RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ACD31053.1 ftul2 hslU GIB00719CH01 "ATP-dependent protease
HslVU, ATPase subunit"
         (455 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF07724 AAA_2 "AAA domain (Cdc48 subfamily)"                           53   6e-10
PF00004 AAA "ATPase family associated with various cellular acti...    45   2e-07
PF10431 ClpB_D2-small "C-terminal, D2-small domain, of ClpB prot...    45   3e-07
PF07728 AAA_5 "AAA domain (dynein-related subfamily)"                  34   5e-04
PF01078 Mg_chelatase "Magnesium chelatase, subunit ChlI"               34   6e-04

>PF07724 AAA_2 "AAA domain (Cdc48 subfamily)"
          Length = 160

 Score = 53.5 bits (128), Expect = 6e-10
 Identities = 39/105 (37%), Positives = 48/105 (45%), Gaps = 36/105 (34%)

Query: 260 EQNGIVFLDEIDKVCRKSSNSGADVSREGVQRDLLPLVEGSTVSTKYG-VIKTDHILFIA 318
           E+ GIV LDEIDK            +  GVQ  LL ++EG  ++ K G  + T +ILFI 
Sbjct: 67  EEGGIVLLDEIDK------------AHPGVQNALLQILEGGRLTDKQGRTVDTKNILFIM 114

Query: 319 SGAFHVAKPSD-----------------------LIPELQGRLPI 340
           +GAF   KPSD                        IPE  GRLPI
Sbjct: 115 TGAFGGLKPSDSKRLGGEDYELLKVEVEDLLKKGFIPEFLGRLPI 159



 Score = 51.2 bits (122), Expect = 3e-09
 Identities = 28/60 (46%), Positives = 42/60 (70%), Gaps = 9/60 (15%)

Query: 51  PK-NILMIGPTGVGKTEIARRLAKL----ADAPFIKVEATKFTEVGYVGKDVESIIRDLV 105
           PK N L +GPTGVGKTE+A+ LAKL    ++ P I+++A+++TE    G+DVE  +  L+
Sbjct: 2   PKGNFLFLGPTGVGKTELAKTLAKLLFVGSEKPLIRIDASEYTE----GEDVEHSVSRLI 57


>PF00004 AAA "ATPase family associated with various cellular
           activities (AAA)"
          Length = 123

 Score = 45.4 bits (107), Expect = 2e-07
 Identities = 26/57 (45%), Positives = 35/57 (61%), Gaps = 2/57 (3%)

Query: 54  ILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFTEVGYVGKDVESIIRDLVETAVK 110
           +L+ GP G GKT +AR LAK   APFI++ A++     YVG+  E  +R L E A K
Sbjct: 1   VLLYGPPGTGKTTLARALAKELGAPFIEISASELVS-KYVGES-EKRLRKLFEEAKK 55


>PF10431 ClpB_D2-small "C-terminal, D2-small domain, of ClpB protein
           "
          Length = 90

 Score = 44.7 bits (105), Expect = 3e-07
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 8/67 (11%)

Query: 350 EDFVRILREPDCSILKQYIALMKTEGIDLSFEEDAIRKIAEIAYKVNEEVENIGARRLHT 409
           ED VRIL E   +++KQY  L++TEG++L F ++AI  IAE AY       N GAR L  
Sbjct: 4   EDLVRILTE---ALVKQYKRLLETEGVELEFTDEAIEAIAEKAYD-----PNTGARPLRR 55

Query: 410 VMERLLE 416
           ++ERLLE
Sbjct: 56  IIERLLE 62


>PF07728 AAA_5 "AAA domain (dynein-related subfamily)"
          Length = 135

 Score = 33.9 bits (77), Expect = 5e-04
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 54 ILMIGPTGVGKTEIARRLAKLADAPFIKVEATKFT 88
          +L++GP G GKT +AR LA     P +++  +K T
Sbjct: 2  VLLVGPPGTGKTTLARALAAALGRPLVRINLSKDT 36


>PF01078 Mg_chelatase "Magnesium chelatase, subunit ChlI"
          Length = 200

 Score = 33.6 bits (76), Expect = 6e-04
 Identities = 27/80 (33%), Positives = 37/80 (46%), Gaps = 20/80 (25%)

Query: 20 GQNDAKKAVAIALRNRWRRMQLDNEMRQEVTPKNILMIGPTGVGKTEIARRLAKLADAPF 79
          GQ +AK+A+ IA                     N+L+IGP G GK+ +ARRL  L   P 
Sbjct: 7  GQEEAKRALEIAAAGG----------------HNLLLIGPPGTGKSMLARRLPGLL-PPL 49

Query: 80 IKVEATKFT---EVGYVGKD 96
           + EA +      V  +GKD
Sbjct: 50 TEEEALEVAAIHSVAGLGKD 69


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.316    0.132    0.358 

Gapped
Lambda     K      H
   0.267   0.0545    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 13,388,393
Number of extensions: 719638
Number of successful extensions: 103694
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1891
Number of HSP's successfully gapped: 230
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)