BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABD99824.1 lsal0 ABD99824.1 GIB00337CH01 "Conserved
hypothetical protein"
         (248 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1f5sB [c.108.1] PHOSPHOSERINE PHOSPHATASE (PSP)                        35   2e-04
1f5sA [c.108.1] PHOSPHOSERINE PHOSPHATASE (PSP)                        35   2e-04
1j97B [c.108.1] PHOSPHOSERINE PHOSPHATASE                              35   2e-04
1j97A [c.108.1] PHOSPHOSERINE PHOSPHATASE                              35   2e-04
1l7pB [c.108.1] PHOSPHOSERINE PHOSPHATASE                              33   9e-04
1l7mB [c.108.1] PHOSPHOSERINE PHOSPHATASE                              33   9e-04
1l7mA [c.108.1] PHOSPHOSERINE PHOSPHATASE                              33   9e-04

>1f5sB [c.108.1] PHOSPHOSERINE PHOSPHATASE (PSP)
          Length = 209

 Score = 35.4 bits (80), Expect = 2e-04
 Identities = 36/140 (25%), Positives = 61/140 (43%), Gaps = 18/140 (12%)

Query: 40  KDKKSFPAAIFEKIVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDF 99
           K KK         +VNNE+ +++  E    E  K +T + +   +N +            
Sbjct: 1   KKKKLILFDFDSTLVNNETIDEIAREAGVEEEVKKITKEAMEGKLNFEQS---------- 50

Query: 100 LDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQE 159
           L K V   + + IE  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +   
Sbjct: 51  LRKRVSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVN 105

Query: 160 NIK---GIDRVKLSLLIFND 176
            IK   G+D    + LI  D
Sbjct: 106 KIKEKLGLDYAFANRLIVKD 125


>1f5sA [c.108.1] PHOSPHOSERINE PHOSPHATASE (PSP)
          Length = 210

 Score = 35.4 bits (80), Expect = 2e-04
 Identities = 36/140 (25%), Positives = 61/140 (43%), Gaps = 18/140 (12%)

Query: 40  KDKKSFPAAIFEKIVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDF 99
           K KK         +VNNE+ +++  E    E  K +T + +   +N +            
Sbjct: 2   KKKKLILFDFDSTLVNNETIDEIAREAGVEEEVKKITKEAMEGKLNFEQS---------- 51

Query: 100 LDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQE 159
           L K V   + + IE  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +   
Sbjct: 52  LRKRVSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVN 106

Query: 160 NIK---GIDRVKLSLLIFND 176
            IK   G+D    + LI  D
Sbjct: 107 KIKEKLGLDYAFANRLIVKD 126


>1j97B [c.108.1] PHOSPHOSERINE PHOSPHATASE
          Length = 208

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 18/127 (14%)

Query: 53  IVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITI 112
           +VNNE+ +++  E    E  K +T + +   +N +            L K V   + + I
Sbjct: 13  LVNNETIDEIAREAGVEEEVKKITKEAMEGKLNFEQS----------LRKRVSLLKDLPI 62

Query: 113 EITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQENIK---GIDRVKL 169
           E  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +    IK   G+D    
Sbjct: 63  EKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVNKIKEKLGLDYAFA 117

Query: 170 SLLIFND 176
           + LI  D
Sbjct: 118 NRLIVKD 124


>1j97A [c.108.1] PHOSPHOSERINE PHOSPHATASE
          Length = 209

 Score = 35.0 bits (79), Expect = 2e-04
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 18/127 (14%)

Query: 53  IVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDFLDKMVEYNQQITI 112
           +VNNE+ +++  E    E  K +T + +   +N +            L K V   + + I
Sbjct: 14  LVNNETIDEIAREAGVEEEVKKITKEAMEGKLNFEQS----------LRKRVSLLKDLPI 63

Query: 113 EITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQENIK---GIDRVKL 169
           E  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +    IK   G+D    
Sbjct: 64  EKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVNKIKEKLGLDYAFA 118

Query: 170 SLLIFND 176
           + LI  D
Sbjct: 119 NRLIVKD 125


>1l7pB [c.108.1] PHOSPHOSERINE PHOSPHATASE
          Length = 208

 Score = 33.1 bits (74), Expect = 9e-04
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 40  KDKKSFPAAIFEKIVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDF 99
           K KK         +VNNE+ +++  E    E  K +T K+    +N +            
Sbjct: 2   KKKKLILFNFDSTLVNNETIDEIAREAGVEEEVKKIT-KEAEGKLNFEQS---------- 50

Query: 100 LDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQE 159
           L K V   + + IE  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +   
Sbjct: 51  LRKRVSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVN 105

Query: 160 NIK---GIDRVKLSLLIFND 176
            IK   G+D    + LI  D
Sbjct: 106 KIKEKLGLDYAFANRLIVKD 125


>1l7mB [c.108.1] PHOSPHOSERINE PHOSPHATASE
          Length = 208

 Score = 33.1 bits (74), Expect = 9e-04
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 40  KDKKSFPAAIFEKIVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDF 99
           K KK         +VNNE+ +++  E    E  K +T K+    +N +            
Sbjct: 2   KKKKLILFDFDSTLVNNETIDEIAREAGVEEEVKKIT-KEAEGKLNFEQS---------- 50

Query: 100 LDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQE 159
           L K V   + + IE  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +   
Sbjct: 51  LRKRVSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVN 105

Query: 160 NIK---GIDRVKLSLLIFND 176
            IK   G+D    + LI  D
Sbjct: 106 KIKEKLGLDYAFANRLIVKD 125


>1l7mA [c.108.1] PHOSPHOSERINE PHOSPHATASE
          Length = 207

 Score = 33.1 bits (74), Expect = 9e-04
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 19/140 (13%)

Query: 40  KDKKSFPAAIFEKIVNNESCNQMFWEWFTLEIKKVLTDKKVRVDINIDPHQFLYQSTWDF 99
           K KK         +VNNE+ +++  E    E  K +T K+    +N +            
Sbjct: 1   KKKKLILFDFDSTLVNNETIDEIAREAGVEEEVKKIT-KEAEGKLNFEQS---------- 49

Query: 100 LDKMVEYNQQITIEITERVSQELNLKKGLIDTVKHIKDLGYRVALDDISSGQYSFKVVQE 159
           L K V   + + IE  E+  + +   +G  +T+K +K+ GY VA+  +S G   F +   
Sbjct: 50  LRKRVSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYVVAV--VSGG---FDIAVN 104

Query: 160 NIK---GIDRVKLSLLIFND 176
            IK   G+D    + LI  D
Sbjct: 105 KIKEKLGLDYAFANRLIVKD 124


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.320    0.140    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 848,886,475
Number of extensions: 35945159
Number of successful extensions: 90804
Number of sequences better than 1.0e-03: 1072
Number of HSP's gapped: 90627
Number of HSP's successfully gapped: 1283
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)