RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACD30919.1 ftul2 folE GIB00719CH01 "GTP cyclohydrolase I"
         (206 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1a8rA [d.96.1.1] GTP CYCLOHYDROLASE I                                 218   5e-60
1zl0A1 [c.8.10.1] HYPOTHETICAL PROTEIN PA5198 A:170 -- 307             32   8e-04

>1a8rA [d.96.1.1] GTP CYCLOHYDROLASE I
          Length = 221

 Score =  218 bits (557), Expect = 5e-60
 Identities = 85/201 (42%), Positives = 123/201 (61%), Gaps = 6/201 (2%)

Query: 9   SKLGKSVQEHLIKLGLEQPRE---FNLDNDNKITIITKAYRQILDALGL--YTDEFEKTP 63
           SK    V E L+  GLE P       +DN+ + ++I     +I+  L L    D   +TP
Sbjct: 4   SKEAALVHEALVARGLETPLRPPVHEMDNETRKSLIAGHMTEIMQLLNLDLADDSLMETP 63

Query: 64  FRVARMFTQEIFNGLDYANFPACALYENEFNYTGVLTQKNITIMSFCEHHFVPFEGTAEV 123
            R+A+M+  EIF+GLDYANFP   L EN+     ++T ++IT+ S CE HFV  +G A V
Sbjct: 64  HRIAKMYVDEIFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCESHFVTIDGKATV 123

Query: 124 SFIPKNNNIIGLCRINSICDFFSRRPQIQERMTAQIFEALKFILSTEDVSVKIKAKHACV 183
           ++IP  +++IGL +IN I  FF++RPQ+QER+T QI  AL+ +L T +V+V I A H CV
Sbjct: 124 AYIP-KDSVIGLSKINRIVQFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCV 182

Query: 184 SLRGVNNQNSQTYTQMVGGVF 204
             RG+ +  S T T  +GG+F
Sbjct: 183 KARGIRDATSATTTTSLGGLF 203


>1zl0A1 [c.8.10.1] HYPOTHETICAL PROTEIN PA5198 A:170 -- 307
          Length = 138

 Score = 31.6 bits (72), Expect = 8e-04
 Identities = 10/89 (11%), Positives = 26/89 (29%), Gaps = 17/89 (19%)

Query: 54  LYTDEFEKTPFRVARMFTQ-------EIFNGLDYANFPACALYENEFNYTGVLTQK---- 102
           L  ++  +  +R+ R   Q            +   +F  C   E   +   +  +     
Sbjct: 45  LVLEDVGEPYYRLERSLWQLLESIDARQLGAICLGSFTDCPRKEVAHSLERIFGEYAAAI 104

Query: 103 NITIMS---FC---EHHFVPFEGTAEVSF 125
            + +          ++   P+  TA +  
Sbjct: 105 EVPLYHHLPSGHGAQNRAWPYGKTAVLEG 133


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.317    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0609    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 12,416,128
Number of extensions: 857878
Number of successful extensions: 3770
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3554
Number of HSP's successfully gapped: 193
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)