSLRFLIAGRECSKIDIGSYLDNKSNVNKFF 254
           ++   +            ++             F++A  +     +G+   N        
Sbjct: 219 EVAITMGTIELQAFGIGAVEPIIAAAGEVD-ADFVLALGDLDISPLGTLPRN------VR 271

Query: 255 VFESVDSSEYLPVLDLYLSTSKVEGFPNILAEAMLCEVPIVASNV-GDCKDILN-----G 308
                     L      +      G    +  A+   +P + +    D            
Sbjct: 272 AVGWTPLHTLLRTCTAVVH----HGGGGTVMTAIDAGIPQLLAPDPRDQFQHTAREAVSR 327

Query: 309 YGEVFELSQGNKEIIEKIMKVLETTVVMK--KRMREYIINNFSIEAILEKHEKL 360
            G        +K   + + +++    +    + +RE ++   +    + +  + 
Sbjct: 328 RGIGLVS-TSDKVDADLLRRLIGDESLRTAAREVREEMVALPTPAETVRRIVER 380


>1ahpA [c.87.1] E.COLI MALTODEXTRIN PHOSPHORYLASE
          Length = 796

 Score = 45.8 bits (108), Expect = 2e-07
 Identities = 27/229 (11%), Positives = 54/229 (23%), Gaps = 34/229 (14%)

Query: 169 FDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIAR----NHADKNIS----RFLQIANLLL 220
             K   K    ++ K R   D++        I R         N+      + +I     
Sbjct: 501 VIKQANKVRLAEFVKVRTGIDINPQAIFDIQIKRLHEYKRQHLNLLRILALYKEIRENPQ 560

Query: 221 KSNPSLRFLIAGRECSKIDIGSYLDNKSNV--------------NKFFVFESVDSSEYLP 266
                  FL   +      +   +    N                K         S    
Sbjct: 561 ADRVPRVFLFGAKAAPGYYLAKNIIFAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEK 620

Query: 267 VLD-----LYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE----VFELSQ 317
           ++        +ST+  E       +  L     V +  G   +I    GE    +F  + 
Sbjct: 621 LIPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTV 680

Query: 318 GNKEIIEKIMKVLETTVVMKKRMRE---YIINNFSIEAILEKHEKLYHE 363
              + I              K +      + +    +      +++ H 
Sbjct: 681 KQVKAILAKGYDPVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHS 729


>2ecpA [c.87.1] MALTODEXTRIN PHOSPHORYLASE
          Length = 796

 Score = 45.8 bits (108), Expect = 2e-07
 Identities = 27/229 (11%), Positives = 54/229 (23%), Gaps = 34/229 (14%)

Query: 169 FDKDVFKPSFLKYEKFRLNNDLDDNVKIIGIIAR----NHADKNIS----RFLQIANLLL 220
             K   K    ++ K R   D++        I R         N+      + +I     
Sbjct: 501 VIKQANKVRLAEFVKVRTGIDINPQAIFDIQIKRLHEYKRQHLNLLRILALYKEIRENPQ 560

Query: 221 KSNPSLRFLIAGRECSKIDIGSYLDNKSNV--------------NKFFVFESVDSSEYLP 266
                  FL   +      +   +    N                K         S    
Sbjct: 561 ADRVPRVFLFGAKAAPGYYLAKNIIFAINKVADVINNDPLVGDKLKVVFLPDYCVSAAEK 620

Query: 267 VLD-----LYLSTSKVEGFPNILAEAMLCEVPIVASNVGDCKDILNGYGE----VFELSQ 317
           ++        +ST+  E       +  L     V +  G   +I    GE    +F  + 
Sbjct: 621 LIPAADISEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEIAEKVGEENIFIFGHTV 680

Query: 318 GNKEIIEKIMKVLETTVVMKKRMRE---YIINNFSIEAILEKHEKLYHE 363
              + I              K +      + +    +      +++ H 
Sbjct: 681 KQVKAILAKGYDPVKWRKKDKVLDAVLKELESGKYSDGDKHAFDQMLHS 729


>1dvgA [a.132.1] HEME OXYGENASE-1
          Length = 212

 Score = 34.7 bits (79), Expect = 4e-04
 Identities = 11/101 (10%), Positives = 25/101 (24%), Gaps = 2/101 (1%)

Query: 263 EYLPVLDLYLSTSKVEGFPNI-LAEAMLCEVPIVASNVGD-CKDILNGYGEVFELSQGNK 320
            Y P    Y+      G  +  L  A      +   + G   K I      +    +G  
Sbjct: 96  PYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKALALPSSGEGLA 155

Query: 321 EIIEKIMKVLETTVVMKKRMREYIINNFSIEAILEKHEKLY 361
                 +        + +      +       + E+ +  +
Sbjct: 156 SFTFPSIDNPTKFKQLYRARNTLELTPEVKHRVTEEAKTAF 196


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0426    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 31,889,620
Number of extensions: 2038694
Number of successful extensions: 22858
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 10173
Number of HSP's successfully gapped: 764
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)