BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABD99837.1 lsal0 cydC GIB00337CH01 "Transport ATP-binding
protein"
         (586 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                         150   1e-38
3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A                         150   1e-38
2hydA [x.x.x] ABC TRANSPORTER HOMOLOG                                 149   2e-38
1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA            145   4e-37
2ghiA [x.x.x] TRANSPORT PROTEIN                                       142   2e-36
2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               142   2e-36
1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN               141   4e-36
2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               141   6e-36
3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               141   6e-36
2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               140   9e-36
2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               138   4e-35
1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING               137   6e-35
2ghiC [x.x.x] TRANSPORT PROTEIN                                       125   3e-31
1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING       124   7e-31
1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING       124   7e-31
2ghiB [x.x.x] TRANSPORT PROTEIN                                       122   3e-30
2ghiD [x.x.x] TRANSPORT PROTEIN                                       119   2e-29
1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1                               116   2e-28
3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA        114   7e-28
2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           110   1e-26
2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           110   1e-26
2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           106   2e-25
1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA        103   1e-24
2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           103   2e-24
2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                           102   4e-24
2oukB [x.x.x] PROTEIN ARTP                                             97   1e-22
2oljA [x.x.x] AMINO ACID ABC TRANSPORTER                               97   1e-22
2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN             94   1e-21
2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN             94   1e-21
2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1                            93   2e-21
3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING           93   2e-21
3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1                 92   3e-21
2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                92   4e-21
2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                92   5e-21
2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                92   5e-21
1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        91   7e-21
1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        91   7e-21
2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                91   1e-20
1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   2e-20
1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               89   3e-20
1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               88   6e-20
2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                85   6e-19
2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             84   8e-19
2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN             84   8e-19
2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                84   1e-18
1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               84   1e-18
1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               84   1e-18
1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               84   1e-18
3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN               83   2e-18
2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1                83   2e-18
2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN         82   3e-18
2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                82   3e-18
2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                80   1e-17
1b0uA [c.37.1] HISTIDINE PERMEASE                                      80   2e-17
2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                79   3e-17
1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               79   4e-17
1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               79   4e-17
1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING     79   4e-17
3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          79   4e-17
2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          79   4e-17
2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          79   4e-17
1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN        78   6e-17
2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                78   6e-17
2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          77   1e-16
2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          77   1e-16
2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          77   1e-16
1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE               76   2e-16
2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE                76   2e-16
1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                 75   6e-16
1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID                 74   1e-15
1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID                 74   1e-15
1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN             72   5e-15
1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN             72   5e-15
1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           71   7e-15
1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           71   7e-15
2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          69   3e-14
2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN               67   1e-13
2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING         67   1e-13
1ji0A [c.37.1] ABC TRANSPORTER                                         67   2e-13
2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  66   2e-13
2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  66   2e-13
1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK        65   4e-13
2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         63   2e-12
2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  62   3e-12
2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING             62   4e-12
2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  62   4e-12
2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN         62   6e-12
2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     60   2e-11
2d2fA [x.x.x] SUFC PROTEIN                                             60   2e-11
2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC                  60   2e-11
1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN                    58   6e-11
2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN                     58   6e-11
2d2eA [x.x.x] SUFC PROTEIN                                             58   6e-11
1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT ATP-BIN...    57   1e-10
2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066                              57   1e-10
3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC              55   4e-10
3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC              55   4e-10
3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN                      55   4e-10
1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER                                54   1e-09
1yqtA [x.x.x] RNASE L INHIBITOR                                        53   2e-09
1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN           52   3e-09
2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          50   2e-08
2ix3A [x.x.x] ELONGATION FACTOR 3                                      49   5e-08
2iwhB [x.x.x] ELONGATION FACTOR 3A                                     49   5e-08
2ix8A [x.x.x] ELONGATION FACTOR 3A                                     44   2e-06
2iw3B [x.x.x] ELONGATION FACTOR 3A                                     44   2e-06
2iw3A [x.x.x] ELONGATION FACTOR 3A                                     44   2e-06
1ii8B [c.37.1] RAD50 ABC-ATPASE                                        40   1e-05
1f2uD [c.37.1] RAD50 ABC-ATPASE                                        40   1e-05
1f2uB [c.37.1] RAD50 ABC-ATPASE                                        40   1e-05
1f2tB [c.37.1] RAD50 ABC-ATPASE                                        40   1e-05
1us8B [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE             40   2e-05
2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          40   2e-05
2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN          40   2e-05
2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               39   4e-05
2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               39   4e-05
2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             39   4e-05
2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             39   4e-05
2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.                             39   4e-05
2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               38   9e-05
2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A                               38   9e-05

>3g60A [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score =  150 bits (378), Expect = 1e-38
 Identities = 100/329 (30%), Positives = 166/329 (50%), Gaps = 17/329 (5%)

Query: 262 FMLVVVSFIL--WGGTYLGGSNGVYTGLANWIAAFVLC-------LFPVVDAFAVIPAAS 312
           F+L+  S+ L  W GT L  S     G    +   VL          P ++AFA    A+
Sbjct: 267 FLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAA 326

Query: 313 QETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKLDNVHFRYENGSR-EILKGINLD 371
            E     D+   ++    +  + +  +  L      +  N+HF Y +    +ILKG+NL 
Sbjct: 327 YEVFKIIDNKPSIDSFSKSGHKPDNIQGNL------EFKNIHFSYPSRKEVQILKGLNLK 380

Query: 372 ISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ-ISNYIGVIHQT 430
           + SG  +A++G SG GKST   L++      +G ++I+G D+  +  + +   IGV+ Q 
Sbjct: 381 VKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQE 440

Query: 431 PYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER 490
           P LF TTI  N+R G E+ T++++ + ++     D +  LP   +T+V E G + SGG++
Sbjct: 441 PVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQK 500

Query: 491 HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMD 550
            R+A+AR L+++  I++LDE T  LD  +E  V +  ++  + +T I I H L  V   D
Sbjct: 501 QRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNAD 560

Query: 551 QVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + G I  QG+ D L +    Y KL
Sbjct: 561 VIAGFDGGVIVEQGNHDELMREKGIYFKL 589



 Score =  116 bits (290), Expect = 2e-28
 Identities = 62/227 (27%), Positives = 124/227 (54%), Gaps = 4/227 (1%)

Query: 347  DIKLDNVHFRYENG-SREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
            +++   V F Y    S  +L+G++L++  G  LA++G SG GKST+  L+        G+
Sbjct: 941  NVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGS 1000

Query: 406  ITINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATI--EQVWQVLERVG 462
            + ++G ++ ++  Q +   +G++ Q P LF+ +I  N+  G+    +  E++ +  +   
Sbjct: 1001 VFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEAN 1060

Query: 463  LKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQE 522
            +   + +LP    T V + G + SGG++ R+A+AR L++   I++LDE T  LD  +E+ 
Sbjct: 1061 IHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKV 1120

Query: 523  VISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYL 569
            V    ++  + +T I I H L  ++  D ++ I++G ++  G+   L
Sbjct: 1121 VQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQL 1167


>3g5uA [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
          Length = 1182

 Score =  150 bits (378), Expect = 1e-38
 Identities = 100/329 (30%), Positives = 166/329 (50%), Gaps = 17/329 (5%)

Query: 262 FMLVVVSFIL--WGGTYLGGSNGVYTGLANWIAAFVLC-------LFPVVDAFAVIPAAS 312
           F+L+  S+ L  W GT L  S     G    +   VL          P ++AFA    A+
Sbjct: 267 FLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAA 326

Query: 313 QETNVYKDSLVRLNRLQDNSFEEEKSEIKLIAPYDIKLDNVHFRYENGSR-EILKGINLD 371
            E     D+   ++    +  + +  +  L      +  N+HF Y +    +ILKG+NL 
Sbjct: 327 YEVFKIIDNKPSIDSFSKSGHKPDNIQGNL------EFKNIHFSYPSRKEVQILKGLNLK 380

Query: 372 ISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ-ISNYIGVIHQT 430
           + SG  +A++G SG GKST   L++      +G ++I+G D+  +  + +   IGV+ Q 
Sbjct: 381 VKSGQTVALVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQE 440

Query: 431 PYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER 490
           P LF TTI  N+R G E+ T++++ + ++     D +  LP   +T+V E G + SGG++
Sbjct: 441 PVLFATTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQK 500

Query: 491 HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHHLQGVEAMD 550
            R+A+AR L+++  I++LDE T  LD  +E  V +  ++  + +T I I H L  V   D
Sbjct: 501 QRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNAD 560

Query: 551 QVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + G I  QG+ D L +    Y KL
Sbjct: 561 VIAGFDGGVIVEQGNHDELMREKGIYFKL 589



 Score =  116 bits (290), Expect = 2e-28
 Identities = 62/227 (27%), Positives = 124/227 (54%), Gaps = 4/227 (1%)

Query: 347  DIKLDNVHFRYENG-SREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
            +++   V F Y    S  +L+G++L++  G  LA++G SG GKST+  L+        G+
Sbjct: 941  NVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGS 1000

Query: 406  ITINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATI--EQVWQVLERVG 462
            + ++G ++ ++  Q +   +G++ Q P LF+ +I  N+  G+    +  E++ +  +   
Sbjct: 1001 VFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEAN 1060

Query: 463  LKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQE 522
            +   + +LP    T V + G + SGG++ R+A+AR L++   I++LDE T  LD  +E+ 
Sbjct: 1061 IHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKV 1120

Query: 523  VISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYL 569
            V    ++  + +T I I H L  ++  D ++ I++G ++  G+   L
Sbjct: 1121 VQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQL 1167


>2hydA [x.x.x] ABC TRANSPORTER HOMOLOG
          Length = 578

 Score =  149 bits (376), Expect = 2e-38
 Identities = 85/236 (36%), Positives = 131/236 (55%), Gaps = 1/236 (0%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           I +D+V F+Y +    ILK INL I  G+ +A +G SG GKSTL NLI      T G I 
Sbjct: 340 IDIDHVSFQYNDNEAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQIL 399

Query: 408 INGIDVSK-VGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
           I+G ++   +   + N IG++ Q   LF+ T+  N+ +G   AT E+V +  +     D 
Sbjct: 400 IDGHNIKDFLTGSLRNQIGLVQQDNILFSDTVKENILLGRPTATDEEVVEAAKMANAHDF 459

Query: 467 VKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISI 526
           +  LPQG +T V E G++ SGG++ R+++ARI L + PI+ILDE T  LD  +E  +   
Sbjct: 460 IMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEA 519

Query: 527 FNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAI 582
            +   KD+T + + H L  +   D+++ IE+G I   G+   L      Y+ L +I
Sbjct: 520 LDVLSKDRTTLIVAHRLSTITHADKIVVIENGHIVETGTHRELIAKQGAYEHLYSI 575



 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 31/130 (23%), Positives = 57/130 (43%), Gaps = 8/130 (6%)

Query: 20  FLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLI-----SRSATRPENI--LLVYVPIVL 72
           F+K YK  +   I +GI+ F     +     Y I     + + T  E +  L + + I L
Sbjct: 8   FVKPYKYRIFATIIVGIIKFGIPMLIPLLIKYAIDGVINNHALTTDEKVHHLTIAIGIAL 67

Query: 73  TRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKALEKDAVFFKSKYQLGDVLGLLSE 132
              F + RP   ++ +  +     K+  D+R KLY  L+  +  F +  Q+G V+  +  
Sbjct: 68  F-IFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISRVIN 126

Query: 133 DINHIQNLYL 142
           D+   ++  L
Sbjct: 127 DVEQTKDFIL 136


>1pf4A [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
          Length = 520

 Score =  145 bits (365), Expect = 4e-37
 Identities = 77/220 (35%), Positives = 129/220 (58%), Gaps = 2/220 (0%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ + +V F Y+   +  L  ++  I  G  +A++GRSGSGKST+ANL         G+I
Sbjct: 297 EVDVKDVTFTYQGKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSI 356

Query: 407 TINGIDVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNE-EATIEQVWQVLERVGLK 464
            ++G DV       +  +  ++ Q  +LFN TI NN+    E E T EQ+ Q   +    
Sbjct: 357 CLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAM 416

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           + ++ +PQGL+T++ E G   SGG+R R+A+AR LL+DAP++ILDE T  LD  +E+ + 
Sbjct: 417 EFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQ 476

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
           +  +   K+KT++ I H L  +E  D+++ +++G I  +G
Sbjct: 477 AALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERG 516


>2ghiA [x.x.x] TRANSPORT PROTEIN
          Length = 255

 Score =  142 bits (359), Expect = 2e-36
 Identities = 91/241 (37%), Positives = 134/241 (55%), Gaps = 3/241 (1%)

