RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ACD30829.1 ftul2 rpsF GIB00719CH01 "30S ribosomal protein S6"
         (111 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF01250 Ribosomal_S6 "Ribosomal protein S6"                            89   5e-21

>PF01250 Ribosomal_S6 "Ribosomal protein S6"
          Length = 92

 Score = 88.9 bits (220), Expect = 5e-21
 Identities = 41/89 (46%), Positives = 66/89 (74%), Gaps = 1/89 (1%)

Query: 3  HYEVVLMIHPDQSDQ-LDAMLGKYRGIIEEKGGKIHRFEDWGRRQLAYPIEKLHKAHYVL 61
          HYE++ ++ PD S++ + A++ +Y  +I + GG I + EDWGRR+LAYPI+KL + HYVL
Sbjct: 2  HYEIMFIVRPDLSEEEVKALVERYAKLITDNGGVIRKVEDWGRRRLAYPIKKLREGHYVL 61

Query: 62 FNIECPTESLEKLQESLRYNDAILRRLVI 90
           N + P E++++L+ +LR ND +LR LV+
Sbjct: 62 MNFDAPPEAIDELERTLRLNDRVLRHLVV 90


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.320    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0521    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 13,595,810
Number of extensions: 745513
Number of successful extensions: 101183
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1845
Number of HSP's successfully gapped: 248
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)