BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABD99160.1 lsal0 rpmE GIB00337CH01 "LSU ribosomal protein L31P"
         (82 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2hgu3 [x.x.x] 50S RIBOSOMAL PROTEIN L31                                52   5e-10
1yl34 [i.1.1 (1vor1)] 50S RIBOSOMAL PROTEIN L31                        49   4e-09
1vs6Z [x.x.x] 50S RIBOSOMAL PROTEIN L31                                47   1e-08
2j014 [x.x.x] 50S RIBOSOMAL PROTEIN L31                                34   1e-04

>2hgu3 [x.x.x] 50S RIBOSOMAL PROTEIN L31
          Length = 71

 Score = 52.4 bits (124), Expect = 5e-10
 Identities = 22/42 (52%), Positives = 30/42 (71%)

Query: 38 EDGNTYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYG 79
          E  +T P I VE+ S  HPFYTG+Q+F   +GRV+RF ++YG
Sbjct: 23 ETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYG 64


>1yl34 [i.1.1 (1vor1)] 50S RIBOSOMAL PROTEIN L31
          Length = 73

 Score = 49.3 bits (116), Expect = 4e-09
 Identities = 20/42 (47%), Positives = 30/42 (71%)

Query: 38 EDGNTYPLIRVEISSDSHPFYTGRQKFTQADGRVDRFNKKYG 79
          E  +T P I V++ S  HPF+TG ++F   +GRVD+FNK++G
Sbjct: 23 ETMSTRPEIHVDVWSGVHPFWTGEERFLDTEGRVDKFNKRFG 64


>1vs6Z [x.x.x] 50S RIBOSOMAL PROTEIN L31
          Length = 70

 Score = 47.4 bits (111), Expect = 1e-08
 Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 14/78 (17%)

Query: 1  MKQGIHPDYHEVVFMDSATGYKFLSGSTKNSEETIEWEDGNTYPLIRVEISSDSHPFYTG 60
          MK+ IHP Y E+    S        G+      T+  +       + +++ S  HPF+TG
Sbjct: 1  MKKDIHPKYEEITASCSC-------GNVMKIRSTVGHD-------LNLDVCSKCHPFFTG 46

Query: 61 RQKFTQADGRVDRFNKKY 78
          +Q+     GRVDRFNK++
Sbjct: 47 KQRDVATGGRVDRFNKRF 64


>2j014 [x.x.x] 50S RIBOSOMAL PROTEIN L31
          Length = 49

 Score = 34.3 bits (77), Expect = 1e-04
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 38 EDGNTYPLIRVEISSDSHPFYTGRQKF 64
          E  +T P I VE+ S  HPFYTG+Q+F
Sbjct: 23 ETYSTKPEIYVEVCSKCHPFYTGQQRF 49


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.324    0.141    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 948,335,548
Number of extensions: 39699731
Number of successful extensions: 106192
Number of sequences better than 1.0e-03: 1841
Number of HSP's gapped: 103991
Number of HSP's successfully gapped: 2172
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.1 bits)