Query: 347 DIKLDNVHFRY-ENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +I+  +V+F Y +  +   LK IN  I SG   A++G +GSGKST+A L+     A EG 
Sbjct: 16  NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGD 74

Query: 406 ITINGIDVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           I I G +V+K   + I + IG++ Q   LFN TI  N+  G  +AT E+V +  +   L 
Sbjct: 75  IKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLY 134

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D ++ALP+  +T+V   GM+ SGGER R+A+AR LLKD  I+I DE T  LD  TE    
Sbjct: 135 DFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQ 194

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAIDE 584
                  K++TLI I H L  + + + +I +  G I  +G+   L K N  Y ++  +  
Sbjct: 195 KAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEMWNMQS 254

Query: 585 G 585
           G
Sbjct: 255 G 255


>2ff7A [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  142 bits (358), Expect = 2e-36
 Identities = 80/220 (36%), Positives = 124/220 (56%), Gaps = 1/220 (0%)

Query: 346 YDIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +DI   N+ FRY+  S  IL  INL I  G+ + I+GRSGSGKSTL  LI+   +   G 
Sbjct: 2   HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ 61

Query: 406 ITINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           + I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  
Sbjct: 62  VLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 121

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I DE T  LD  +E  ++
Sbjct: 122 DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIM 181

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
              ++  K +T+I I H L  V+  D++I +E G I  QG
Sbjct: 182 RNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQG 221


>1mt0A [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
          Length = 241

 Score =  141 bits (356), Expect = 4e-36
 Identities = 80/219 (36%), Positives = 123/219 (56%), Gaps = 1/219 (0%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           DI   N+ FRY+  S  IL  INL I  G+ + I+GRSGSGKSTL  LI+   +   G +
Sbjct: 1   DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQV 60

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
            I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  D
Sbjct: 61  LIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHD 120

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
            +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I DE T  LD  +E  ++ 
Sbjct: 121 FISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR 180

Query: 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
             ++  K +T+I I H L  V+  D++I +E G I  QG
Sbjct: 181 NMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQG 219


>2ffbA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  141 bits (355), Expect = 6e-36
 Identities = 79/220 (35%), Positives = 124/220 (56%), Gaps = 1/220 (0%)

Query: 346 YDIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +DI   N+ FRY+  S  IL  INL I  G+ + I+GRSGSGKSTL  LI+   +   G 
Sbjct: 2   HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ 61

Query: 406 ITINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           + I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  
Sbjct: 62  VLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 121

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I D+ T  LD  +E  ++
Sbjct: 122 DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIM 181

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
              ++  K +T+I I H L  V+  D++I +E G I  QG
Sbjct: 182 RNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQG 221


>3b5jA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  141 bits (355), Expect = 6e-36
 Identities = 79/220 (35%), Positives = 124/220 (56%), Gaps = 1/220 (0%)

Query: 346 YDIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +DI   N+ FRY+  S  IL  INL I  G+ + I+GR+GSGKSTL  LI+   +   G 
Sbjct: 2   HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQ 61

Query: 406 ITINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           + I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  
Sbjct: 62  VLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 121

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I DE T  LD  +E  ++
Sbjct: 122 DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIM 181

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
              ++  K +T+I I H L  V+  D++I +E G I  QG
Sbjct: 182 RNMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQG 221


>2fgkA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score =  140 bits (353), Expect = 9e-36
 Identities = 79/219 (36%), Positives = 123/219 (56%), Gaps = 1/219 (0%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           DI   N+ FRY+  S  IL  INL I  G+ + I+GRSGSGKSTL  LI+   +   G +
Sbjct: 1   DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQV 60

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
            I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  D
Sbjct: 61  LIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHD 120

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
            +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I D+ T  LD  +E  ++ 
Sbjct: 121 FISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMR 180

Query: 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
             ++  K +T+I I H L  V+  D++I +E G I  QG
Sbjct: 181 NMHKICKGRTVIIIAHRLSTVKNADRIIVMEKGKIVEQG 219


>2ffaA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 243

 Score =  138 bits (348), Expect = 4e-35
 Identities = 79/220 (35%), Positives = 123/220 (55%), Gaps = 1/220 (0%)

Query: 346 YDIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +DI   N+ FRY+  S  IL  INL I  G+ + I+GRSGSGKSTL  LI+   +   G 
Sbjct: 2   HDITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQ 61

Query: 406 ITINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           + I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  
Sbjct: 62  VLIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAH 121

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I DE T  LD  +E  ++
Sbjct: 122 DFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIM 181

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
              ++  K +T+I I   L  V+  D++I +E G I  QG
Sbjct: 182 RNMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQG 221


>1xefA [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
          Length = 241

 Score =  137 bits (346), Expect = 6e-35
 Identities = 79/219 (36%), Positives = 122/219 (55%), Gaps = 1/219 (0%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           DI   N+ FRY+  S  IL  INL I  G+ + I+GRSGSGKSTL  LI+   +   G +
Sbjct: 1   DITFRNIRFRYKPDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQV 60

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
            I+G D++      +   +GV+ Q   L N +I++N+ + N   ++E+V    +  G  D
Sbjct: 61  LIDGHDLALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHD 120

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
            +  L +G  T+V E G   SGG+R R+A+AR L+ +  I+I DE T  LD  +E  ++ 
Sbjct: 121 FISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR 180

Query: 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG 564
             ++  K +T+I I   L  V+  D++I +E G I  QG
Sbjct: 181 NMHKICKGRTVIIIAARLSTVKNADRIIVMEKGKIVEQG 219


>2ghiC [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score =  125 bits (314), Expect = 3e-31
 Identities = 88/235 (37%), Positives = 130/235 (55%), Gaps = 8/235 (3%)

Query: 347 DIKLDNVHFRY-ENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +I+  +V+F Y +  +   LK IN  I SG   A++G +GSGKST+A L+     A EG 
Sbjct: 16  NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGD 74

Query: 406 ITINGIDVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           I I G +V+K   + I + IG++ Q   LFN TI  N+  G  +AT E+V +  +   L 
Sbjct: 75  IKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDAT-EEVIKATKSAQLY 133

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D ++ALP+  +T+V   GM+   GER R+A+AR LLKD  I+I DE T  LD  TE    
Sbjct: 134 DFIEALPKKWDTIV--GGMKL--GERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQ 189

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
                  K++TLI I H L  + + + +I +  G I  +G+   L K N  Y ++
Sbjct: 190 KAVEDLRKNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEM 244


>1mv5D [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 241

 Score =  124 bits (311), Expect = 7e-31
 Identities = 78/229 (34%), Positives = 121/229 (52%), Gaps = 3/229 (1%)

Query: 352 NVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGI 411
           +V F Y++ S +IL+ I+ +      +A  G SG GKST+ +L+      T G ITI+G 
Sbjct: 6   HVDFAYDD-SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQ 64

Query: 412 DVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNE-EATIEQVWQVLERVGLKDMVKA 469
            +  +  +   + IG + Q   +   TI  NL  G E + T E +WQVL+    +  V+ 
Sbjct: 65  PIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVEN 124

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNR 529
           +P  L T V E G++ SGG+R R+A+AR  L++  I++LDE T  LD  +E  V    + 
Sbjct: 125 MPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDS 184

Query: 530 ELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQK 578
            +K +T + I H L  +   D++ FIE G I   G  + L  T+  Y K
Sbjct: 185 LMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAK 233


>1mv5A [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
          Length = 242

 Score =  124 bits (311), Expect = 7e-31
 Identities = 78/229 (34%), Positives = 121/229 (52%), Gaps = 3/229 (1%)

Query: 352 NVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGI 411
           +V F Y++ S +IL+ I+ +      +A  G SG GKST+ +L+      T G ITI+G 
Sbjct: 6   HVDFAYDD-SEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQ 64

Query: 412 DVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNE-EATIEQVWQVLERVGLKDMVKA 469
            +  +  +   + IG + Q   +   TI  NL  G E + T E +WQVL+    +  V+ 
Sbjct: 65  PIDNISLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVEN 124

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNR 529
           +P  L T V E G++ SGG+R R+A+AR  L++  I++LDE T  LD  +E  V    + 
Sbjct: 125 MPDQLNTEVGERGVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDS 184

Query: 530 ELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQK 578
            +K +T + I H L  +   D++ FIE G I   G  + L  T+  Y K
Sbjct: 185 LMKGRTTLVIAHRLSTIVDADKIYFIEKGQITGSGKHNELVATHPLYAK 233


>2ghiB [x.x.x] TRANSPORT PROTEIN
          Length = 248

 Score =  122 bits (306), Expect = 3e-30
 Identities = 87/235 (37%), Positives = 130/235 (55%), Gaps = 8/235 (3%)

Query: 347 DIKLDNVHFRY-ENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           +I+  +V+F Y +  +   LK IN  I SG   A++G +GSGKST+A L+     A EG 
Sbjct: 16  NIEFSDVNFSYPKQTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGD 74

Query: 406 ITINGIDVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
           I I G +V+K   + I + IG++ Q   LFN TI  N+  G  +AT E+V +  +   L 
Sbjct: 75  IKIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLY 134

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D ++ALP+  +T+V    M+ SGGER R+A+AR LLKD  I+I DE T   D  TE    
Sbjct: 135 DFIEALPKKWDTIVGNK-MKLSGGERQRIAIARCLLKDPKIVIFDEAT--SDSKTEYLFQ 191

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
                  K++TLI I H  + + + + +I +  G I  +G+   L K N  Y ++
Sbjct: 192 KAVEDLRKNRTLIIIAH--RTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEM 244


>2ghiD [x.x.x] TRANSPORT PROTEIN
          Length = 224

 Score =  119 bits (298), Expect = 2e-29
 Identities = 86/235 (36%), Positives = 128/235 (54%), Gaps = 23/235 (9%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +I+  +V+F Y       LK IN  I SG   A++G +GSGKST+A L+     A EG I
Sbjct: 7   NIEFSDVNFSYHR----TLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDA-EGDI 61

Query: 407 TINGIDVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
            I G +V+K   + I + IG++ Q   LFN TI  N+  G  +AT E+V +  +   L D
Sbjct: 62  KIGGKNVNKYNRNSIRSIIGIVPQDTILFNETIKYNILYGKLDATDEEVIKATKSAQLYD 121

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
            ++ALP+  +T+V       SGGER R+A+AR LLKD  I+I D      D  TE     
Sbjct: 122 FIEALPKKWDTIV------LSGGERQRIAIARCLLKDPKIVIFD------DSKTEY---- 165

Query: 526 IFNRELKD-KTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
           +F + ++D +TLI I H L  + + + +I +  G I  +G+   L K N  Y ++
Sbjct: 166 LFQKAVEDNRTLIIIAHRLSTISSAESIILLNKGKIVEKGTHKDLLKLNGEYAEM 220


>1jj7A [c.37.1] PEPTIDE TRANSPORTER TAP1
          Length = 251

 Score =  116 bits (290), Expect = 2e-28
 Identities = 69/234 (29%), Positives = 126/234 (53%), Gaps = 5/234 (2%)

Query: 348 IKLDNVHFRYENGSRE-ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++  +V F Y N     +L+G+   +  G+  A++G +GSGKST+A L++     T G +
Sbjct: 12  VQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQL 71

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLK 464
            ++G  + +   + +   +  + Q P +F  ++  N+  G  ++ T+E++     + G  
Sbjct: 72  LLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAH 131

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
             +  LPQG +T VDEAG + SGG+R  +ALAR L++   ++ILD+ T  LD  ++ +V 
Sbjct: 132 SFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVE 191

Query: 525 SIF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERY 576
            +   + E   ++++ IT HL  VE  D ++F+E G I   G+   L +    Y
Sbjct: 192 QLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCY 245


>3b60A [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 572

 Score =  114 bits (285), Expect = 7e-28
 Identities = 84/307 (27%), Positives = 147/307 (47%), Gaps = 11/307 (3%)

Query: 246 KLHHFDQIRDYLLQLVFMLVVVSFILWGGTYLGGSNGVYTGLANWIAAFVLCLFPVVDAF 305
           K+     I D ++QL+  L + +F+L+  ++    + +  G    + + ++ L   + + 
Sbjct: 234 KMVSASSISDPIIQLIASLAL-AFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKSL 292

Query: 306 AVIPAASQETNVYKDSLVRLNRLQDNSFEEEKSEIKLI---APYDIKLDNVHFRYENGSR 362
             + A  Q       +L  +        E+EK E K +   A  D++  NV F Y     
Sbjct: 293 TNVNAQFQRGMAACQTLFAIL-----DSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREV 347

Query: 363 EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVG-DQIS 421
             L+ INL I +G  +A++GRSGSGKST+A+LI       EG I ++G D+ +     + 
Sbjct: 348 PALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLR 407

