RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACD30290.1 ftul2 rpoC GIB00719CH01 "DNA-directed RNA
polymerase, beta' subunit"
         (1417 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2ghoD1 [e.29.1.2] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN D:3 --...  1060   0.0  
1iw7D [e.29.1.2] RNA POLYMERASE BETA SUBUNIT                          749   0.0  
1i3qA [e.29.1.2] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT       598   e-174
1dioA [c.1.19.3] PROTEIN (DIOL DEHYDRATASE)                           123   6e-31
1lm5A [d.211.2.1] SUBDOMAIN OF DESMOPLAKIN CARBOXY-TERMINAL DOMAIN    105   1e-25
1i3qB [e.29.1.1] DNA-DIRECTED RNA POLYMERASE II 140KD POLYPEPTIDE     100   4e-24
1g7dA [a.71.1.1] ENDOPLASMIC RETICULUM PROTEIN ERP29                   96   1e-22
1kitA2 [b.29.1.8] SIALIDASE A:347 -- 543                               90   5e-21
2r7kA1 [c.30.1.8] 5-FORMAMINOIMIDAZOLE-4-CARBOXAMIDE-1-(BETA)-D-...    78   3e-17
1t0hB [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A          69   1e-14
1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237           66   7e-14
1xi8A2 [b.103.1.1] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A:6 ...    59   8e-12
2nqmA2 [b.103.1.1] MOLYBDOPTERIN BIOSYNTHESIS PROTEIN MOEA A:7 -...    56   7e-11
1qwyA [b.84.3.2] PEPTIDOGLYCAN HYDROLASE                               53   7e-10
1vs6W1 [b.84.4.1] 50S RIBOSOMAL PROTEIN L27 W:1 -- 84                  53   8e-10
2hgjD2 [b.40.4.5] 50S RIBOSOMAL PROTEIN L2 D:5 -- 126                  46   8e-08
1cfmA2 [b.84.2.2] CYTOCHROME F A:169 -- 232                            44   3e-07
1brwA3 [d.41.3.1] PROTEIN (PYRIMIDINE NUCLEOSIDE PHOSPHORYLASE) ...    43   6e-07
1v8qA [b.84.4.1] TT0826                                                43   7e-07
2c35A1 [a.60.8.2] DNA-DIRECTED RNA POLYMERASE II 16 KDA A:14 -- 142    41   3e-06
1accA [f.11.1.1] ANTHRAX PROTECTIVE ANTIGEN                            40   5e-06
1uz5A2 [b.103.1.1] 402AA LONG HYPOTHETICAL MOLYBDOPTERIN A:5 -- 180    39   1e-05

>2ghoD1 [e.29.1.2] DNA-DIRECTED RNA POLYMERASE BETA' CHAIN D:3 -- 1501
          Length = 1196

 Score = 1060 bits (2743), Expect = 0.0
 Identities = 467/1062 (43%), Positives = 627/1062 (59%), Gaps = 89/1062 (8%)

Query: 13   KKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLCGK 72
            K+   ++I+LASPE IRSWS+GEV+KPETINYRT KPERDGLF  +IFGPIKDYEC CGK
Sbjct: 1    KEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGK 60

Query: 73   YKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKN 132
            YKR +              ++ VRR RMGHI+L  P  HIW++K +PS+IG  LD+    
Sbjct: 61   YKRQRFEGKVCERCGVEVTRSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATE 120

Query: 133  VEKVLYFESYIVTDPG-----MTPLEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLL 187
            +E+VLYF  YIV DP        P+EK+QLLTDEEY           +A MGAEAI++LL
Sbjct: 121  LEQVLYFNKYIVLDPKGAVLDGVPVEKRQLLTDEEY--------GGIDARMGAEAIQELL 172

Query: 188  ADTDIES-EIELLQXXXXXXXXXXXXXXXIKRLRLLETFQASGNKPEWMVMTXXXXXXXX 246
             + D+E  E ELL+                KRL ++  F  SGN+PEWM++         
Sbjct: 173  KELDLEKLERELLEEMKHPSRARRAKAR--KRLEVVRAFLDSGNRPEWMILEAVPVLPPD 230

Query: 247  XXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXXXXXXAPDIIVRNEKRMLQEAVDALLD 306
                  ++GGRFATSDLNDLY                 AP+II+RNEKRMLQEAVDA++D
Sbjct: 231  LRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIIIRNEKRMLQEAVDAVID 290

Query: 307  NGRRGRAVTG-SNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPSLRLHECG 365
            NGRRG  VT   ++RPL+SL D++ GKQGRFRQNLLGKRVDYSGRSVI VGP L+LH+CG
Sbjct: 291  NGRRGSPVTNPGSERPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCG 350

Query: 366  LPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAV---VWDILETVINEHPVLLN 422
            LPK+MALELFKPF+  K+     A  +K A+RM+E +  +   VWD LE VI+   VLLN
Sbjct: 351  LPKRMALELFKPFLLKKMEEKAFAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLN 410

Query: 423  RAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLM 482
            RAPTLHRLGIQAF+P L+EG++IQLHPLVC AFNADFDGDQMAVHVPL+  +Q EAR+ M
Sbjct: 411  RAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQM 470

Query: 483  MSTNNILSPASGQPIITPTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDI 542
            +S +N+LSPASG+P+  P++DI+LGLYYIT+ ++  +G G  F++ E+   AY  G + +
Sbjct: 471  LSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGMAFATPEEALAAYERGEVAL 530

Query: 543  HAKIKLR-----IDRQVFDT----KGNTYNEKGVVN---------------TTVGRALLL 578
            +A I +      + R  F      +       G+++               T+ GR L  
Sbjct: 531  NAPIVVAGRETSVGRLKFVFANPDEALLAVAHGLLDLQDVVTVRYLGRRLETSPGRILFA 590

Query: 579  NILPEGLSFSLLNKVLV-------KKEISKIINQAFRVLGGKATVVLADKLMYAGFKYST 631
             I+ E +    + + L+       K  +  ++ QAF  LG + T  L D L Y GF  ST
Sbjct: 591  RIVGEAVGDEKVAQELIQMDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTLST 650

