BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABD99245.1 lsal0 ABD99245.1 GIB00337CH01 "Conserved
hypothetical protein"
         (194 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2kl5A [x.x.x] UNCHARACTERIZED PROTEIN YUTD                            106   5e-26
2oiwD [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE               35   2e-04
2oiwC [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE               35   2e-04
2oiwA [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE               35   2e-04

>2kl5A [x.x.x] UNCHARACTERIZED PROTEIN YUTD
          Length = 110

 Score =  106 bits (265), Expect = 5e-26
 Identities = 46/91 (50%), Positives = 63/91 (69%)

Query: 32  ETRIKIDGRPYDLVENYHEGFSAERLGERFSQILTKYDYIVGDWGYDQLRLRGFYEIGSK 91
           E  I I    ++LV N+ +GF+ E    R+S IL KYDYIVGDWGY QLRL+GF++  ++
Sbjct: 10  EIMILIQNAEFELVHNFKDGFNEEAFKARYSDILNKYDYIVGDWGYGQLRLKGFFDDQNQ 69

Query: 92  KGSPYQSIERLDDYLYEYCNFGCSYFILHNL 122
           K +    I  LD+Y+YEYCNFGC+YF+L  +
Sbjct: 70  KATFETKISTLDEYIYEYCNFGCAYFVLKRI 100


>2oiwD [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE
          Length = 126

 Score = 34.7 bits (78), Expect = 2e-04
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 52  FSAERLGERFSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCN 111
           F+ +   +R+  I+ + DY+   +G D     G   IG+   + Y+ I +        C 
Sbjct: 39  FTPDLSFKRWRVIIREVDYVNQYYGQDVTVYTGIERIGNTSLTIYEEIHQNG----VVCA 94

Query: 112 FGCSYFILHNLEVQTPEPIPANIR 135
            G S ++  N +   PEPIP +IR
Sbjct: 95  KGRSVYVNFNFDTGRPEPIPDDIR 118


>2oiwC [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE
          Length = 129

 Score = 34.7 bits (78), Expect = 2e-04
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 52  FSAERLGERFSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCN 111
           F+ +   +R+  I+ + DY+   +G D     G   IG+   + Y+ I +        C 
Sbjct: 39  FTPDLSFKRWRVIIREVDYVNQYYGQDVTVYTGIERIGNTSLTIYEEIHQNG----VVCA 94

Query: 112 FGCSYFILHNLEVQTPEPIPANIR 135
            G S ++  N +   PEPIP +IR
Sbjct: 95  KGRSVYVNFNFDTGRPEPIPDDIR 118


>2oiwA [x.x.x] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE
          Length = 129

 Score = 34.7 bits (78), Expect = 2e-04
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 52  FSAERLGERFSQILTKYDYIVGDWGYDQLRLRGFYEIGSKKGSPYQSIERLDDYLYEYCN 111
           F+ +   +R+  I+ + DY+   +G D     G   IG+   + Y+ I +        C 
Sbjct: 40  FTPDLSFKRWRVIIREVDYVNQYYGQDVTVYTGIERIGNTSLTIYEEIHQNG----VVCA 95

Query: 112 FGCSYFILHNLEVQTPEPIPANIR 135
            G S ++  N +   PEPIP +IR
Sbjct: 96  KGRSVYVNFNFDTGRPEPIPDDIR 119


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.136    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 774,925,059
Number of extensions: 32107663
Number of successful extensions: 86835
Number of sequences better than 1.0e-03: 2464
Number of HSP's gapped: 84405
Number of HSP's successfully gapped: 2613
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)