Query: 422 NYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLKDMVKALPQGLETMVDE 480
           N + ++ Q  +LFN T+ NN+     EE + EQ+ +        D +  +  GL+T++ E
Sbjct: 408 NQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGE 467

Query: 481 AGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWIT 540
            G+  S               D+PI+ILDE T  LD  +E+ + +  +   K++T + I 
Sbjct: 468 NGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIA 527

Query: 541 HHLQGVE 547
           H L  +E
Sbjct: 528 HRLSTIE 534


>2ixfC [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 252

 Score =  110 bits (275), Expect = 1e-26
 Identities = 68/237 (28%), Positives = 121/237 (51%), Gaps = 5/237 (2%)

Query: 348 IKLDNVHFRYENGSR-EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K  +V F Y N    ++L+G+   +  G   A++G +GSGKST+A L++     T G +
Sbjct: 12  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 71

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLK 464
            ++G  + +     +   +  + Q P LF  +   N+  G     T+E++  V    G  
Sbjct: 72  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +   PQG +T V E G + SGG+R  +ALAR L++   ++ILD+ T  LD   +  V 
Sbjct: 132 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 191

Query: 525 SIF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + E   +T++ ITH L   E    ++F+++G++  QG+   L +    Y+ +
Sbjct: 192 RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 248


>2ixfA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 255

 Score =  110 bits (275), Expect = 1e-26
 Identities = 68/237 (28%), Positives = 121/237 (51%), Gaps = 5/237 (2%)

Query: 348 IKLDNVHFRYENGSR-EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K  +V F Y N    ++L+G+   +  G   A++G +GSGKST+A L++     T G +
Sbjct: 16  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 75

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLK 464
            ++G  + +     +   +  + Q P LF  +   N+  G     T+E++  V    G  
Sbjct: 76  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 135

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +   PQG +T V E G + SGG+R  +ALAR L++   ++ILD+ T  LD   +  V 
Sbjct: 136 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 195

Query: 525 SIF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + E   +T++ ITH L   E    ++F+++G++  QG+   L +    Y+ +
Sbjct: 196 RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 252


>2ixeA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 251

 Score =  106 bits (265), Expect = 2e-25
 Identities = 67/237 (28%), Positives = 119/237 (50%), Gaps = 5/237 (2%)

Query: 348 IKLDNVHFRYENGSR-EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K  +V F Y N    ++L+G+   +  G   A++G +GSGKST+A L++     T G +
Sbjct: 12  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 71

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLK 464
            ++G  + +     +   +  + Q P LF  +   N+  G     T+E++  V    G  
Sbjct: 72  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 131

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +   PQG +T V E G + SGG+R  +ALAR L++   ++ILD  T  LD   +  V 
Sbjct: 132 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 191

Query: 525 SIF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + E   +T++ IT  L   E    ++F+++G++  QG+   L +    Y+ +
Sbjct: 192 RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 248


>1z2rA [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
          Length = 496

 Score =  103 bits (258), Expect = 1e-24
 Identities = 64/198 (32%), Positives = 102/198 (51%), Gaps = 2/198 (1%)

Query: 352 NVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGI 411
           NV F Y       L+ INL I +G  +A++GRSGSGKST+A+LI       EG I ++G 
Sbjct: 280 NVTFTYPGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGH 339

Query: 412 DVSKVG-DQISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLKDMVKA 469
           D+ +     + N + ++ Q  +LFN T+ NN+     EE + EQ+ +        D +  
Sbjct: 340 DLREYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINK 399

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNR 529
           +  GL+T++ E G+  S               D+PI+ILDE T  LD  +E+ + +  + 
Sbjct: 400 MDNGLDTIIGENGVLLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDE 459

Query: 530 ELKDKTLIWITHHLQGVE 547
             K++T + I H L  +E
Sbjct: 460 LQKNRTSLVIAHRLSTIE 477


>2ixfD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 250

 Score =  103 bits (256), Expect = 2e-24
 Identities = 67/237 (28%), Positives = 120/237 (50%), Gaps = 7/237 (2%)

Query: 348 IKLDNVHFRYENGSR-EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K  +V F Y N    ++L+G+   +  G   A++G +GSGKST+A L++     T G +
Sbjct: 13  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 72

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLK 464
            ++G  + +     +   +  + Q   LF  +   N+  G     T+E++  V    G  
Sbjct: 73  LLDGEPLVQYDHHYLHTQVAAVGQL--LFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 130

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +   PQG +T V E G + SGG+R  +ALAR L++   ++ILD+ T  LD   +  V 
Sbjct: 131 DFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQ 190

Query: 525 SIF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + E   +T++ ITH L   E    ++F+++G++  QG+   L +    Y+ +
Sbjct: 191 RLLYESPEWASRTVLLITHQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 247


>2ixgA [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 254

 Score =  102 bits (253), Expect = 4e-24
 Identities = 65/237 (27%), Positives = 118/237 (49%), Gaps = 5/237 (2%)

Query: 348 IKLDNVHFRYENGSR-EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K  +V F Y N    ++L+G+   +  G   A++G +GSGKST+A L++     T G +
Sbjct: 14  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 73

Query: 407 TINGIDVSKVGDQ-ISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLK 464
            ++G  + +     +   +  + Q P LF  +   N+  G     T+E++  V    G  
Sbjct: 74  LLDGEPLVQYDHHYLHTQVAAVGQEPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAH 133

Query: 465 DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI 524
           D +   PQG +T V E G + + G+R  +ALAR L++   ++ILD  T  LD   +  V 
Sbjct: 134 DFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQ 193

Query: 525 SIF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
            +   + E   +T++ IT  L   E    ++F+++G++  QG+   L +    Y+ +
Sbjct: 194 RLLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 250


>2oukB [x.x.x] PROTEIN ARTP
          Length = 241

 Score = 97.1 bits (240), Expect = 1e-22
 Identities = 73/231 (31%), Positives = 116/231 (50%), Gaps = 26/231 (11%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLA---NLIRGDRVATEGAITINGIDVSKV 416
           GS E+LKGIN+ I  G+ + ++G SGSGKST     NL+             N       
Sbjct: 13  GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDTN 72

Query: 417 GDQISNYIGVIHQTPYLF-NTTILNNLRIGN-------EEATIEQVWQVLERVGLKDMVK 468
            +++   +G++ Q   LF + T+LNN+ +          E    +  ++L++VGLKD   
Sbjct: 73  LNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAH 132

Query: 469 ALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           A P  L           SGG+  R+A+AR L  +  I++ DEPT  LDP    EV+S+  
Sbjct: 133 AYPDSL-----------SGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK 181

Query: 529 RELKD-KTLIWITHHLQ-GVEAMDQVIFIEDGTIEMQGSPDYL--RKTNER 575
           +   +  T++ +TH +    E  D+V+F++ G I  +G P+ L  R  +ER
Sbjct: 182 QLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQHER 232


>2oljA [x.x.x] AMINO ACID ABC TRANSPORTER
          Length = 242

 Score = 97.1 bits (240), Expect = 1e-22
 Identities = 73/231 (31%), Positives = 116/231 (50%), Gaps = 26/231 (11%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLA---NLIRGDRVATEGAITINGIDVSKV 416
           GS E+LKGIN+ I  G+ + ++G SGSGKST     NL+             N       
Sbjct: 14  GSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDFXXXXXXXXXXNLKAKDTN 73

Query: 417 GDQISNYIGVIHQTPYLF-NTTILNNLRIGN-------EEATIEQVWQVLERVGLKDMVK 468
            +++   +G++ Q   LF + T+LNN+ +          E    +  ++L++VGLKD   
Sbjct: 74  LNKVREEVGMVFQRFNLFPHMTVLNNITLAPMKVRKWPREKAEAKAMELLDKVGLKDKAH 133

Query: 469 ALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           A P  L           SGG+  R+A+AR L  +  I++ DEPT  LDP    EV+S+  
Sbjct: 134 AYPDSL-----------SGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK 182

Query: 529 RELKD-KTLIWITHHLQ-GVEAMDQVIFIEDGTIEMQGSPDYL--RKTNER 575
           +   +  T++ +TH +    E  D+V+F++ G I  +G P+ L  R  +ER
Sbjct: 183 QLANEGMTMVVVTHEMGFAREVGDRVLFMDGGYIIEEGKPEDLFDRPQHER 233


>2it1B [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 361

 Score = 93.6 bits (231), Expect = 1e-21
 Identities = 71/225 (31%), Positives = 118/225 (52%), Gaps = 12/225 (5%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +IKL+N+  ++  G+   L  INL I  G+ +A+LG SGSGKSTL   I G    T G I
Sbjct: 2   EIKLENIVKKF--GNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKI 59

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
             +  DV+++  +  N +G++ Q   L+ + T+  N+    E     +     E +  K 
Sbjct: 60  YFDEKDVTELPPKDRN-VGLVFQNWALYPHMTVYKNIAFPLELRKAPR-----EEIDKKV 113

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
              A    ++ +++    + SGG++ R+A+AR L+K+  +++LDEP   LD L   EV +
Sbjct: 114 REVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRA 173

Query: 526 IFNRELKDK--TLIWITHHLQGVEAM-DQVIFIEDGTIEMQGSPD 567
              R  K+   T +++TH      AM D++  I +G I   G+PD
Sbjct: 174 ELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPD 218


>2it1A [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
          Length = 362

 Score = 93.6 bits (231), Expect = 1e-21
 Identities = 71/225 (31%), Positives = 118/225 (52%), Gaps = 12/225 (5%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +IKL+N+  ++  G+   L  INL I  G+ +A+LG SGSGKSTL   I G    T G I
Sbjct: 3   EIKLENIVKKF--GNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKI 60

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
             +  DV+++  +  N +G++ Q   L+ + T+  N+    E     +     E +  K 
Sbjct: 61  YFDEKDVTELPPKDRN-VGLVFQNWALYPHMTVYKNIAFPLELRKAPR-----EEIDKKV 114

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
              A    ++ +++    + SGG++ R+A+AR L+K+  +++LDEP   LD L   EV +
Sbjct: 115 REVAKMLHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRA 174

Query: 526 IFNRELKDK--TLIWITHHLQGVEAM-DQVIFIEDGTIEMQGSPD 567
              R  K+   T +++TH      AM D++  I +G I   G+PD
Sbjct: 175 ELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPD 219


>2ixeD [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
          Length = 248

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 66/236 (27%), Positives = 116/236 (49%), Gaps = 10/236 (4%)

Query: 348 IKLDNVHFRYENGSR-EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K  +V F Y N    ++L+G+   +  G   A++G +GSGKST+A L++     T G +
Sbjct: 14  VKFQDVSFAYPNHPNVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKV 73

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIG-NEEATIEQVWQVLERVGLKD 465
            ++G  + +  D    +  V    P LF  +   N+  G     T+E++  V    G  D
Sbjct: 74  LLDGEPLVQY-DHHYLHTQVAAVGPLLFGRSFRENIAYGLTRTPTMEEITAVAMESGAHD 132

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
            +   PQG +T V     + SGG+R  +ALAR L++   ++ILD  T  LD   +  V  
Sbjct: 133 FISGFPQGYDTEV-----QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQR 187

Query: 526 IF--NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKL 579
           +   + E   +T++ IT  L   E    ++F+++G++  QG+   L +    Y+ +
Sbjct: 188 LLYESPEWASRTVLLITQQLSLAERAHHILFLKEGSVCEQGTHLQLMERGGCYRSM 243


>3d31A [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
          Length = 348

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 67/225 (29%), Positives = 122/225 (54%), Gaps = 18/225 (8%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           I+++++  +++N S   L  ++L + SG+   ILG +G+GK+    LI G  V   G I 
Sbjct: 2   IEIESLSRKWKNFS---LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRIL 58

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
           ++G DV+ +  +  + I  ++Q   LF +  +  NL  G     I+   +VL+    +D+
Sbjct: 59  LDGKDVTDLSPE-KHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTA--RDL 115

Query: 467 VKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQ---EV 523
                  +E ++D   +  SGGE+ R+ALAR L+ +  I++LDEP   LDP T++   E+
Sbjct: 116 K------IEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREM 169

Query: 524 ISIFNRELKDKTLIWITHHLQGVEAM-DQVIFIEDGTIEMQGSPD 567
           +S+ +++ K  T++ ITH       M D++  + DG +   G P+
Sbjct: 170 LSVLHKKNK-LTVLHITHDQTEARIMADRIAVVMDGKLIQVGKPE 213


>3gfoA [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
          Length = 251

 Score = 92.4 bits (228), Expect = 3e-21
 Identities = 71/250 (28%), Positives = 128/250 (51%), Gaps = 23/250 (9%)