Query: 632  LSGVSVGVDDMTIPDNXXXXXXXXXXXXXQITEQYQSSLITENERYNNIINIWSKTSDEV 691
             SG+++G+DD  IP+              QI + Y+   +T+ ERY+ +I +W++T+++V
Sbjct: 651  TSGITIGIDDAVIPEEKQRYLEEADRKLRQIEQAYEMGFLTDRERYDQVIQLWTETTEKV 710

Query: 692  GASMMDAISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTM 751
              ++     ++             FN +Y+MA+SGARG+  Q+RQL GMRGLM KP G  
Sbjct: 711  TQAVFKNFEEN-----------YPFNPLYVMAQSGARGNPQQIRQLCGMRGLMQKPSGET 759

Query: 752  IETAITANFREGLSVLQYFTSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDC 811
             E  + ++FREGL+VL+YF S+HGARKG ADTAL+TA++GYLTR+LVDVA ++VV E DC
Sbjct: 760  FEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVAHEIVVREADC 819

Query: 812  GTDDGLMFSAIVEDGEVKVPLVERA--------LGRTLAADVVTEKGVVLLEAGT----X 859
            GT + +    + +  EV   L  R          GR LA +V  E     LE G      
Sbjct: 820  GTTNYISV-PLFQMDEVTRTLRLRKRSDIESGLYGRVLAREV--EALGRRLEEGRYLSLE 876

Query: 860  XXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGESVGVIAAQSI 919
                         +  + VRSP+TC+TR G+C KCYG DL+  R V++GE+VGV+AA+SI
Sbjct: 877  DVHFLIKAAEAGEVREVPVRSPLTCQTRYGVCQKCYGYDLSMARPVSIGEAVGVVAAESI 936

Query: 920  GEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEII 979
            GEPGTQLTMRT                K K            ++  +G   +      + 
Sbjct: 937  GEPGTQLTMRTTQGLPRVIELFEARRPKAKA----------VISEIDGVVRIEEGEDRLS 986

Query: 980  VSDTMGRVREQHKIPMGAVVPLASGKAVEIGDVI--ATWDPH 1019
            V        +++K+P  A + +  G  VE G  +     DPH
Sbjct: 987  VFVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLTRGAIDPH 1028



 Score =  252 bits (645), Expect = 6e-70
 Identities = 152/438 (34%), Positives = 226/438 (51%), Gaps = 49/438 (11%)

Query: 928  MRTFHTGGAASLGITVS-DIKVKTA--GKIKFKNIRTVTNKEGQEIVISRAGEIIVSDTM 984
            +RT  +G      + V+ +I V+ A  G   + ++      E    +  R    I S   
Sbjct: 793  LRTADSGYLTRKLVDVAHEIVVREADCGTTNYISVPLFQMDEVTRTLRLRKRSDIESGLY 852

Query: 985  GRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPLITDVAGKVVLEDVIDGITSKH 1044
            GRV  +           A G+ +E G  ++  D H      + AG+V    V   +T + 
Sbjct: 853  GRVLAREV--------EALGRRLEEGRYLSLEDVHFLIKAAE-AGEVREVPVRSPLTCQT 903

Query: 1045 TYDDLTGQQTIEITSISQRTTSKNLKPVVKIVDEKGAKLKSIPLAVGAVLNVADDSILEV 1104
             Y             + Q+    +L           A+  SI  AVG V   A +SI E 
Sbjct: 904  RYG------------VCQKCYGYDLSM---------ARPVSIGEAVGVV---AAESIGEP 939

Query: 1105 GDIVAKIPLEGSKNKDITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIE 1164
            G    ++ +        T GLPRV ELFEARRPK  A++S  DG+VR+     + + R+ 
Sbjct: 940  G---TQLTM------RTTQGLPRVIELFEARRPKAKAVISEIDGVVRI----EEGEDRLS 986

Query: 1165 IIDKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLADGPTDPHDLLKYKGLEEFADYILIE 1224
            +  ++    +E  LPK   L+V DG+ V  G  L  G  DPH LL+ KG E    Y++ E
Sbjct: 987  VFVESEGFSKEYKLPKDARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVDE 1046

Query: 1225 AQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDSKFVKDESIELVRILEENDKLRKQG 1284
             Q VYR QGV ++DKHIE +VRQML+   + D GDS+ ++ + +E   +   N++L  +G
Sbjct: 1047 IQKVYRAQGVKLHDKHIEIVVRQMLKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEG 1106

Query: 1285 KKEVEYELVLMGITRSSLSTESFLSAASFQETTRVLTEASINSQIDNLRGLKENVLIGRL 1344
            K  V ++ +LMG+T+S+LST+S+LSAASFQ TT VLTEA+I  + D L GLKENV++GRL
Sbjct: 1107 KVPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRL 1166

Query: 1345 IPTGTGLAVRKESAKIEK 1362
            IP GTG    + +  +++
Sbjct: 1167 IPAGTGSDFVRFTQVVDQ 1184


>1iw7D [e.29.1.2] RNA POLYMERASE BETA SUBUNIT
          Length = 1392

 Score =  749 bits (1935), Expect = 0.0
 Identities = 400/1133 (35%), Positives = 564/1133 (49%), Gaps = 90/1133 (7%)

Query: 128  MPLKNVEKVLYFESYIVTDPGMTPLEKKQLLTDEEYAEALENYG---------------- 171
              L    +V  FE  +    G   +    +L D       + YG                
Sbjct: 279  SILVVKARVYPFEDDVEVSTG-DRVAPGDVLADGGK-VKSDVYGRVEVDLVRNVVRVVES 336

Query: 172  YEFEASMGAEAIRDLLADTDIES-EIELLQXXXXXXXXXXXXXXXIKRLRLLETFQASGN 230
            Y+ +A MGAEAI+ LL + D+E+ E ELL+                KRL ++  F  SGN
Sbjct: 337  YDIDARMGAEAIQQLLKELDLEALEKELLEEMKHPSRARRAKAR--KRLEVVRAFLDSGN 394

