RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ACD31100.1 ftul2 ACD31100.1 GIB00719CH01 "conserved
hypothetical protein"
         (248 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1nrkA2 [d.250.1.1] YGFZ PROTEIN A:1 -- 243                            127   1e-32
1pj5A4 [d.250.1.1] N,N-DIMETHYLGLYCINE OXIDASE A:428 -- 742            70   3e-15
1v5vA2 [d.250.1.1] AMINOMETHYLTRANSFERASE A:3 -- 312                   70   3e-15

>1nrkA2 [d.250.1.1] YGFZ PROTEIN A:1 -- 243
          Length = 243

 Score =  127 bits (320), Expect = 1e-32
 Identities = 53/212 (25%), Positives = 87/212 (41%), Gaps = 48/212 (22%)

Query: 13  VSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLLLSVEQE 72
           ++G D++K+ QG  TAD++  + D   LL A  + KG+  S   + F   +       + 
Sbjct: 32  ITGADSEKYXQGQVTADVSQXAEDQH-LLAAHCDAKGKXWSNLRL-FRDGDGFAWIERRS 89

Query: 73  VFENLLAWLKKYGMFSKVSFNPNDDYAL--------------FFTKTGFLNHDILTKGSL 118
           V E  L  LKKY +FSKV+  P+D+  L               F++       ++ +G+ 
Sbjct: 90  VREPQLTELKKYAVFSKVTIAPDDERVLLGVAGFQARAALANLFSELPSKEKQVVKEGAT 149

Query: 119 T---------------SEMTFEQVRKE----------------NIINKLATINAANFEKF 147
           T                E T   +  +                NI      I+AAN  +F
Sbjct: 150 TLLWFEHPAERFLIVTDEATANXLTDKLRGEAELNNSQQWLALNIEAGFPVIDAANSGQF 209

Query: 148 LPAELDLDNVDKVVCYTKGCYMGQEVIARMHY 179
           +P   +L  +   + + KGCY GQE +AR  +
Sbjct: 210 IPQATNLQALGG-ISFKKGCYTGQEXVARAKF 240


>1pj5A4 [d.250.1.1] N,N-DIMETHYLGLYCINE OXIDASE A:428 -- 742
          Length = 315

 Score = 70.1 bits (171), Expect = 3e-15
 Identities = 32/233 (13%), Positives = 57/233 (24%), Gaps = 64/233 (27%)

Query: 7   NFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLL 66
             K LEVSG    K LQ LTTADL        +  T   +  G + S   V  +S +   
Sbjct: 80  PLKRLEVSGPGALKLLQELTTADLAKK--PGAVTYTLLLDHAGGVRSDITVARLSEDTFQ 137

Query: 67  LSVEQEVFENLLAWLKKYGMFSKVSF------NPNDDYALF------------------- 101
           L     +         ++   S  +       +                           
Sbjct: 138 LGANGNIDTAYFERAARHQTQSGSATDWVQVRDTTGGTCCIGLWGPLARDLVSKVSDDDF 197

Query: 102 ---------FTKTGFLNHD-ILTKGSLTSEMTFE-----------------QVRKENIIN 134
                                  + S   E+ +E                   +   +I 
Sbjct: 198 TNDGLKYFRAKNVVIGGIPVTAMRLSYVGELGWELYTSADNGQRLWDALWQAGQPFGVIA 257

Query: 135 K-LATINAANFEKFLP---AELDLD------NVDKVVCYTKGCYMGQEVIARM 177
              A  ++   EK       ++  +       +   V   K  ++G+  +   
Sbjct: 258 AGRAAFSSLRLEKGYRSWGTDMTTEHDPFEAGLGFAVKMAKESFIGKGALEGR 310


>1v5vA2 [d.250.1.1] AMINOMETHYLTRANSFERASE A:3 -- 312
          Length = 310

 Score = 69.7 bits (170), Expect = 3e-15
 Identities = 24/115 (20%), Positives = 37/115 (32%), Gaps = 7/115 (6%)

Query: 7   NFKILEVSGVDTKKFLQGLTTADLNGLSIDNDILLTAFANLKGRIISLCFVKFISNEKLL 66
           +   +   G D  KFLQ +TT D++          T   N +G I     V  + N + L
Sbjct: 52  HMGEIVFRGKDALKFLQYVTTNDISKPP-AISGTYTLVLNERGAIKDETLVFNMGNNEYL 110

Query: 67  LSVEQEVFENLLAWLKKY------GMFSKVSFNPNDDYALFFTKTGFLNHDILTK 115
           +  + + FE L AW               +           F   G    D+   
Sbjct: 111 MICDSDAFEKLYAWFTYLKRTIEQFTKLDLEIELKTYDIAMFAVQGPKARDLAKD 165


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.318    0.137    0.388 

Gapped
Lambda     K      H
   0.267   0.0408    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 12,893,810
Number of extensions: 924113
Number of successful extensions: 3611
Number of sequences better than 1.0e-03: 8
Number of HSP's gapped: 3513
Number of HSP's successfully gapped: 108
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)