Query: 346 YDIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           Y +K++ +++ Y +G+   LKGIN++I  G+  AILG +G GKSTL     G    + G 
Sbjct: 3   YILKVEELNYNYSDGTHA-LKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGR 61

Query: 406 ITING--IDVSKVGD-QISNYIGVIHQTP--YLFNTTILNNLRIGNEEATIEQVWQVLER 460
           I  +   ID S+ G  ++   IG++ Q P   LF+ ++  ++  G     + +  ++ +R
Sbjct: 62  ILFDNKPIDYSRKGIMKLRESIGIVFQDPDNQLFSASVYQDVSFGAVNMKLPED-EIRKR 120

Query: 461 VGLKDMVKALPQ-GLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLT 519
           V       AL + G+E + D+     S G++ R+A+A +L+ +  ++ILDEPT GLDP+ 
Sbjct: 121 VD-----NALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMG 175

Query: 520 EQEVISI---FNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSP-------DYL 569
             E++ +     +EL                  D V  +++G + +QG+P       + +
Sbjct: 176 VSEIMKLLVEMQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEVFAEKEVI 235

Query: 570 RKTNERYQKL 579
           RK N R  ++
Sbjct: 236 RKVNLRLPRI 245


>2pzgA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 223

 Score = 92.0 bits (227), Expect = 4e-21
 Identities = 64/232 (27%), Positives = 116/232 (50%), Gaps = 20/232 (8%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ ++NV   +E G   +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I
Sbjct: 2   EVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI 61

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
             +G             I    Q  ++   TI  N+  G       +   V++   L++ 
Sbjct: 62  KHSG------------RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEED 108

Query: 467 VKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-S 525
           +    +    ++ E G+  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S
Sbjct: 109 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 168

Query: 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQG------SPDYLRK 571
              + + +KT I +T  ++ ++  D+++ + +G+    G      +PD+  K
Sbjct: 169 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNPDFSSK 220


>2pzeB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 219

 Score = 91.7 bits (226), Expect = 5e-21
 Identities = 61/220 (27%), Positives = 112/220 (50%), Gaps = 14/220 (6%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ ++NV   +E G   +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I
Sbjct: 3   EVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI 62

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
             +G             I    Q  ++   TI  N+  G       +   V++   L++ 
Sbjct: 63  KHSG------------RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEED 109

Query: 467 VKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-S 525
           +    +    ++ E G+  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S
Sbjct: 110 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 169

Query: 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS 565
              + + +KT I +T  ++ ++  D+++ + +G+    G+
Sbjct: 170 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGT 209


>2pzeA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 226

 Score = 91.7 bits (226), Expect = 5e-21
 Identities = 61/220 (27%), Positives = 112/220 (50%), Gaps = 14/220 (6%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ ++NV   +E G   +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I
Sbjct: 6   EVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI 65

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
             +G             I    Q  ++   TI  N+  G       +   V++   L++ 
Sbjct: 66  KHSG------------RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEED 112

Query: 467 VKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-S 525
           +    +    ++ E G+  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S
Sbjct: 113 ISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFES 172

Query: 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS 565
              + + +KT I +T  ++ ++  D+++ + +G+    G+
Sbjct: 173 CVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGT 212


>1l2tB [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 232

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 65/226 (28%), Positives = 116/226 (51%), Gaps = 11/226 (4%)

Query: 348 IKLDNVHFRYENGSREI--LKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           IKL NV   Y+ G   I  LK +NL+I  G+ ++I+G SGSGKST+ N+I      TEG 
Sbjct: 2   IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGE 61

Query: 406 ITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
           + I+ I  + + D     I    +  ++F    L  L    E   +  +++    +  ++
Sbjct: 62  VYIDNIKTNDLDDDELTKIR-RDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEE 120

Query: 466 MVKALPQGL------ETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLT 519
             K   + L      E   +    + SGG++ R+A+AR L  + PII+ D+PT  LD  T
Sbjct: 121 RRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKT 180

Query: 520 EQEVISIFNR--ELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQ 563
            ++++ +  +  E   KT++ +TH +      +++I+++DG +E +
Sbjct: 181 GEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVERE 226


>1l2tA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 230

 Score = 91.3 bits (225), Expect = 7e-21
 Identities = 65/226 (28%), Positives = 116/226 (51%), Gaps = 11/226 (4%)

Query: 348 IKLDNVHFRYENGSREI--LKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           IKL NV   Y+ G   I  LK +NL+I  G+ ++I+G SGSGKST+ N+I      TEG 
Sbjct: 2   IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGE 61

Query: 406 ITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
           + I+ I  + + D     I    +  ++F    L  L    E   +  +++    +  ++
Sbjct: 62  VYIDNIKTNDLDDDELTKIR-RDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSGEE 120

Query: 466 MVKALPQGL------ETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLT 519
             K   + L      E   +    + SGG++ R+A+AR L  + PII+ D+PT  LD  T
Sbjct: 121 RRKRALECLKMAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKT 180

Query: 520 EQEVISIFNR--ELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQ 563
            ++++ +  +  E   KT++ +TH +      +++I+++DG +E +
Sbjct: 181 GEKIMQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVERE 226


>2pzfB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 216

 Score = 90.5 bits (223), Expect = 1e-20
 Identities = 61/221 (27%), Positives = 113/221 (51%), Gaps = 17/221 (7%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ ++NV   +E G   +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I
Sbjct: 4   EVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI 63

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNL-RIGNEEATIEQVWQVLERVGLKD 465
             +G             I    Q  ++   TI  N+  +  +E     V +  +   L++
Sbjct: 64  KHSG------------RISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQ---LEE 108

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI- 524
            +    +    ++ E G+  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  
Sbjct: 109 DISKFAEKDNIVLGEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE 168

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS 565
           S   + + +KT I +T  ++ ++  D+++ + +G+    G+
Sbjct: 169 SCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGT 209


>1r0zD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 256

 Score = 89.4 bits (220), Expect = 2e-20
 Identities = 67/229 (29%), Positives = 113/229 (49%), Gaps = 24/229 (10%)

Query: 348 IKLDNVHFRYENGSRE----------ILKGINLDISSGDKLAILGRSGSGKSTLANLIRG 397
           I ++NV   +E G  E          +LK INL+I  G+ LAI G +GSGK++L  LI G
Sbjct: 3   IIMENVTAFWEEGFGEFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILG 62

Query: 398 DRVATEGAITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQV 457
           +  A+EG I  +G             +    Q  ++   TI  N+  G       +   V
Sbjct: 63  ELEASEGIIKHSG------------RVSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSV 109

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           ++   L+  +    +   T++ E G+  SGG+R R++LAR + KDA + +LD P   LD 
Sbjct: 110 VKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDV 169

Query: 518 LTEQEVI-SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS 565
            TE++V  S   + + +KT I +T  ++ +   D+++ +  G+    G+
Sbjct: 170 FTEEQVFESCVCKLMANKTRILVTSKMEHLRKADKILILHQGSSYFYGT 218


>1xf9D [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 260

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 30  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 77

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+ I        +   V++   L+  +    +   T++ E G+
Sbjct: 78  VSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV 136

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 137 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 196

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 197 MEHLRKADKILILHQGSSYFYGT 219


>1xf9C [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 82

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+ I        +   V++   L+  +    +   T++ E G+
Sbjct: 83  VSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV 141

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 142 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 201

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 202 MEHLRKADKILILHQGSSYFYGT 224


>1xf9B [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 82

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+ I        +   V++   L+  +    +   T++ E G+
Sbjct: 83  VSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV 141

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 142 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 201

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 202 MEHLRKADKILILHQGSSYFYGT 224


>1xf9A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 81

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+ I        +   V++   L+  +    +   T++ E G+
Sbjct: 82  VSFCSQFSWIMPGTIKENI-ISGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV 140

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 141 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 200

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 201 MEHLRKADKILILHQGSSYFYGT 223


>1r10A [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 81

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 82  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 140

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 141 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 200

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 201 MEHLRKADKILILHQGSSYFYGT 223


>1r0zC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 273

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 46  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 93

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 94  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 152

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 153 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 212

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 213 MEHLRKADKILILHQGSSYFYGT 235


>1r0zB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 44  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 91

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 92  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 150

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 151 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 210

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 211 MEHLRKADKILILHQGSSYFYGT 233


>1r0zA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 271

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 44  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 91

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 92  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 150

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 151 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 210

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 211 MEHLRKADKILILHQGSSYFYGT 233


>1r0xD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 263

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 33  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 80

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 81  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 139

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 140 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 199

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 200 MEHLRKADKILILHQGSSYFYGT 222


>1r0xC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 82

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 83  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 141

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 142 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 201

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 202 MEHLRKADKILILHQGSSYFYGT 224


>1r0xB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 82

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 83  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 141

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 142 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 201

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 202 MEHLRKADKILILHQGSSYFYGT 224


>1r0xA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 81

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 82  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 140

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 141 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 200

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 201 MEHLRKADKILILHQGSSYFYGT 223


>1r0wC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 37  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 84

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 85  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 143

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 144 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 203

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 204 MEHLRKADKILILHQGSSYFYGT 226


>1r0wB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 37  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 84

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 85  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 143

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 144 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 203

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 204 MEHLRKADKILILHQGSSYFYGT 226


>1r0wA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 36  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 83

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 84  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 142

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 143 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 202

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 203 MEHLRKADKILILHQGSSYFYGT 225


>1q3hD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 81

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 82  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 140

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 141 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 200

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 201 MEHLRKADKILILHQGSSYFYGT 223


>1q3hC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 36  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 83

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 84  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 142

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 143 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 202

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 203 MEHLRKADKILILHQGSSYFYGT 225


>1q3hB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 37  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 84

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 85  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 143

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 144 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 203

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 204 MEHLRKADKILILHQGSSYFYGT 226


>1q3hA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 265

 Score = 89.0 bits (219), Expect = 3e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 35  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 82

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+  G       +   V++   L+  +    +   T++ E G+
Sbjct: 83  VSFCSQFSWIMPGTIKENIIFGVSYDEY-RYKSVVKACQLQQDITKFAEQDNTVLGEGGV 141

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 142 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 201

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 202 MEHLRKADKILILHQGSSYFYGT 224


>1xfaA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 264

 Score = 88.2 bits (217), Expect = 6e-20
 Identities = 61/203 (30%), Positives = 104/203 (51%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK INL+I  G+ LAI G +GSGK++L  LI G+  A+EG I  +G             
Sbjct: 34  VLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG------------R 81

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           +    Q  ++   TI  N+ I        +   V++   L+  +    +   T++ E G+
Sbjct: 82  VSFCSQFSWIMPGTIKENI-IRGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGV 140

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD  TE++V  S   + + +KT I +T  
Sbjct: 141 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTSK 200

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ +   D+++ +  G+    G+
Sbjct: 201 MEHLRKADKILILHQGSSYFYGT 223


>2pzgB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 215

 Score = 84.7 bits (208), Expect = 6e-19
 Identities = 61/226 (26%), Positives = 111/226 (49%), Gaps = 29/226 (12%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ ++NV   +E G   +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I
Sbjct: 5   EVVMENVTAFWEEGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI 64

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
             +G             I    Q  ++   TI  N+  G             +    + +
Sbjct: 65  KHSG------------RISFCSQFSWIMPGTIKENIIFGVS----------YDEYRYRSV 102

Query: 467 VKA--LPQGLETMVDE----AGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           +KA  L + +    ++     G+  SGG+R R++LAR + KDA + +LD P   LD LTE
Sbjct: 103 IKACQLEEDISKFAEKDNIVLGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTE 162

Query: 521 QEVI-SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS 565
           +E+  S   + + +KT I +T  ++ ++  D+++ + +G+    G+
Sbjct: 163 KEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGT 208


>2yz2B [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 263

 Score = 84.3 bits (207), Expect = 8e-19
 Identities = 67/242 (27%), Positives = 121/242 (50%), Gaps = 24/242 (9%)

Query: 348 IKLDNVHFRYENGS---REILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEG 404
           I++ NV   +  G+   ++ L+ ++L I+ G+ L + G +GSGKSTL  ++ G    T G
Sbjct: 3   IEVVNVSHIFHRGTPLEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSG 62

Query: 405 AITINGIDVSKVGDQISNYIGVIHQTPY-------LFNTTILNNLRIGNEEATIEQVWQV 457
            +  +G    K G +I   IG+  Q P        +F+           +   +  V + 
Sbjct: 63  DVLYDG--ERKKGYEIRRNIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKA 120

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           +E VGL           ++  D      SGGE+ R+A+A +++ +  I+ILDEP VGLD 
Sbjct: 121 MEFVGLD---------FDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDR 171