Query: 231  KPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXXXXXXAPDIIV 290
            +PEWM++               ++GGRFATSDLNDLY                 AP+II+
Sbjct: 395  RPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQGAPEIII 454

Query: 291  RNEKRMLQEAVDALLDNGRRGRAVTG-SNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSG 349
            RNEKRMLQEAVDALLDNGRRG  VT   + RPL+SL D++ GKQGRFRQNLLGKRVDYSG
Sbjct: 455  RNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSG 514

Query: 350  RSVITVGPSLRLHECGLPKKMALELFKPFVYSKLRLGGHATTIKQAKRMVELEEAV---V 406
            RSVI VGP L+LH+CGLPK+MALELFKPF+  K+   G A  +K A+RM+E +  +   V
Sbjct: 515  RSVIVVGPQLKLHQCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEV 574

Query: 407  WDILETVINEHPVLLNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADFDGDQMAV 466
            WD LE VI+   VLLNRAPTLHRLGIQAF+P L+EG++IQLHPLVC AFNADFDGDQMAV
Sbjct: 575  WDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVLVEGQSIQLHPLVCEAFNADFDGDQMAV 634

Query: 467  HVPLTVESQLEARVLMMSTNNILSPASGQPIITPTQDIVLGLYYITREKEGARGEGKLFS 526
            HVPL+  +Q EAR+ M+S +N+LSPASG+P+  P++DI+LGLYYIT+ ++  +G G  F+
Sbjct: 635  HVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKKGAGLEFA 694

Query: 527  SYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGNTYNEKGV------------------- 567
            + E+   A+  G + ++A IK+             +                        
Sbjct: 695  TPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVR 754

Query: 568  -----VNTTVGRALLLNILPEGLSF-------SLLNKVLVKKEISKIINQAFRVLGGKAT 615
                 + T+ GR L   I+ E +           L+    K  +  ++ QAF  LG + T
Sbjct: 755  YMGKRLETSPGRILFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKT 814

Query: 616  VVLADKLMYAGFKYSTLSGVSVGVDDMTIPDNXXXXXXXXXXXXXQITEQYQSSLITENE 675
              L D L Y GF +ST SG+++G+DD  IP+              QI + Y+   +T+ E
Sbjct: 815  ARLLDALKYYGFTFSTTSGITIGIDDAVIPEEKKQYLEEADRKLLQIEQAYEMGFLTDRE 874

Query: 676  RYNNIINIWSKTSDEVGASMMDAISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMR 735
            RY+ I+ +W++T+++V  ++     +              FN +Y+MA+SGARG+  Q+R
Sbjct: 875  RYDQILQLWTETTEKVTQAVFKNFEE-----------NYPFNPLYVMAQSGARGNPQQIR 923

Query: 736  QLAGMRGLMAKPDGTMIETAITANFREGLSVLQYFTSTHGARKGLADTALKTANAGYLTR 795
            QL G+RGLM KP G   E  + ++FREGL+VL+YF S+HGARKG ADTAL+TA++GYLTR
Sbjct: 924  QLCGLRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTR 983

Query: 796  RLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRTLAADV--VTEKGVVL 853
            +LVDV  ++VV E DCGT + +      +  EV   L  R      A     V  + V +
Sbjct: 984  KLVDVTHEIVVREADCGTTNYISVPLF-QPDEVTRSLRLRKRADIEAGLYGRVLAREVEV 1042

Query: 854  L--------EAGTXXXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQV 905
            L                          I  + VRSP+TC+TR G+C KCYG DL+  R V
Sbjct: 1043 LGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGVCQKCYGYDLSMARPV 1102

Query: 906  NVGESVGVIAAQSIGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRT--VT 963
            ++GE+VG++AAQSIGEPGTQLTMRTFHTGG A        +          +      ++
Sbjct: 1103 SIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVIS 1162

Query: 964  NKEGQEIVISRAGEIIVSDTMGRVREQHKIPMGAVVPLASGKAVEIGDVIATWDPHAQPL 1023
              +G   +     ++ V        +++K+P  A + +  G  VE G  +         L
Sbjct: 1163 EIDGVVRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQL 1222

Query: 1024 ITDVAGKVVLEDVIDGITSKHTYDDLTGQQTIEITSISQRTTSKNLKPVVKIVDEKGAKL 1083
            +     + V   +++ I   +    +          + Q      +         +G  L
Sbjct: 1223 LEAKGPEAVERYLVEEIQKVYRAQGVKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVL 1282

Query: 1084 KSIP-LAVGAVLNVADDSILEVGDIVAKIPLEGSKNKDITGGLP---RVAELFEARRPKD 1139
            +     A+   L     + +    ++  +       K              L EA     
Sbjct: 1283 EKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASFQNTTHVLTEAAIAGK 1342

Query: 1140 AAILSPCDGMVRLGNRDTKE---KQRIEIIDKNGHIVEEILLPKSRHLVVFDG 1189
               L      V LG R          +           + +    +     + 
Sbjct: 1343 KDELIGLKENVILG-RLIPAGTGSDFVRFTQVVDQKTLKAIEEARKE--AVEA 1392



 Score =  255 bits (652), Expect = 8e-71
 Identities = 109/336 (32%), Positives = 148/336 (44%), Gaps = 17/336 (5%)

Query: 13  KKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLCGK 72
           K+   ++I+LASPE IRSWS+GEV+KPETINYRT KPERDGLF  +IFGPIKDYEC CGK
Sbjct: 2   KEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGK 61

Query: 73  YKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPSRIGLFLDMPLKN 132
           YKR +              ++ VRR RMGHI+L  P  HIW++K +PS+IG  LD+    
Sbjct: 62  YKRQRFEGKVCERCGVEVTKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATE 121

