RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ACD31331.1 ftul2 rpmD GIB00719CH01 "50S ribosomal protein L30"
         (61 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00327 Ribosomal_L30 "Ribosomal protein L30p/L7e"                     39   6e-06

>PF00327 Ribosomal_L30 "Ribosomal protein L30p/L7e"
          Length = 52

 Score = 38.9 bits (90), Expect = 6e-06
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 8  KVTLVKSLIGRKENHIASARGLGLRKINHTVEVLDTPENRGMANKIYYMV 57
          KVT V+S+IGR      + R LGLRKIN  V V D P  RGM  K+ ++V
Sbjct: 3  KVTRVRSIIGRPPKQRKTLRLLGLRKINSAVFVKDNPATRGMLKKVEHLV 52


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.321    0.139    0.415 

Gapped
Lambda     K      H
   0.267   0.0536    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 8,752,251
Number of extensions: 463073
Number of successful extensions: 70807
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1459
Number of HSP's successfully gapped: 276
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)