Query: 518 LTEQEVISIFNR-ELKDKTLIWITHHLQGV-EAMDQVIFIEDGTIEMQGS-PDYLRKTNE 574
             + +++ I  + +   KT+I I+H ++ V   +D+V+ +E G     G+  ++L K + 
Sbjct: 172 EGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFLEKYDP 231

Query: 575 RY 576
           R+
Sbjct: 232 RF 233


>2yz2A [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 266

 Score = 84.3 bits (207), Expect = 8e-19
 Identities = 67/242 (27%), Positives = 121/242 (50%), Gaps = 24/242 (9%)

Query: 348 IKLDNVHFRYENGS---REILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEG 404
           I++ NV   +  G+   ++ L+ ++L I+ G+ L + G +GSGKSTL  ++ G    T G
Sbjct: 3   IEVVNVSHIFHRGTPLEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSG 62

Query: 405 AITINGIDVSKVGDQISNYIGVIHQTPY-------LFNTTILNNLRIGNEEATIEQVWQV 457
            +  +G    K G +I   IG+  Q P        +F+           +   +  V + 
Sbjct: 63  DVLYDG--ERKKGYEIRRNIGIAFQYPEDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKA 120

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           +E VGL           ++  D      SGGE+ R+A+A +++ +  I+ILDEP VGLD 
Sbjct: 121 MEFVGLD---------FDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLDR 171

Query: 518 LTEQEVISIFNR-ELKDKTLIWITHHLQGV-EAMDQVIFIEDGTIEMQGS-PDYLRKTNE 574
             + +++ I  + +   KT+I I+H ++ V   +D+V+ +E G     G+  ++L K + 
Sbjct: 172 EGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVLEKGKKVFDGTRMEFLEKYDP 231

Query: 575 RY 576
           R+
Sbjct: 232 RF 233


>2pzfA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 224

 Score = 84.0 bits (206), Expect = 1e-18
 Identities = 58/208 (27%), Positives = 105/208 (50%), Gaps = 17/208 (8%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ 419
           G   +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G         
Sbjct: 17  GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG--------- 67

Query: 420 ISNYIGVIHQTPYLFNTTILNNL-RIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMV 478
               I    Q  ++   TI  N+  +  +E     V +  +   L++ +    +    ++
Sbjct: 68  ---RISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVL 121

Query: 479 DEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLI 537
            E G+  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I
Sbjct: 122 GEGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRI 181

Query: 538 WITHHLQGVEAMDQVIFIEDGTIEMQGS 565
            +T  ++ ++  D+++ + +G+    G+
Sbjct: 182 LVTSKMEHLKKADKILILHEGSSYFYGT 209


>1xmiE [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 266

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 57/203 (28%), Positives = 103/203 (50%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G             
Sbjct: 35  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------R 82

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           I    Q  ++   TI  N+ I        +   V++   L++ +    +    ++ E G+
Sbjct: 83  ISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI 141

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I +T  
Sbjct: 142 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 201

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ ++  D+++ + +G+    G+
Sbjct: 202 MEHLKKADKILILHEGSSYFYGT 224


>1xmiC [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 270

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 57/203 (28%), Positives = 103/203 (50%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G             
Sbjct: 39  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------R 86

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           I    Q  ++   TI  N+ I        +   V++   L++ +    +    ++ E G+
Sbjct: 87  ISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI 145

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I +T  
Sbjct: 146 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 205

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ ++  D+++ + +G+    G+
Sbjct: 206 MEHLKKADKILILHEGSSYFYGT 228


>1xmiA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 267

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 57/203 (28%), Positives = 103/203 (50%), Gaps = 14/203 (6%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G             
Sbjct: 36  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------R 83

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           I    Q  ++   TI  N+ I        +   V++   L++ +    +    ++ E G+
Sbjct: 84  ISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGEGGI 142

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I +T  
Sbjct: 143 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 202

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ ++  D+++ + +G+    G+
Sbjct: 203 MEHLKKADKILILHEGSSYFYGT 225


>3dhwC [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
          Length = 343

 Score = 83.2 bits (204), Expect = 2e-18
 Identities = 65/230 (28%), Positives = 116/230 (50%), Gaps = 29/230 (12%)

Query: 348 IKLDNVHFRYENGSREI--LKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           IKL N+   +  G+R I  L  ++L + +G    ++G SG+GKSTL   +      TEG+
Sbjct: 2   IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGS 61

Query: 406 ITINGIDVSKVGD----QISNYIGVIHQTPYLFNT-TILNNLRIGNE------EATIEQV 454
           + ++G +++ + +    +    IG+I Q   L ++ T+  N+ +  E      +    +V
Sbjct: 62  VLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRV 121

Query: 455 WQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVG 514
            ++L  VGL D   + P  L           SGG++ R+A+AR L  +  +++ DE T  
Sbjct: 122 TELLSLVGLGDKHDSYPSNL-----------SGGQKQRVAIARALASNPKVLLCDEATSA 170

Query: 515 LDPLTEQEVISI---FNRELKDKTLIWITHHLQGVEAM-DQVIFIEDGTI 560
           LDP T + ++ +    NR L   T++ ITH +  V+ + D V  I +G +
Sbjct: 171 LDPATTRSILELLKDINRRL-GLTILLITHEMDVVKRICDCVAVISNGEL 219


>2cbzA [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
          Length = 230

 Score = 83.2 bits (204), Expect = 2e-18
 Identities = 62/241 (25%), Positives = 109/241 (45%), Gaps = 30/241 (12%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           I + N  F +       L GI   I  G  +A++G+ G GKS+L + +  +    EG + 
Sbjct: 3   ITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVA 62

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVW--QVLERVGLKD 465
           I G             +  + Q  ++ N ++  N+  G +   +E+ +   V++   L  
Sbjct: 63  IKGS------------VAYVPQQAWIQNDSLRENILFGCQ---LEEPYYRSVIQACALLP 107

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVIS 525
            ++ LP G  T + E G+  SGG++ R++LAR +  +A I + D+P   +D    + +  
Sbjct: 108 DLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFE 167

Query: 526 IF---NRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAI 582
                   LK+KT I +TH +  +  +D +I +  G I   GS          YQ+L A 
Sbjct: 168 NVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGS----------YQELLAR 217

Query: 583 D 583
           D
Sbjct: 218 D 218


>2pcjA [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
          Length = 223

 Score = 82.4 bits (202), Expect = 3e-18
 Identities = 63/211 (29%), Positives = 106/211 (50%), Gaps = 24/211 (11%)

Query: 363 EILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ--- 419
           EILKGI+L +  G+ ++I+G SGSGKSTL  ++      TEG + + G +V    ++   
Sbjct: 17  EILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELS 76

Query: 420 --ISNYIGVIHQTPYLF-NTTILNN-----LRIGN-EEATIEQVWQVLERVGLKDMVKAL 470
              +  +G + Q  YL    T L N     L++G  ++   E+   +L  +GL D +   
Sbjct: 77  LLRNRKLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRK 136

Query: 471 PQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRE 530
           P  L           SGGE+ R+A+AR L  +  ++  DEPT  LD    + V+ IF + 
Sbjct: 137 PYEL-----------SGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKI 185

Query: 531 LKDKT-LIWITHHLQGVEAMDQVIFIEDGTI 560
            +  T ++ +TH  +  E   + + ++DG +
Sbjct: 186 NEGGTSIVMVTHERELAELTHRTLEMKDGKV 216


>2bboA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 254

 Score = 82.4 bits (202), Expect = 3e-18
 Identities = 62/241 (25%), Positives = 119/241 (49%), Gaps = 16/241 (6%)

Query: 347 DIKLDNVHFRYENG-SREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGA 405
           ++ ++NV   +E G    +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG 
Sbjct: 3   EVVMENVTAFWEEGLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGK 62

Query: 406 ITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKD 465
           I  +G             I    Q  ++   TI  N+  G       +   V++   L++
Sbjct: 63  IKHSG------------RISFCSQFSWIMPGTIKENIIFGVSYDEY-RYRSVIKACQLEE 109

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI- 524
            +    +    ++ E G+  S G++ +++LAR + KDA + +LD P   LD LTE+E+  
Sbjct: 110 DISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE 169

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERY-QKLKAID 583
           S   + + +KT I +T  ++ ++  D+++ + +G+    G+   L+     +  KL + D
Sbjct: 170 SCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSFD 229

Query: 584 E 584
           +
Sbjct: 230 Q 230


>2bbtB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 80.5 bits (197), Expect = 1e-17
 Identities = 61/236 (25%), Positives = 114/236 (48%), Gaps = 28/236 (11%)

Query: 356 RYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSK 415
           +  N +  +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G     
Sbjct: 25  KQNNNNTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG----- 79

Query: 416 VGDQISNYIGVIHQTPYLFNTTILNNL-RIGNEEATIEQVWQVLERVGLKDMVKALPQGL 474
                   I    Q  ++   TI  N+  +  +E     V +  +   L++ +    +  
Sbjct: 80  -------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQ---LEEDISKFAEKD 129

Query: 475 ETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKD 533
             ++   G+  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +
Sbjct: 130 NIVL---GITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMAN 186

Query: 534 KTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS--------PDYLRKTNERYQKLKA 581
           KT I +T  ++ ++  D+++ + +G+    G+        PD+  K  + + +  A
Sbjct: 187 KTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSKLMDSFDQFSA 242


>1b0uA [c.37.1] HISTIDINE PERMEASE
          Length = 258

 Score = 80.1 bits (196), Expect = 2e-17
 Identities = 63/230 (27%), Positives = 110/230 (47%), Gaps = 16/230 (6%)

Query: 352 NVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGI 411
           ++H RY  G  E+LKG++L   +GD           KST    I      +EGAI +NG 
Sbjct: 7   DLHKRY--GGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQ 64

Query: 412 DVSKVGDQISNY-IGVIHQTPYLFN--TTILNNLRIGNEEATIEQVWQV-LERVGLKD-- 465
           +++ V D+     +   +Q   L    T +  +  + +    +E V +  ++ +GL    
Sbjct: 65  NINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHD 124

Query: 466 -MVKALPQGLETMVDEAG-----MRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLT 519
              +AL    +  +DE       +  SGG++ R+++AR L  +  +++ DEPT  LDP  
Sbjct: 125 ARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPEL 184

Query: 520 EQEVISIFNRELKD-KTLIWITHHLQ-GVEAMDQVIFIEDGTIEMQGSPD 567
             EV+ I  +  ++ KT++ +TH +         VIF+  G IE +G P+
Sbjct: 185 VGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPE 234


>2bbsB [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 231

 Score = 79.3 bits (194), Expect = 3e-17
 Identities = 58/220 (26%), Positives = 109/220 (49%), Gaps = 19/220 (8%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G             
Sbjct: 14  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------R 61

Query: 424 IGVIHQTPYLFNTTILNNL-RIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAG 482
           I    Q  ++   TI  N+  +  +E     V +  +   L++ +    +    ++   G
Sbjct: 62  ISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQ---LEEDISKFAEKDNIVL--GG 116

Query: 483 MRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITH 541
           +  SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I +T 
Sbjct: 117 ITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTS 176

Query: 542 HLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKA 581
            ++ ++  D+++ + +G+    G+   L+   + + +  A
Sbjct: 177 KMEHLKKADKILILHEGSSYFYGTFSELQNLRDSFDQFSA 216


>1xmjA [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 246

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 61/241 (25%), Positives = 119/241 (49%), Gaps = 21/241 (8%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++ ++NV   +E     +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I
Sbjct: 1   EVVMENVTAFWET---PVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKI 57

Query: 407 TINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNL-RIGNEEATIEQVWQVLERVGLKD 465
             +G             I    Q  ++   TI  N+  +  +E     V +  +   L++
Sbjct: 58  KHSG------------RISFCSQFSWIMPGTIKENIIGVSYDEYRYRSVIKACQ---LEE 102

Query: 466 MVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI- 524
            +    +    ++ E G+  S G++ +++LAR + KDA + +LD P   LD LTE+E+  
Sbjct: 103 DISKFAEKDNIVLGEGGITLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFE 162

Query: 525 SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERY-QKLKAID 583
           S   + + +KT I +T  ++ ++  D+++ + +G+    G+   L+     +  KL + D
Sbjct: 163 SCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLQPDFSSKLMSFD 222

Query: 584 E 584
           +
Sbjct: 223 Q 223


>1xmiB [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 258

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 57/203 (28%), Positives = 100/203 (49%), Gaps = 25/203 (12%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G             
Sbjct: 38  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------R 85

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           I    Q  ++   TI  N+  G             +    + ++KA    LE  + +  +
Sbjct: 86  ISFCSQFSWIMPGTIKENIIAGVS----------YDEYRYRSVIKACQ--LEEDISKIVL 133

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I +T  
Sbjct: 134 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 193