Query: 133 VEKVLYFESYIVTDPGMTP-----LEKKQLLTDEEYAEALENYGYEFEASMGAEAIRDLL 187
           +E+VLYF  YIV DP         +EK+QLLTDEEY E        +    G +A+    
Sbjct: 122 LEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRELRYGKQETYPLPPGVDALVKDG 181

Query: 188 ADTDIESEIELLQXXXXXXXXXXXXXXXIKRLRLLETFQASGNKPEWMVMTXXXXXXXXX 247
            +     E+                   + R+  ++  +A    P    +          
Sbjct: 182 EEVVKGQELAPGVVSRLDGVALYRFPRRV-RVEYVKKERAGLRLPLAAWVEKEAYKPGEI 240

Query: 248 XXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXXXXXXAPDIIVRNEKRMLQEAVDALLDN 307
                 E   F    +                      P  I+  + R+     D  +  
Sbjct: 241 LAELP-EPYLFG-DKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARVYPFEDDVEVST 298

Query: 308 GRRG--RAVTGSNKRPLKSLADMIKGKQGRFRQNLL 341
           G R     V       +KS         GR   +L+
Sbjct: 299 GDRVAPGDVLADG-GKVKSD------VYGRVEVDLV 327



 Score =  116 bits (291), Expect = 6e-29
 Identities = 115/258 (44%), Positives = 160/258 (62%), Gaps = 5/258 (1%)

Query: 1119 KDITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILL 1178
             DIT GLPRV ELFEARRPK  A++S  DG+VR    +T+EK  + +  +      ++  
Sbjct: 1137 ADITQGLPRVIELFEARRPKAKAVISEIDGVVR--IEETEEKLSVFVESEGFSKEYKL-- 1192

Query: 1179 PKSRHLVVFDGEQVSRGDVLADGPTDPHDLLKYKGLEEFADYILIEAQSVYRMQGVVIND 1238
            PK   L+V DG+ V  G  L  G  DPH LL+ KG E    Y++ E Q VYR QGV ++D
Sbjct: 1193 PKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQGVKLHD 1252

Query: 1239 KHIETIVRQMLRKAVILDEGDSKFVKDESIELVRILEENDKLRKQGKKEVEYELVLMGIT 1298
            KHIE +VRQM++   + D GDS+ ++ + +E   +   N++L  +GK  V ++ +LMG+T
Sbjct: 1253 KHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVT 1312

Query: 1299 RSSLSTESFLSAASFQETTRVLTEASINSQIDNLRGLKENVLIGRLIPTGTGL-AVRKES 1357
            +S+LST+S+LSAASFQ TT VLTEA+I  + D L GLKENV++GRLIP GTG   VR   
Sbjct: 1313 KSALSTKSWLSAASFQNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQ 1372

Query: 1358 AKIEKMREELGVEDNMVF 1375
               +K  + +        
Sbjct: 1373 VVDQKTLKAIEEARKEAV 1390


>1i3qA [e.29.1.2] DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
          Length = 1414

 Score =  598 bits (1542), Expect = e-174
 Identities = 187/929 (20%), Positives = 353/929 (37%), Gaps = 124/929 (13%)

Query: 8   QNYNS---KKFDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIK 64
           Q Y+S   +    ++  L SPE +R+ S  +++ PET++    + +  GL   ++    +
Sbjct: 3   QQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDR 62

Query: 65  DYECLCGKYKRLKHXXXXXXXXXXXXXQAKVRRERMGHIDLVCPVVHIWYLKSLPS---R 121
           + +C   +    +                       GHIDL  PV H+ ++  +      
Sbjct: 63  NLKCQTCQEGMNE------------------CPGHFGHIDLAKPVFHVGFIAKIKKVCEC 104

Query: 122 IGLFLDMPLKNVEKVLYFESYIVTDP-----GMTPLEKKQLLTDEEYAEALENYGYEFEA 176
           + +     L +    L  ++  + D       +  L K +++ + +     E+   +  +
Sbjct: 105 VCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPS--EDDPTQLVS 162

Query: 177 SMGAEAIRDLLADTDI-------------ESEIELLQXXXXXXXXXXXXXXXIKRLRLLE 223
             G    +  +    +             +++   L+               +K    L 
Sbjct: 163 RGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSL- 221

Query: 224 TFQASGNKPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLYXXXXXXXXXXXXXXXX 283
            F    ++PEWM++T                  +    DL                    
Sbjct: 222 GFNEVFSRPEWMILTCLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHN 281

Query: 284 XAPDIIVRNEKRMLQEAVDALLDNGRRGRAV-TGSNKRPLKSLADMIKGKQGRFRQNLLG 342
            AP   +   + +LQ  V   +DN   G+      + RP+KS+   +KGK+GR R NL+G
Sbjct: 282 GAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEGRIRGNLMG 341

Query: 343 KRVDYSGRSVITVGPSLRLHECGLPKKMALELFKPFVYSKL------------------- 383
           KRVD+S R+VI+  P+L L + G+PK +A  L  P V +                     
Sbjct: 342 KRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 401

Query: 384 ----RLGGHATTIKQAKRMVELEEAVVWDILETVINEHPVLLNRAPTLHRLGIQAFEPRL 439
               R  G    ++ +KR  +++    W +   +++  PVL NR P+LH++ + A   ++
Sbjct: 402 KYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKV 461

Query: 440 IEGKAIQLHPLVCAAFNADFDGDQMAVHVPLTVESQLEARVLMMSTNNILSPASGQPIIT 499
           I     +L+  V + +NADFDGD+M +HVP + E++ E   L      I+SP S +P + 
Sbjct: 462 IPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMG 521

Query: 500 PTQDIVLGLYYITREKEGARGEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVF---- 555
             QD + G+  +T        +  L   Y          T  I     L   +Q+     
Sbjct: 522 IVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVIPTPAIIKPKPLWSGKQILSVAI 581

Query: 556 --DTKGNTYNEKGVVNTTVGRALLLNILPEGLSFSLLNKVLVKKEISKIINQAFRVLGGK 613
                   ++E   + +     +L  I+   + F ++ K  V      +I+   R  G +
Sbjct: 582 PNGIHLQRFDEGTTLLSPKDNGML--IIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ 639

