BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABD99438.1 lsal0 ABD99438.1 GIB00337CH01 "Signal recognition
particle associated protein"
         (112 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1s7oC [a.4.13] HYPOTHETICAL UPF0122 PROTEIN                           125   5e-32
1s7oB [a.4.13] HYPOTHETICAL UPF0122 PROTEIN                           125   5e-32
1s7oA [a.4.13] HYPOTHETICAL UPF0122 PROTEIN                           124   1e-31
1xsvA [a.4.13] HYPOTHETICAL UPF0122 PROTEIN SAV1236                    97   3e-23

>1s7oC [a.4.13] HYPOTHETICAL UPF0122 PROTEIN
          Length = 108

 Score =  125 bits (315), Expect = 5e-32
 Identities = 63/109 (57%), Positives = 83/109 (76%), Gaps = 4/109 (3%)

Query: 3   IEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKI 62
           IEKTNR+NALF+FY  LLT KQM YI LYY DDYSL EIA+ + VSRQAVYDNI+RTEKI
Sbjct: 2   IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKI 61

Query: 63  LEEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLE 111
           LE YE KLH+Y ++ ++SE  D+++ +    Y +D+ L  +I+ L S++
Sbjct: 62  LETYEMKLHMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID 106


>1s7oB [a.4.13] HYPOTHETICAL UPF0122 PROTEIN
          Length = 105

 Score =  125 bits (315), Expect = 5e-32
 Identities = 63/109 (57%), Positives = 83/109 (76%), Gaps = 4/109 (3%)

Query: 3   IEKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKI 62
           IEKTNR+NALF+FY  LLT KQM YI LYY DDYSL EIA+ + VSRQAVYDNI+RTEKI
Sbjct: 1   IEKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKI 60

Query: 63  LEEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLE 111
           LE YE KLH+Y ++ ++SE  D+++ +    Y +D+ L  +I+ L S++
Sbjct: 61  LETYEMKLHMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID 105


>1s7oA [a.4.13] HYPOTHETICAL UPF0122 PROTEIN
          Length = 106

 Score =  124 bits (311), Expect = 1e-31
 Identities = 62/108 (57%), Positives = 82/108 (75%), Gaps = 4/108 (3%)

Query: 4   EKTNRINALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKIL 63
           EKTNR+NALF+FY  LLT KQM YI LYY DDYSL EIA+ + VSRQAVYDNI+RTEKIL
Sbjct: 1   EKTNRMNALFEFYAALLTDKQMNYIELYYADDYSLAEIADEFGVSRQAVYDNIKRTEKIL 60

Query: 64  EEYESKLHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLE 111
           E YE KLH+Y ++ ++SE  D+++ +    Y +D+ L  +I+ L S++
Sbjct: 61  ETYEMKLHMYSDYVVRSEIFDDMIAH----YPHDEYLQEKISILTSID 104


>1xsvA [a.4.13] HYPOTHETICAL UPF0122 PROTEIN SAV1236
          Length = 104

 Score = 96.7 bits (239), Expect = 3e-23
 Identities = 49/102 (48%), Positives = 69/102 (67%), Gaps = 5/102 (4%)

Query: 10  NALFDFYEPLLTPKQMTYIGLYYRDDYSLGEIAENYEVSRQAVYDNIRRTEKILEEYESK 69
           N LFDFY+ LLT KQ  Y+ L+Y +DYSL EIA+ + VSRQAVYDNIRRT  ++E+YE K
Sbjct: 8   NYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKK 67

Query: 70  LHLYRNFQLQSEELDNLLKYVEENYAYDKELLTRINRLESLE 111
           L LY+ F+ + E  D      +++ +  +++   I +LE LE
Sbjct: 68  LELYQKFEQRREIYDE-----KQHLSNPEQIQRYIQQLEDLE 104


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.137    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 907,612,140
Number of extensions: 37805743
Number of successful extensions: 104184
Number of sequences better than 1.0e-03: 2130
Number of HSP's gapped: 101781
Number of HSP's successfully gapped: 2612
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.8 bits)