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ ++  D+++ + +G+    G+
Sbjct: 194 MEHLKKADKILILHEGSSYFYGT 216


>1q12A [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
          Length = 367

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 26/230 (11%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 1   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 58

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLER 460
           I    ++         +G++ Q+  L+ + ++  N+  G       +E   ++V QV E 
Sbjct: 59  IGEKRMNDT-PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 117

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           + L  ++   P+ L           SGG+R R+A+ R L+ +  + +LDEP   LD    
Sbjct: 118 LQLAHLLDRKPKAL-----------SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALR 166

Query: 521 QEV---ISIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
            ++   IS  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 167 VQMRIEISRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 215


>3fh6A [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 26/230 (11%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLER 460
           I    ++         +G++ Q+  L+ + ++  N+  G       +E   ++V QV E 
Sbjct: 61  IGEKRMNDT-PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 119

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           + L  ++   P+ L           SGG+R R+A+ R L+ +  + +LDEP   LD    
Sbjct: 120 LQLAHLLDRKPKAL-----------SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALR 168

Query: 521 QEV---ISIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
            ++   IS  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 169 VQMRIEISRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 217


>2awoA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 26/230 (11%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLER 460
           I    ++         +G++ Q+  L+ + ++  N+  G       +E   ++V QV E 
Sbjct: 61  IGEKRMNDT-PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 119

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           + L  ++   P+ L           SGG+R R+A+ R L+ +  + +LDEP   LD    
Sbjct: 120 LQLAHLLDRKPKAL-----------SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALR 168

Query: 521 QEV---ISIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
            ++   IS  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 169 VQMRIEISRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 217


>2awnB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 374

 Score = 78.6 bits (192), Expect = 4e-17
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 26/230 (11%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLER 460
           I    ++         +G++ Q+  L+ + ++  N+  G       +E   ++V QV E 
Sbjct: 61  IGEKRMNDT-PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 119

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           + L  ++   P+ L           SGG+R R+A+ R L+ +  + +LDEP   LD    
Sbjct: 120 LQLAHLLDRKPKAL-----------SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALR 168

Query: 521 QEV---ISIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
            ++   IS  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 169 VQMRIEISRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 217


>1f3oA [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 225

 Score = 78.2 bits (191), Expect = 6e-17
 Identities = 68/224 (30%), Positives = 114/224 (50%), Gaps = 13/224 (5%)

Query: 348 IKLDNVHFRYENGSREI---LKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEG 404
           IKL NV   Y+    EI   LK +NL+I  G+ ++I G SGSGKSTL N+I      TEG
Sbjct: 1   IKLKNVTKTYKG--EEIIYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEG 56

Query: 405 AITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLK 464
            + I+ I  + + D     I    +  ++F    L  L    E   +  +++     G +
Sbjct: 57  EVYIDNIKTNDLDDDELTKIRR-DKIGFVFQQFNLIPLLTALENVELPLIFKYRGASGEE 115

Query: 465 DMVKALP----QGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
              +AL     +  E   +    + SGG++ R+A+AR L  + PII+ DEPT  LD  T 
Sbjct: 116 RRKRALECLKAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTG 175

Query: 521 QEVISIFNRELKD-KTLIWITHHLQGVEAMDQVIFIEDGTIEMQ 563
           +++  +     +D KT++ +TH +      +++I+++DG +E +
Sbjct: 176 EKIQLLKKLNEEDGKTVVVVTHDINVARFGERIIYLKDGEVERE 219


>2bbtA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 249

 Score = 78.2 bits (191), Expect = 6e-17
 Identities = 61/230 (26%), Positives = 113/230 (49%), Gaps = 28/230 (12%)

Query: 347 DIKLDNVHFRYENGSRE---------ILKGINLDISSGDKLAILGRSGSGKSTLANLIRG 397
           ++ ++NV   +E G  E         +LK IN  I  G  LA+ G +G+GK++L  +I G
Sbjct: 2   EVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMG 61

Query: 398 DRVATEGAITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNL-RIGNEEATIEQVWQ 456
           +   +EG I  +G             I    Q  ++   TI  N+  +  +E     V +
Sbjct: 62  ELEPSEGKIKHSG------------RISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIK 109

Query: 457 VLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLD 516
             +   L++ +    +    ++   G+  SGG+R R++LAR + KDA + +LD P   LD
Sbjct: 110 ACQ---LEEDISKFAEKDNIVL--GGITLSGGQRARISLARAVYKDADLYLLDSPFGYLD 164

Query: 517 PLTEQEVI-SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGS 565
            LTE+E+  S   + + +KT I +T  ++ ++  D+++ + +G+    G+
Sbjct: 165 VLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGT 214


>2r6gB [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 372

 Score = 77.4 bits (189), Expect = 1e-16
 Identities = 61/230 (26%), Positives = 113/230 (49%), Gaps = 26/230 (11%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLER 460
           I    ++         +G++ Q+  L+ + ++  N+  G       +E   ++V QV E 
Sbjct: 61  IGEKRMNDT-PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 119

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           + L  ++   P+ L           SGG+R R+A+ R L+ +  + +LD+P   LD    
Sbjct: 120 LQLAHLLDRKPKAL-----------SGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALR 168

Query: 521 QEV---ISIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
            ++   IS  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 169 VQMRIEISRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 217


>2r6gA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 371

 Score = 77.4 bits (189), Expect = 1e-16
 Identities = 61/230 (26%), Positives = 113/230 (49%), Gaps = 26/230 (11%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLER 460
           I    ++         +G++ Q+  L+ + ++  N+  G       +E   ++V QV E 
Sbjct: 61  IGEKRMNDT-PPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV 119

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTE 520
           + L  ++   P+ L           SGG+R R+A+ R L+ +  + +LD+P   LD    
Sbjct: 120 LQLAHLLDRKPKAL-----------SGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALR 168

Query: 521 QEV---ISIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
            ++   IS  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 169 VQMRIEISRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 217


>2awoC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 363

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 58/213 (27%), Positives = 104/213 (48%), Gaps = 26/213 (12%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           + K INLDI  G+ +  +G SG GKSTL  +I G    T G + I    ++         
Sbjct: 10  VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDT-PPAERG 68

Query: 424 IGVIHQTPYLFNTTILNNLRIG------NEEATIEQVWQVLERVGLKDMVKALPQGLETM 477
           +G++   P+L   ++  N+  G       +E   ++V QV E + L  ++   P+ L   
Sbjct: 69  VGMVALYPHL---SVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKAL--- 122

Query: 478 VDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEV---ISIFNRELKDK 534
                   SGG+R R+A+ R L+ +  + +LDEP   LD     ++   IS  ++ L  +
Sbjct: 123 --------SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRL-GR 173

Query: 535 TLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
           T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 174 TMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 206


>1xmiD [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 268

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 56/203 (27%), Positives = 102/203 (50%), Gaps = 16/203 (7%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           +LK IN  I  G  LA+ G +G+GK++L  +I G+   +EG I  +G             
Sbjct: 38  VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG------------R 85

Query: 424 IGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGM 483
           I    Q  ++   TI  N+ I        +   V++   L++ +    +    ++ E  +
Sbjct: 86  ISFCSQFSWIMPGTIKENI-IAGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGE--I 142

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVI-SIFNRELKDKTLIWITHH 542
             SGG+R R++LAR + KDA + +LD P   LD LTE+E+  S   + + +KT I +T  
Sbjct: 143 TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSK 202

Query: 543 LQGVEAMDQVIFIEDGTIEMQGS 565
           ++ ++  D+++ + +G+    G+
Sbjct: 203 MEHLKKADKILILHEGSSYFYGT 225


>2bbsA [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
          Length = 253

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 64/254 (25%), Positives = 119/254 (46%), Gaps = 39/254 (15%)

Query: 347 DIKLDNVHFRYENGSRE---------ILKGINLDISSGDKLAILGRSGSGKSTLANLIRG 397
           ++ ++NV   +E G  E         +LK IN  I  G  LA+ G +G+GK++L  +I G
Sbjct: 4   EVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMG 63

Query: 398 DRVATEGAITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQV 457
           +   +EG I  +G             I    Q  ++   TI  N+           +   
Sbjct: 64  ELEPSEGKIKHSG------------RISFCSQNSWIMPGTIKENI-----------IGVS 100

Query: 458 LERVGLKDMVKA--LPQGLETMVDEAGM---RFSGGERHRMALARILLKDAPIIILDEPT 512
            +    + ++KA  L + +    ++  +     SGG+R R++LAR + KDA + +LD P 
Sbjct: 101 YDEYRYRSVIKACQLEEDISKFAEKDNIVLITLSGGQRARISLARAVYKDADLYLLDSPF 160

Query: 513 VGLDPLTEQEVI-SIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRK 571
             LD LTE+E+  S   + + +KT I +T  ++ ++  D+++ + +G+    G+   L+ 
Sbjct: 161 GYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQN 220

Query: 572 TNERY-QKLKAIDE 584
               +  KL + D+
Sbjct: 221 LRPDFSSKLMSFDQ 234


>1g6hA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 254

 Score = 74.7 bits (182), Expect = 6e-16
 Identities = 60/229 (26%), Positives = 103/229 (44%), Gaps = 35/229 (15%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ 419
           G  + L G+++ ++ GD   I+G +GSGKSTL N+I G   A EG +     D++     
Sbjct: 15  GEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPA 74

Query: 420 ISNYIGVIH--QTPY-LFNTTILNNLRIG-------------------NEEATIEQVWQV 457
              + G++   QTP  L   T+L NL IG                    EE  +E+ +++
Sbjct: 75  ELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKI 134

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           LE + L             + D      SGG+   + + R L+ +  +I++DEP  G+ P
Sbjct: 135 LEFLKLSH-----------LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 518 LTEQEVIS-IFNRELKDKTLIWITHHLQGV-EAMDQVIFIEDGTIEMQG 564
               ++ + +   + K  T + I H L  V   +D +  + +G I  +G
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEG 232


>1g9xA [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
          Length = 253

 Score = 73.9 bits (180), Expect = 1e-15
 Identities = 60/229 (26%), Positives = 102/229 (44%), Gaps = 35/229 (15%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ 419
           G  + L G+++ +  GD   I+G +GSGKSTL N+I G   A EG +     D++     
Sbjct: 15  GEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPA 74

Query: 420 ISNYIGVIH--QTPY-LFNTTILNNLRIG-------------------NEEATIEQVWQV 457
              + G++   QTP  L   T+L NL IG                    EE  +E+ +++
Sbjct: 75  ELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKI 134

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           LE + L             + D      SGG+   + + R L+ +  +I++DEP  G+ P
Sbjct: 135 LEFLKLSH-----------LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAP 183

Query: 518 LTEQEVIS-IFNRELKDKTLIWITHHLQGV-EAMDQVIFIEDGTIEMQG 564
               ++ + +   + K  T + I H L  V   +D +  + +G I  +G
Sbjct: 184 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEG 232


>1gajA [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
          Length = 253

 Score = 73.6 bits (179), Expect = 1e-15
 Identities = 59/229 (25%), Positives = 103/229 (44%), Gaps = 35/229 (15%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ 419
           G  + L G+++ ++ GD   I+G +GSGKSTL N+I G   A EG +     D++     
Sbjct: 14  GEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPA 73

Query: 420 ISNYIGVIH--QTPY-LFNTTILNNLRIG-------------------NEEATIEQVWQV 457
              + G++   QTP  L   T+L NL IG                    EE  +E+ +++
Sbjct: 74  ELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESPLNSLFYKKWIPKEEEMVEKAFKI 133

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           LE + L             + D      SGG+   + + R L+ +  +I++D+P  G+ P
Sbjct: 134 LEFLKLSH-----------LYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAP 182

Query: 518 LTEQEVIS-IFNRELKDKTLIWITHHLQGV-EAMDQVIFIEDGTIEMQG 564
               ++ + +   + K  T + I H L  V   +D +  + +G I  +G
Sbjct: 183 GLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVMFNGQIIAEG 231


>1z47B [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 342

 Score = 71.6 bits (174), Expect = 5e-15
 Identities = 57/216 (26%), Positives = 108/216 (50%), Gaps = 13/216 (6%)

Query: 357 YENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKV 416
           Y  G+R + +G++  I  G+ + +LG SGSGK+T+  LI G    T+G + I G  V+ +
Sbjct: 11  YPGGARSV-RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL 69

Query: 417 GDQISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLE 475
             Q  N +G++ Q   LF + T+ +N+  G  E  + +  ++  RV  +++++ +   LE
Sbjct: 70  PPQKRN-VGLVFQNYALFQHMTVYDNVSFGLREKRVPKD-EMDARV--RELLRFM--RLE 123