Query: 614 ATVVLADKLMYAGFKYSTLSGVSVGVDDMTIPD----NXXXXXXXXXXXXXQITEQYQSS 669
               L   +      +   +G S G+ D                        +T++ Q++
Sbjct: 640 VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQAN 699

Query: 670 LITENERY-------NNIINIWSKTSDEVGASMMDAISKDTVSINGEKKEIESFNSVYMM 722
           L+T            +N++   ++  D+ G                    ++  N+V  M
Sbjct: 700 LLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE--------------VNLKDLNNVKQM 745

Query: 723 AKSGARGSYNQMRQLAGMRGLMAK-----PDGTMIET---------------AITANFRE 762
             +G++GS+  + Q++   G  +        G +  T                +  ++  
Sbjct: 746 VMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVENSYLR 805

Query: 763 GLSVLQYFTSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTD-DGLMFSA 821
           GL+  ++F    G R+GL DTA+KTA  GY+ RRLV   +D++V  ++   +  G +   
Sbjct: 806 GLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQF 865

Query: 822 I-VEDGEVKVPLVERALGRTLAADVVTEK 849
           I  EDG     + +++L     +D   EK
Sbjct: 866 IYGEDGMDAAHIEKQSLDTIGGSDAAFEK 894



 Score =  107 bits (268), Expect = 3e-26
 Identities = 38/200 (19%), Positives = 73/200 (36%), Gaps = 50/200 (25%)

Query: 1162 RIEIIDKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLADGPTDPH--------DLLKYKG 1213
            R+ ++  +  +             V + + V+  +V+     DP         D+++  G
Sbjct: 1250 RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLG 1309

Query: 1214 LEEFADYILIEAQSVYRMQGVVINDKHIETIVRQMLRKAVILDEGDSKFVKDESIELVRI 1273
            +E     +  E  +V    G  +N +H+  +V  M  +  +                   
Sbjct: 1310 IEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL------------------- 1350

Query: 1274 LEENDKLRKQGKKEVEYELVLMGITRSSL--STESFLSAASFQETTRVLTEASINSQIDN 1331
                                   +TR     S    L   SF+ET  +L EA  ++++D+
Sbjct: 1351 ---------------------TSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDD 1389

Query: 1332 LRGLKENVLIGRLIPTGTGL 1351
             RG+ ENV++G++ P GTG 
Sbjct: 1390 CRGVSENVILGQMAPIGTGA 1409


>1dioA [c.1.19.3] PROTEIN (DIOL DEHYDRATASE)
          Length = 551

 Score =  123 bits (308), Expect = 6e-31
 Identities = 14/264 (5%), Positives = 42/264 (15%), Gaps = 49/264 (18%)

Query: 589 LLNKVLVKKEISKIINQAFRVLGGKATVV--LADKLMYAGFKYSTLSGVSVGVDDMTIPD 646
           +            +I+      G        +                V           
Sbjct: 48  VTELDGKPVSDFDLIDHFIARYGINLNRAEEVMAMDSVKLANMLCDPNVKRSEIVPLTTA 107

Query: 647 NXXXXXXXXXXXXXQIT-----------EQYQSSLITENERYNNIINIWSKTSDEVGASM 695
                          +                      N + N +               
Sbjct: 108 MTPAKIVEVVSHMNVVEMMMAMQKMRARRTPSQQAHVTNVKDNPVQIAADAAEGAWRGFD 167

Query: 696 MDAISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETA 755
               +              +  +   +      G    + Q +       K         
Sbjct: 168 EQETTV--------AVARYAPFNAIALLVGSQVGRPGVLTQCSLEEATELKLGMLGHTCY 219

Query: 756 -------------------------ITANFREGLSVLQYFTSTHGARKGLADTALKTANA 790
                                    + +++      +++ + +    +     A   +  
Sbjct: 220 AETISVYGTEPVFTDGDDTPWSKGFLASSYASRGLKMRFTSGSGSEVQ--MGYAEGKS-M 276

Query: 791 GYLTRRLVDVAQDLVVIEEDCGTD 814
            YL  R + + +   V     G+ 
Sbjct: 277 LYLEARCIYITKAAGVQGLQNGSV 300


>1lm5A [d.211.2.1] SUBDOMAIN OF DESMOPLAKIN CARBOXY-TERMINAL DOMAIN
          Length = 189

 Score =  105 bits (262), Expect = 1e-25
 Identities = 18/199 (9%), Positives = 46/199 (23%), Gaps = 20/199 (10%)

Query: 805 VVIEEDCGTDDGLMFSAIVEDGEVKVPLVERAL-GRTLAADVVT-EKGVVLL----EAGT 858
           +    D    + +  +  +E G V     +R L  +     ++    G  L      +  
Sbjct: 4   IAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQG 63

Query: 859 XXXXXXXXXXXXXGIDMIKVRSPITCKTRRGLCAKCYGRDLARERQVNVGESVGVIAAQS 918
                            I  +       +        G+           E   +     
Sbjct: 64  VIDQDMATRLKPAQKAFIGFKMSAAEAVKEKWLPYEAGQRF--------LEFQYLTGGLV 115

Query: 919 IGEPGTQLTMRTFHTGGAASLGITVSDIKVKTAGKIKFKNIRTVTNKEGQEIVISRAGEI 978
             E   +++       G    G     ++  ++             K   +I    A   
Sbjct: 116 DPEVHGRISTEEAIRKGFID-GRAAQRLQDTSSYAKILTC-----PKTKLKISYKDAINR 169

Query: 979 IVSDTMGRVREQHKIPMGA 997
            + + +  +R      + +
Sbjct: 170 SMVEDITGLRLLEAASVSS 188


>1i3qB [e.29.1.1] DNA-DIRECTED RNA POLYMERASE II 140KD POLYPEPTIDE
          Length = 1083

 Score =  100 bits (250), Expect = 4e-24
 Identities = 44/462 (9%), Positives = 113/462 (24%), Gaps = 66/462 (14%)

Query: 343 KRVDYSGRSVITVGPSLRLHECGLPKKMALELFKPFVYSKLR--LGGHATTIKQAKRMVE 400
               ++  S       L   +        L+ F  FV   L+  +   +T I+ +   + 
Sbjct: 8   AEDSWAVISAFFREKGLVSQQ--------LDSFNQFVDYTLQDIICEDSTLIEISFGKIY 59

Query: 401 LEEAVVWDILETVINEHPVL-LNRAPTLHRLGIQAFEPRLIEGKAIQLHPLVCAAFNADF 459
           + + +V +        +P     R  T         + R  E   I   P++  + N   
Sbjct: 60  VTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEKVFIGRLPIMLRSKNCYL 119

Query: 460 DGDQMAVHVPLTVESQLEARVLMMSTNNILSPASGQPIITPTQDIVLGLYYITREKEGAR 519
                      T     + +               + ++   +     +  + ++     
Sbjct: 120 SE--------ATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKA---- 167

Query: 520 GEGKLFSSYEDVSRAYNSGTIDIHAKIKLRIDRQVFDTKGNTYNEKGVVNTTVGRALLLN 579
                  S+    R      ++  ++    + +     +  +                L 
Sbjct: 168 --APSPISHVAEIR----SALEKGSRFISTL-QVKLYGREGSSARTIK--------ATLP 212

Query: 580 ILPEGLSFSLLNKVLVKKEISKIINQAFRVL-GGKATVVLADKLMYAGFKYSTLSGVSVG 638
            + + +   ++ + L      +I+      +   +   +L   +          + +   
Sbjct: 213 YIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFI 272

Query: 639 VDDMTIPDNXXXXXXXXXXXXXQITEQYQSSLITENERYNNIINIWSKTSDEVGASMMDA 698
             +  I                   E        E         +               
Sbjct: 273 GKEKRIQYAKDILQ----------KEFLPHITQLEGFESRKAFFL------------GYM 310

Query: 699 ISKDTVSINGEKKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITA 758
           I++  +     K +       +   +    G           + L       M  T   A
Sbjct: 311 INRLLLCALDRKDQD--DRDHFGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVELA 368

Query: 759 -NFREGLSVLQYFTSTHGARKGLADTALKTANAGYLT--RRL 797
            N +   S L+Y  +T     G++    +   +  L+  RR 
Sbjct: 369 INAKTITSGLKYALATGNWGAGVSQVLNRYTYSSTLSHLRRT 410


>1g7dA [a.71.1.1] ENDOPLASMIC RETICULUM PROTEIN ERP29
          Length = 106

 Score = 95.7 bits (238), Expect = 1e-22
 Identities = 11/107 (10%), Positives = 29/107 (27%), Gaps = 11/107 (10%)

Query: 136 VLYFESYIVTDPGMTPLEK-KQLLTDEEYAEALENYGYEFEASMGAEAIRDLLADTD--- 191
           +  +++        +  E  + +L   +        G +      A     ++       
Sbjct: 4   LPAYDALAGQFIEASSREARQAILKQGQDGL----SGVKETDKKWASQYLKIMGKILDQG 59

Query: 192 ---IESEIELLQXXXXXXXXXXXXXXXIKRLRLLETFQASGNKPEWM 235
                SE+  +                 + L +L  F+  G + E +
Sbjct: 60  EDFPASELARISKLIENKMSEGKKEELQRSLNILTAFRKKGAEKEEL 106


>1kitA2 [b.29.1.8] SIALIDASE A:347 -- 543
          Length = 197

 Score = 90.0 bits (223), Expect = 5e-21
 Identities = 25/185 (13%), Positives = 48/185 (25%), Gaps = 27/185 (14%)

Query: 710 KKEIESFNSVYMMAKSGARGSYNQMRQLAGMRGLMAKPDGTMIETAITANFREGLSVLQY 769
             +  +   +          + NQ++   G R  +           + AN   G+S    
Sbjct: 33  DWQSNAKIRIVDG-------AANQIQVADGSRKYVVTLSIDESG-GLVANL-NGVSAPII 83

Query: 770 FTSTHGARKGLADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMF-SAIVEDGEV 828
             S H       D  L+ +   + T   VD  Q      E    ++     +    DG +
Sbjct: 84  LQSEHAKVHSFHDYELQYSALNHTTTLFVDGQQITTWAGEVSQENNIQFGNADAQIDGRL 143

Query: 829 -----KVPLVERALGRTLAADVVTEKGVVLLEAGTXXXXXXXXXXXXXGIDMIKVRSPIT 883
                 +      L    A  +   +    +E                G   IK  + ++
Sbjct: 144 HVQKIVLTQQGHNLVEFDAFYLA--QQTPEVEK----------DLEKLGWTKIKTGNTMS 191

Query: 884 CKTRR 888
                
Sbjct: 192 LYGNA 196


>2r7kA1 [c.30.1.8] 5-FORMAMINOIMIDAZOLE-4-CARBOXAMIDE-1-(BETA)-D-
           A:1 -- 123
          Length = 123

 Score = 77.5 bits (191), Expect = 3e-17
 Identities = 11/111 (9%), Positives = 28/111 (25%), Gaps = 7/111 (6%)

Query: 157 LLTDEEYAEALENYGYE--FEASMGAEAIRDLLADTDIESEIELLQXXXXXXXXXXXXXX 214
           +++ +E  E  + Y  +    A++G+     +L    +E    +                
Sbjct: 1   MISKDEILEIFDKYNKDEITIATLGSHTSLHILKGAKLEGFSTVC-ITMKGRDVPYKRFK 59

Query: 215 XIKRLRLLETFQASGN--KPEWMVMTXXXXXXXXXXXXXXIEGGRFATSDL 263
              +   ++ F    N    E +                   G     +  
Sbjct: 60  VADKFIYVDNFSDIKNEEIQEKLREL--NSIVVPHGSFIAYCGLDNVENSF 108