Query: 476 TMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDK- 534
           +  +      SGG                    DEP   +D    +E +  F R++ D+ 
Sbjct: 124 SYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRE-LRTFVRQVHDEM 182

Query: 535 --TLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSPD 567
             T +++TH   + +E  D+V+ + +G +E  G+P+
Sbjct: 183 GVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPE 218


>1z47A [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
          Length = 345

 Score = 71.6 bits (174), Expect = 5e-15
 Identities = 57/216 (26%), Positives = 108/216 (50%), Gaps = 13/216 (6%)

Query: 357 YENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKV 416
           Y  G+R + +G++  I  G+ + +LG SGSGK+T+  LI G    T+G + I G  V+ +
Sbjct: 14  YPGGARSV-RGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVTDL 72

Query: 417 GDQISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLE 475
             Q  N +G++ Q   LF + T+ +N+  G  E  + +  ++  RV  +++++ +   LE
Sbjct: 73  PPQKRN-VGLVFQNYALFQHMTVYDNVSFGLREKRVPKD-EMDARV--RELLRFM--RLE 126

Query: 476 TMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDK- 534
           +  +      SGG                    DEP   +D    +E +  F R++ D+ 
Sbjct: 127 SYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRE-LRTFVRQVHDEM 185

Query: 535 --TLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSPD 567
             T +++TH   + +E  D+V+ + +G +E  G+P+
Sbjct: 186 GVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPE 221


>1oxvA [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 353

 Score = 71.2 bits (173), Expect = 7e-15
 Identities = 53/176 (30%), Positives = 93/176 (52%), Gaps = 14/176 (7%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           I + NV   ++ G    L  +N++I +G++  ILG SG+GK+T   +I G  V + G + 
Sbjct: 4   IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63

Query: 408 INGIDVSKVGDQI----SNYIGVIHQTPYLF-NTTILNNLR--IGNEEATIEQVWQVLER 460
            +   V+  G  I       IG++ QT  L+ N T   N+   + N + + E++     R
Sbjct: 64  FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEI-----R 118

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLD 516
             ++++ K L   +  +++      SGG++ R+ALAR L+KD  +++LDEP   LD
Sbjct: 119 KRVEEVAKIL--DIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD 172


>1oxsC [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 71.2 bits (173), Expect = 7e-15
 Identities = 53/176 (30%), Positives = 93/176 (52%), Gaps = 14/176 (7%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           I + NV   ++ G    L  +N++I +G++  ILG SG+GK+T   +I G  V + G + 
Sbjct: 4   IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63

Query: 408 INGIDVSKVGDQI----SNYIGVIHQTPYLF-NTTILNNLR--IGNEEATIEQVWQVLER 460
            +   V+  G  I       IG++ QT  L+ N T   N+   + N + + E++     R
Sbjct: 64  FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEI-----R 118

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLD 516
             ++++ K L   +  +++      SGG++ R+ALAR L+KD  +++LDEP   LD
Sbjct: 119 KRVEEVAKIL--DIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLD 172


>2awnC [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 344

 Score = 68.9 bits (167), Expect = 3e-14
 Identities = 56/214 (26%), Positives = 102/214 (47%), Gaps = 47/214 (21%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNY 423
           + K INLDI  G+ +  +G SG GKSTL  +I G                  +G      
Sbjct: 10  VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAG------------------LG------ 45

Query: 424 IGVIHQTPYLF-NTTILNNLRIG------NEEATIEQVWQVLERVGLKDMVKALPQGLET 476
           +G++ Q+  L+ + ++  N+  G       +E   ++V QV E + L  ++   P+ L  
Sbjct: 46  VGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKAL-- 103

Query: 477 MVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEV---ISIFNRELKD 533
                    SGG+R R+A+ R L+ +  + +LDEP   LD     ++   IS  ++ L  
Sbjct: 104 ---------SGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRL-G 153

Query: 534 KTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
           +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 154 RTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 187


>2yyzA [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 358

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 50/213 (23%), Positives = 102/213 (47%), Gaps = 12/213 (5%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ 419
           G  + + G++ ++  G+ +A+LG SG GK+T   ++ G    T G I  + + V+ +  +
Sbjct: 13  GKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDVLVNDIPPK 72

Query: 420 ISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMV 478
               +G++ Q   L+ + T+  N+        I +     + V  + +  A    ++ ++
Sbjct: 73  YRE-VGMVFQNYALYPHMTVFENIAFPLRARRISK-----DEVEKRVVEIARKLLIDNLL 126

Query: 479 DEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP---LTEQEVISIFNRELKDKT 535
           D    + SGG++ R+ALAR L+K   +++ DEP   LD    +  +  I    +EL   T
Sbjct: 127 DRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQEL-GIT 185

Query: 536 LIWITH-HLQGVEAMDQVIFIEDGTIEMQGSPD 567
            +++TH   + +    ++     G +   G+PD
Sbjct: 186 SVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPD 218


>2onkA [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
          Length = 240

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 58/203 (28%), Positives = 95/203 (46%), Gaps = 15/203 (7%)

Query: 368 INLDISSG-DKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNYIGV 426
           +N+D   G D   +LG +G+GKS    LI G      G + +NG D++ +  +    IG 
Sbjct: 16  LNVDFEMGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERRG-IGF 74

Query: 427 IHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRF 485
           + Q   LF + ++  N+  G     +              M + L  G+  ++D    R 
Sbjct: 75  VPQDYALFPHLSVYRNIAYG-----LXXXXXXXXXXXXXXMAEKL--GIAHLLDRKPARL 127

Query: 486 SGGERHRMALARILLKDAPIIILDEPTVGLDPLTE---QEVISIFNRELKDKTLIWITHH 542
           SGGER R+ALAR L+    +++LDEP   +D  T+    E +    RE  D  ++ +TH 
Sbjct: 128 SGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREF-DVPILHVTHD 186

Query: 543 L-QGVEAMDQVIFIEDGTIEMQG 564
           L +     D+V  + +G I  +G
Sbjct: 187 LIEAAMLADEVAVMLNGRIVEKG 209


>1ji0A [c.37.1] ABC TRANSPORTER
          Length = 231

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 58/229 (25%), Positives = 112/229 (48%), Gaps = 23/229 (10%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           +++ ++H  Y  G+   +KGI+L +  G  + ++G +G+GK+T  + I G   A +G I 
Sbjct: 6   LEVQSLHVYY--GAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKII 63

Query: 408 INGIDV-SKVGDQISNYIGVIHQTPYLF-NTTILNNLRIGNEEATIEQVWQVLERVGLK- 464
            NG D+ +K    I+  I ++ +   +F   T+  NL   N +          ++ G+K 
Sbjct: 64  FNGQDITNKPAHVINRGIALVPEGRRIFPELTVYENLGAYNRK----------DKEGIKR 113

Query: 465 --DMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQE 522
             + + +L   L+  + + G   SGGE+ ++A+ R L +     +LDEP++GL P+   E
Sbjct: 114 DLEWIFSLFPRLKERLKQLGGTLSGGEQ-QLAIGRALSRPK---LLDEPSLGLAPILVSE 169

Query: 523 VISIFNRELKDKTLIWITHH--LQGVEAMDQVIFIEDGTIEMQGSPDYL 569
           V  +  +  ++ T I +     L  ++       +E G I ++G    L
Sbjct: 170 VFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASEL 218


>2zu0C [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 247

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 64/244 (26%), Positives = 120/244 (49%), Gaps = 22/244 (9%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRG--DRVATEGA 405
           + + ++H   E+  + IL+G++LD+  G+  AI+G +GSGKSTL+  + G  D   T G 
Sbjct: 2   LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 406 ITINGIDVSKVG--DQISNYIGVIHQTP--------YLFNTTILNNLRIGNEEATIEQVW 455
           +   G D+  +   D+    I +  Q P          F  T LN +R    + T+++ +
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDR-F 118

Query: 456 QVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGL 515
              + +  K  +  +P+ L T     G  FSGGE+ R  + ++ + +  + ILDE   GL
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEKKRNDILQMAVLEPELCILDESDSGL 176

Query: 516 DPLTEQEVISIFNRELKD--KTLIWITHHLQGVEAM--DQVIFIEDGTIEMQGSPDYLRK 571
           D +   +V++     L+D  ++ I +TH+ + ++ +  D V  +  G I   G    +++
Sbjct: 177 D-IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ 235

Query: 572 TNER 575
             E+
Sbjct: 236 LEEQ 239


>2d3wA [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 64/244 (26%), Positives = 120/244 (49%), Gaps = 22/244 (9%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRG--DRVATEGA 405
           + + ++H   E+  + IL+G++LD+  G+  AI+G +GSGKSTL+  + G  D   T G 
Sbjct: 2   LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 406 ITINGIDVSKVG--DQISNYIGVIHQTP--------YLFNTTILNNLRIGNEEATIEQVW 455
           +   G D+  +   D+    I +  Q P          F  T LN +R    + T+++ +
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDR-F 118

Query: 456 QVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGL 515
              + +  K  +  +P+ L T     G  FSGGE+ R  + ++ + +  + ILDE   GL
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEKKRNDILQMAVLEPELCILDESDSGL 176

Query: 516 DPLTEQEVISIFNRELKD--KTLIWITHHLQGVEAM--DQVIFIEDGTIEMQGSPDYLRK 571
           D +   +V++     L+D  ++ I +TH+ + ++ +  D V  +  G I   G    +++
Sbjct: 177 D-IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ 235

Query: 572 TNER 575
             E+
Sbjct: 236 LEEQ 239


>1g291 [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
          Length = 372

 Score = 65.5 bits (158), Expect = 4e-13
 Identities = 62/227 (27%), Positives = 104/227 (45%), Gaps = 34/227 (14%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITIN---------G 410
           G    ++ ++L++  G+ + +LG SG GK+T   +I G    + G I I          G
Sbjct: 14  GEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPEKG 73

Query: 411 IDVSKVGDQIS----NYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDM 466
           I V      I+    +Y    H T Y  N      LR    +   ++V +V E +GL ++
Sbjct: 74  IFVPPKDRDIAMVFQSYALYPHMTVY-DNIAFPLKLRKVPRQEIDQRVREVAELLGLTEL 132

Query: 467 VKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP---LTEQEV 523
           +   P+ L           SGG+R R+AL R +++   + ++DEP   LD    +  +  
Sbjct: 133 LNRKPREL-----------SGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAE 181

Query: 524 ISIFNRELKDKTLIWITHHLQGVEAM---DQVIFIEDGTIEMQGSPD 567
           +    R+L   T I++TH    VEAM   D++  +  G ++  GSPD
Sbjct: 182 LKKLQRQL-GVTTIYVTH--DQVEAMTMGDRIAVMNRGVLQQVGSPD 225


>2nq2C [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 251

 Score = 63.2 bits (152), Expect = 2e-12
 Identities = 51/214 (23%), Positives = 100/214 (46%), Gaps = 35/214 (16%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           + ++N+ F Y+     + + +N D++ GD LA+LG++G GKSTL +L+ G     +G I 
Sbjct: 4   LSVENLGFYYQ-AENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE 62

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGN----------EEATIEQVWQV 457
           +          Q   ++     +P+ +  ++L+ + +G           +    +   Q 
Sbjct: 63  VY---------QSIGFVPQFFSSPFAY--SVLDIVLMGRSTHINTFAKPKSHDYQVAMQA 111

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           L+ + L  + K     L           SGG+R  + +AR +  +  +I+LDEPT  LD 
Sbjct: 112 LDYLNLTHLAKREFTSL-----------SGGQRQLILIARAIASECKLILLDEPTSALDL 160

Query: 518 LTEQEVISIF--NRELKDKTLIWITHHLQGVEAM 549
             +  V+S+     + ++ T+++ TH    V A+
Sbjct: 161 ANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAI 194


>2d3wD [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 243

 Score = 62.4 bits (150), Expect = 3e-12
 Identities = 64/244 (26%), Positives = 121/244 (49%), Gaps = 23/244 (9%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRG--DRVATEGA 405
           + + ++H   E+  + IL+G++LD+  G+  AI+G +GSGKSTL+  + G  D   T G 
Sbjct: 2   LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 406 ITINGIDVSKVG--DQISNYIGVIHQTP--------YLFNTTILNNLRIGNEEATIEQVW 455
           +   G D+  +   D+    I +  Q P          F  T LN +R    + T+++ +
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDR-F 118

Query: 456 QVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGL 515
              + +  K  +  +P+ L T     G  FSGGE+ R  + ++ + +  + ILDE + GL
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEKKRNDILQMAVLEPELCILDE-SDGL 175

Query: 516 DPLTEQEVISIFNRELKD--KTLIWITHHLQGVEAM--DQVIFIEDGTIEMQGSPDYLRK 571
           D +   +V++     L+D  ++ I +TH+ + ++ +  D V  +  G I   G    +++
Sbjct: 176 D-IDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ 234