>1t0hB [c.37.1.1] VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
          Length = 187

 Score = 68.6 bits (167), Expect = 1e-14
 Identities = 23/105 (21%), Positives = 38/105 (36%), Gaps = 5/105 (4%)

Query: 348 SGRSVITVGPSLRLHECGLPKKMA-LELFKPFVYSKLRLGGHATTIKQAKRMVELEEAVV 406
           S R V+ VGPSL+ +E     + A  +  K     ++ +      I  AK ++E      
Sbjct: 13  SXRPVVLVGPSLKGYEVTDXXQKALFDFLKHRFEGRISITRVTADISLAKAIIERSN--T 70

Query: 407 WDILETVINEHPVLLNRAPTLHRLGIQAFEPRLIEGKAIQLHPLV 451
              L  V +E   +   A TL  + + A          +    L 
Sbjct: 71  RSSLAEVQSEIERIFELARTLQLVVLDADTI--NHPAQLSKTSLA 113


>1r3eA2 [d.265.1.2] TRNA PSEUDOURIDINE SYNTHASE B A:10 -- 237
          Length = 228

 Score = 66.3 bits (161), Expect = 7e-14
 Identities = 9/118 (7%), Positives = 36/118 (30%), Gaps = 5/118 (4%)

Query: 15  FDIIKISLASPEVIRSWSHGEVKKPETINYRTFKPERDGLFCAKIFGPIKDYECLCGKYK 74
           +D +  + ++ +      +   ++ + IN    + +   ++   I G    +        
Sbjct: 110 YDQVPPAYSAKKYKGERLYKLAREGKIINLPPKRVKIFKIWDVNIEGRDVSFRVEVSPGT 169

Query: 75  RLK-HXXXXXXXXXXXXXQAKVRRERMGHIDLVCPV----VHIWYLKSLPSRIGLFLD 127
            ++                 ++ RE +G   +   +         +++    +   L+
Sbjct: 170 YIRSLCMDIGYKLGCGATAVELVRESVGPHTIEESLNVFEAAPEEIENRIIPLEKCLE 227


>1xi8A2 [b.103.1.1] MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN A:6 --
           181
          Length = 85

 Score = 59.5 bits (144), Expect = 8e-12
 Identities = 15/86 (17%), Positives = 26/86 (30%), Gaps = 4/86 (4%)

Query: 796 RLVDVAQDLVVIEEDCGTD--DGLMFSAIVEDGEVKVPLVERALGRTLAADVVTEKGVVL 853
           RL    + L ++  D         +         +   +V          DV  +KG + 
Sbjct: 1   RLTPYEEALSIVLNDLKEIEEVEYVPLKDALGRVLAEDIVASYDLSFAGEDV--KKGDIA 58

Query: 854 LEAGTXXXXXXXXXXXXXGIDMIKVR 879
           L+ GT             GI  + V+
Sbjct: 59  LKKGTILRPQDLALLKALGIRKVPVK 84


>2nqmA2 [b.103.1.1] MOLYBDOPTERIN BIOSYNTHESIS PROTEIN MOEA A:7 --
           177
          Length = 90

 Score = 56.3 bits (136), Expect = 7e-11
 Identities = 18/99 (18%), Positives = 25/99 (25%), Gaps = 14/99 (14%)

Query: 781 ADTALKTANAGYLTRRLVDVAQDLVVIEEDCGTDDGLMFSAIVEDGEVKVPLVERALGRT 840
            DTAL       +  R+  +     +    C                V    V     R 
Sbjct: 4   LDTALNE-----MLSRVTPLTAQETLPLVQCFGRILASD-------VVSPLDVPGFDNRR 51

Query: 841 LAADVVTEKGVVLLEAGTXXXXXXXXXXXXXGIDMIKVR 879
              D+    G V+  AGT             GI  + V 
Sbjct: 52  RGEDI--SAGAVVFPAGTRLTTAELPVIASLGIAEVPVI 88


>1qwyA [b.84.3.2] PEPTIDOGLYCAN HYDROLASE
          Length = 234

 Score = 53.1 bits (126), Expect = 7e-10
 Identities = 13/71 (18%), Positives = 24/71 (33%), Gaps = 1/71 (1%)

Query: 1135 RRPKDAAILSPCDGMVRLGNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGEQVSR 1194
              P+++ + S  DG V               I +      +     +  L V  G++V  
Sbjct: 136  AMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQ-WYMHNNRLTVSAGDKVKA 194

Query: 1195 GDVLADGPTDP 1205
            GD +A   +  
Sbjct: 195  GDQIAYSGSTG 205


>1vs6W1 [b.84.4.1] 50S RIBOSOMAL PROTEIN L27 W:1 -- 84
          Length = 84

 Score = 52.8 bits (127), Expect = 8e-10
 Identities = 10/94 (10%), Positives = 24/94 (25%), Gaps = 16/94 (17%)

Query: 1077 DEKGA---KLKSIPLAVGAVLNVADDSILEVGDIVAKIPLEGSKNKDITGGLPRVAELFE 1133
             +K     +      A    +       +  G I+ +             G         
Sbjct: 2    HKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQR-----GTKFHAGA-------N 49

Query: 1134 ARRPKDAAILSPCDGMVRLGNRDTKEKQRIEIID 1167
                +D  + +  DG V+       + ++   I+
Sbjct: 50   VGCGRDHTLFAKADGKVKFE-VKGPKNRKFISIE 82


>2hgjD2 [b.40.4.5] 50S RIBOSOMAL PROTEIN L2 D:5 -- 126
          Length = 122

 Score = 46.2 bits (109), Expect = 8e-08
 Identities = 15/92 (16%), Positives = 26/92 (28%), Gaps = 8/92 (8%)

Query: 1107 IVAKIPLEGSKNKDITGGLPRVAELFEARRPKDAAILSPCDGMVRLGNRDTKEKQRIEII 1166
               +        +   GG  R+  + + +R     I       V     D     RI ++
Sbjct: 36   TGGRNNQGRITVRFRGGGHKRLYRIIDFKRWDKVGI----PAKVAAIEYDPNRSARIALL 91

Query: 1167 DKNGHIVEEILLPKSRHLVVFDGEQVSRGDVL 1198
                     I+ P      +  G+QV  G   
Sbjct: 92   HYVDGEKRYIIAPD----GLQVGQQVVAGPDA 119



 Score = 41.2 bits (96), Expect = 3e-06
 Identities = 13/61 (21%), Positives = 20/61 (32%), Gaps = 3/61 (4%)

Query: 908 GESVGVIAAQSIGEPGTQLTMRTFHTGGAASLG-ITVSDIKVKTAGKIKFKNIRTVTNKE 966
             +V   +  +  EP   L      TGG  + G ITV         K  ++ I      +
Sbjct: 11  FMTVADFSEITKTEPEKSLVKPLKKTGGRNNQGRITVRFR--GGGHKRLYRIIDFKRWDK 68

Query: 967 G 967
            
Sbjct: 69  V 69


>1cfmA2 [b.84.2.2] CYTOCHROME F A:169 -- 232
          Length = 64

 Score = 44.5 bits (105), Expect = 3e-07
 Identities = 13/63 (20%), Positives = 22/63 (34%), Gaps = 3/63 (4%)

Query: 1142 ILSPCDGMVRL--GNRDTKEKQRIEIIDKNGHIVEEILLPKSRHLVVFDGEQVSRGDVLA 1199
              +   G +       + K    + I   NG  V    +P    L+V +G+ V     L 
Sbjct: 3    YNASAAGKIVAITALSEKKGGFEVSIEKANG-EVVVDKIPAGPDLIVKEGQTVQADQPLT 61

Query: 1200 DGP 1202
            + P
Sbjct: 62   NNP 64


>1brwA3 [d.41.3.1] PROTEIN (PYRIMIDINE NUCLEOSIDE PHOSPHORYLASE) A:331
            -- 433
          Length = 103

 Score = 43.4 bits (102), Expect = 6e-07
 Identities = 11/80 (13%), Positives = 23/80 (28%), Gaps = 7/80 (8%)

Query: 1135 RRPKDAAILSPCDGMVRLGNRDTKEKQRIEIID-KNGHIVEEILLPKSRHLVVFDGEQVS 1193
            +    + + +  DG V               +        + I L     L    G++V 
Sbjct: 1    KAAYTSTVTAAADGYVAEM-AADDIGTAAMWLGAGRAKKEDVIDLAVGIVLHKKIGDRVQ 59

Query: 1194 RGDVL----ADGP-TDPHDL 1208
            +G+ L    ++ P       
Sbjct: 60   KGEALATIHSNRPDVLDVKE 79


>1v8qA [b.84.4.1] TT0826
          Length = 66

 Score = 43.1 bits (102), Expect = 7e-07
 Identities = 7/72 (9%), Positives = 22/72 (30%), Gaps = 13/72 (18%)

Query: 1095 NVADDSILEVGDIVAKIPLEGSKNKDITGGLPRVAELFEARRPKDAAILSPCDGMVRLGN 1154
               +  ++  G+I+ +      +      G             +D  + +  DG+V    
Sbjct: 5    KRYEGQVVRAGNILVRQ-----RGTRFKPGK-------NVGMGRDFTLFALVDGVVEFQ- 51

Query: 1155 RDTKEKQRIEII 1166
               +  + + + 
Sbjct: 52   DRGRLGRYVHVR 63


>2c35A1 [a.60.8.2] DNA-DIRECTED RNA POLYMERASE II 16 KDA A:14 -- 142
          Length = 128

 Score = 40.9 bits (95), Expect = 3e-06
 Identities = 14/118 (11%), Positives = 24/118 (20%), Gaps = 12/118 (10%)

Query: 162 EYAEALENYGYEF---EASMGAEAIRDLLA----DTDIESEIELLQXXXXXXXXXXXXXX 214
           E   +   +  EF   E  + +E    L      +   E E EL +              
Sbjct: 1   EEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSR 60

Query: 215 XIK---RLRLLETFQASGNK--PEWMVMTXXXXXXXXXXXXXXIEGGRFATSDLNDLY 267
                    +                +                   GRF   +L  + 
Sbjct: 61  FKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQIL 118


>1accA [f.11.1.1] ANTHRAX PROTECTIVE ANTIGEN
          Length = 665

 Score = 40.3 bits (94), Expect = 5e-06
 Identities = 11/62 (17%), Positives = 18/62 (29%), Gaps = 9/62 (14%)

Query: 498 ITPTQDIVLGLYYITREKEGAR--------GEGKLFSSYEDVSRAYNSGTIDIHAKIKLR 549
           + PT  +VLG    T     A+             + S      A N+        I + 
Sbjct: 311 VLPTTSLVLG-KNQTLATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMN 369

Query: 550 ID 551
            +
Sbjct: 370 YN 371


>1uz5A2 [b.103.1.1] 402AA LONG HYPOTHETICAL MOLYBDOPTERIN A:5 -- 180
          Length = 176

 Score = 39.0 bits (91), Expect = 1e-05
 Identities = 17/87 (19%), Positives = 28/87 (32%), Gaps = 12/87 (13%)

Query: 794 TRRLVDVAQDLVVIEEDCGTDDGLM-FSAIVEDGEVKVPLVERALGRTLAADVVTEKGVV 852
           T  ++    D V+  ED    +G +        G                 D+  EKG +
Sbjct: 99  TGAMLPGNADAVIQFEDVERVNGEILIYKPAYPGLG---------VMKKGIDI--EKGRL 147

Query: 853 LLEAGTXXXXXXXXXXXXXGIDMIKVR 879
           L++ G              GI+ +KV 
Sbjct: 148 LVKKGERLGFKQTALLSAVGINKVKVF 174


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.327    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0548    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 19,011,610
Number of extensions: 1390568
Number of successful extensions: 5303
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 5121
Number of HSP's successfully gapped: 92
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)