Query: 572 TNER 575
             E+
Sbjct: 235 LEEQ 238


>2d62A [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
          Length = 361

 Score = 62.0 bits (149), Expect = 4e-12
 Identities = 67/238 (28%), Positives = 112/238 (47%), Gaps = 41/238 (17%)

Query: 347 DIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           ++KL N+  R+  G    +K ++L+I  G+ L +LG SG GK+T    I G    T G I
Sbjct: 4   EVKLINIWKRF--GDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQI 60

Query: 407 TI---------NGIDVSKVGDQISNYIGVIHQTPYLFNTTILNN------LRIGNEEATI 451
            I          G+ V      ++     + Q+  L+  T+ +N      LR   ++   
Sbjct: 61  YIEDNLVADPEKGVFVPPKERDVA-----VFQSYALYPHTVYDNIAFPLKLRKVPKQEID 115

Query: 452 EQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEP 511
           ++V +V E +GL +++   P+ L           SGG+R R+AL R +++  P + LDEP
Sbjct: 116 KRVREVAE-LGLTELLNRKPREL-----------SGGQRQRVALGRAIIR-RPKVFLDEP 162

Query: 512 TVGLDP--LTEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPD 567
              LD     ++  +    R+L   T I++TH    VEA    I +  G ++  G+PD
Sbjct: 163 LSNLDAKLRVKRAELKKLQRQL-GVTTIYVTH--DQVEATGDRIAVNKGELQQVGTPD 217


>2d3wC [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 241

 Score = 62.0 bits (149), Expect = 4e-12
 Identities = 62/244 (25%), Positives = 118/244 (48%), Gaps = 25/244 (10%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRG--DRVATEGA 405
           + + ++H   E+  + IL+G++LD+  G+  AI+G +GSGKSTL+  + G  D   T G 
Sbjct: 2   LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 406 ITINGIDVSKVG--DQISNYIGVIHQTP--------YLFNTTILNNLRIGNEEATIEQVW 455
           +   G D+  +   D+    I +  Q P          F  T LN +R    + T+++ +
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDR-F 118

Query: 456 QVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGL 515
              + +  K  +  +P+ L T     G  FSGGE+ R  + ++ + +  + ILDE     
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEKKRNDILQMAVLEPELCILDES---- 172

Query: 516 DPLTEQEVISIFNRELKD--KTLIWITHHLQGVEAM--DQVIFIEDGTIEMQGSPDYLRK 571
           D +   +V++     L+D  ++ I +TH+ + ++ +  D V  +  G I   G    +++
Sbjct: 173 DDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVHVLYQGRIVKSGDFTLVKQ 232

Query: 572 TNER 575
             E+
Sbjct: 233 LEEQ 236


>2nq2D [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 248

 Score = 61.6 bits (148), Expect = 6e-12
 Identities = 51/214 (23%), Positives = 99/214 (46%), Gaps = 39/214 (18%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           + ++N+ F Y+       + +N D++ GD LA+LG++G GKSTL +L+ G     +G I 
Sbjct: 5   LSVENLGFYYQ-----AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIE 59

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGN----------EEATIEQVWQV 457
           +          Q   ++     +P+ +  ++L+ + +G           +    +   Q 
Sbjct: 60  VY---------QSIGFVPQFFSSPFAY--SVLDIVLMGRSTHINTFAKPKSHDYQVAMQA 108

Query: 458 LERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP 517
           L+ + L  + K     L           SGG+R  + +AR +  +  +I+LDEPT  LD 
Sbjct: 109 LDYLNLTHLAKREFTSL-----------SGGQRQLILIARAIASECKLILLDEPTSALDL 157

Query: 518 LTEQEVISIF--NRELKDKTLIWITHHLQGVEAM 549
             +  V+S+     + ++ T+++ TH    V A+
Sbjct: 158 ANQDIVLSLLIDLAQSQNMTVVFTTHQPNQVVAI 191


>2ihyA [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 57/224 (25%), Positives = 102/224 (45%), Gaps = 25/224 (11%)

Query: 362 REILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQIS 421
           + ILK I+  I+ GDK  + G +G+GK+TL N++     AT G + + G       + + 
Sbjct: 14  KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG-KPGYSAETVR 72

Query: 422 NYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEA 481
            +IG +       + ++L   + G      E+V  V+    + D ++     L  +V  A
Sbjct: 73  QHIGFV-------SHSLLEKFQEG------ERVIDVVISGAIDDEIRNEAHQLLKLVGSA 119

Query: 482 GMR-----FSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELK--DK 534
             +      S GE+ R+ +AR  L    ++ILDEP  GLD +  +               
Sbjct: 120 KAQQYIGYLSTGEKQRV-IAR-ALGQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPT 177

Query: 535 TLIWITHHLQGVEA-MDQVIFIEDGTIEMQGS-PDYLRKTNERY 576
             I++TH ++ + A   +++ ++DG    QG+  D L   N R+
Sbjct: 178 LAIYVTHFIEEITANFSKILLLKDGQSIQQGAVEDILTSENSRF 221


>2d2fA [x.x.x] SUFC PROTEIN
          Length = 246

 Score = 60.1 bits (144), Expect = 2e-11
 Identities = 58/219 (26%), Positives = 107/219 (48%), Gaps = 22/219 (10%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVAT--EGAITINGIDVSKVGDQIS 421
           ILKG+NL +  G+  A++G +G+GKSTL  ++ GD   T   G I ++G ++ ++     
Sbjct: 17  ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDER 76

Query: 422 NYIGVIHQTPY---LFNTTILNNLRIG-----NEEATIEQVW-QVLERVGLKDMVKALPQ 472
              G+     Y   +   TI N LR+        E  + + W +V + + L D  ++   
Sbjct: 77  ARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDWDESY-- 134

Query: 473 GLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELK 532
            L   ++E    FSGGE+ R  + ++L+ +    +LDE   GLD +   +V++     ++
Sbjct: 135 -LSRYLNEG---FSGGEKKRNEILQLLVLEPTYAVLDETDSGLD-IDALKVVARGVNAMR 189

Query: 533 DKTL--IWITHHLQGVEAM--DQVIFIEDGTIEMQGSPD 567
                 + ITH+ + +  +  D+V  + DG +   G P+
Sbjct: 190 GPNFGALVITHYQRILNYIQPDKVHVMMDGRVVATGGPE 228


>2d3wB [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
          Length = 244

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 57/210 (27%), Positives = 106/210 (50%), Gaps = 23/210 (10%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRG--DRVATEGA 405
           + + ++H   E+  + IL+G++LD+  G+  AI+G +GSGKSTL+  + G  D   T G 
Sbjct: 2   LSIKDLHVSVED--KAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDYEVTGGT 59

Query: 406 ITINGIDVSKVG--DQISNYIGVIHQTP--------YLFNTTILNNLRIGNEEATIEQVW 455
           +   G D+  +   D+    I +  Q P          F  T LN +R    + T+++ +
Sbjct: 60  VEFKGKDLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDR-F 118

Query: 456 QVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDE-PTVG 514
              + +  K  +  +P+ L T     G  FSGGE+ R  + ++ + +  + ILDE  ++ 
Sbjct: 119 DFQDLMEEKIALLKMPEDLLTRSVNVG--FSGGEKKRNDILQMAVLEPELCILDESDSLD 176

Query: 515 LDPLTEQEVISIFNRELKD--KTLIWITHH 542
           +D L   +V++     L+D  ++ I +TH+
Sbjct: 177 IDAL---KVVADGVNSLRDGKRSFIIVTHY 203


>1vplA [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 238

 Score = 58.2 bits (139), Expect = 6e-11
 Identities = 58/230 (25%), Positives = 108/230 (46%), Gaps = 16/230 (6%)

Query: 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQ 419
           G +EILK                 +G+GK+T   +I      + G +T+ G +V +   +
Sbjct: 13  GKKEILKXXXXXXXXXXXXXXXXPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHE 72

Query: 420 ISNYIGVIHQTPYLF-NTTILNNLRI--GNEEATIEQVWQVLERVGLKDMVKALPQGLET 476
           +   I  + +    + N   +  LR   G   ++  ++ +++ER            GL  
Sbjct: 73  VRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERA-------TEIAGLGE 125

Query: 477 MVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KT 535
            + +    +S G   ++ +AR L+ +  + ILDEPT GLD L  +EV  I  +  ++  T
Sbjct: 126 KIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLT 185

Query: 536 LIWITHHLQGVEAM-DQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAIDE 584
           ++  +H++  VE + D++  I +GTI   G+ + L+   ERY K + I+E
Sbjct: 186 ILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELK---ERY-KAQNIEE 231


>2ihyB [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
          Length = 251

 Score = 58.2 bits (139), Expect = 6e-11
 Identities = 61/232 (26%), Positives = 107/232 (46%), Gaps = 29/232 (12%)

Query: 362 REILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVG---D 418
           + ILK I+  I+ GDK  + G +G+GK+TL N++     AT G + + G    KVG   +
Sbjct: 15  KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFG-KPGKVGYSAE 73

Query: 419 QISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQ-VLERVG----LKDMVKALPQG 473
            +  +IG +       + ++L   + G  E  I+ V     + +G    + D ++     
Sbjct: 74  TVRQHIGFV-------SHSLLEKFQEG--ERVIDVVISGAFKSIGVYQDIDDEIRNEAHQ 124

Query: 474 LETMVDEAGMR-----FSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           L  +V  A  +      S GE+ R+ +AR  L    ++ILDEP  GLD +  +       
Sbjct: 125 LLKLVGSAKAQQYIGYLSTGEKQRV-IAR-ALGQPQVLILDEPAAGLDFIAREXXXXXXX 182

Query: 529 RELK--DKTLIWITHHLQGVEA-MDQVIFIEDGTIEMQGS-PDYLRKTNERY 576
                     I++TH ++ + A   +++ ++DG    QG+  D L   N R+
Sbjct: 183 XXXXXYPTLAIYVTHFIEEITANFSKILLLKDGQSIQQGAVEDILTSENSRF 234


>2d2eA [x.x.x] SUFC PROTEIN
          Length = 239

 Score = 58.2 bits (139), Expect = 6e-11
 Identities = 54/215 (25%), Positives = 108/215 (50%), Gaps = 19/215 (8%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVAT--EGAITINGIDVSKVG--DQ 419
           ILKG+NL +  G+  A++G +G+GKSTL  ++ GD   T   G I ++G ++ ++   ++
Sbjct: 17  ILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTVERGEILLDGENILELSPDER 76

Query: 420 ISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETM-V 478
               + +  Q P +   TI N LR+  +        ++   VG+ +    + + LE +  
Sbjct: 77  ARKGLFLAFQYPVVPGVTIANFLRLALQA-------KLGREVGVAEFWTKVKKALELLDW 129

Query: 479 DEAGMR--FSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTL 536
           DE+ +    + GE+ R  + ++L+ +    +LDE   GLD +   +V++     ++    
Sbjct: 130 DESYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLD-IDALKVVARGVNAMRGPNF 188

Query: 537 --IWITHHLQGVEAM--DQVIFIEDGTIEMQGSPD 567
             + ITH+ + +  +  D+V  + DG +   G P+
Sbjct: 189 GALVITHYQRILNYIQPDKVHVMMDGRVVATGGPE 223


>1v43A [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
           ATP-BINDING PROTEIN
          Length = 353

 Score = 57.4 bits (137), Expect = 1e-10
 Identities = 61/237 (25%), Positives = 104/237 (43%), Gaps = 26/237 (10%)

Query: 342 LIAPYDIKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVA 401
           +I   ++KL+N+  R+  G+   +  +NL I  G+ L +LG SG GK+T   +I G    
Sbjct: 1   VIKMVEVKLENLTKRF--GNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEP 58

Query: 402 TEGAITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERV 461
           TEG I     DV+ +  +  N I ++ Q   ++        +   +E      W   E +
Sbjct: 59  TEGRIYFGDRDVTYLPPKDRN-ISMVFQHMTVYENIAFPLKKFPKDEIDKRVRW-AAELL 116

Query: 462 GLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDP---L 518
            +++++   P  L           SGG             +  ++++DEP   LD    +
Sbjct: 117 QIEELLNRYPAQL-----------SGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRV 165

Query: 519 TEQEVISIFNRELKDKTLIWITHHLQGVEAM---DQVIFIEDGTIEMQGSPD--YLR 570
             +  I    ++LK  T I++TH    VEAM   D++  +  G +   GSP   YLR
Sbjct: 166 AMRAEIKKLQQKLK-VTTIYVTH--DQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLR 219


>2pjzA [x.x.x] HYPOTHETICAL PROTEIN ST1066
          Length = 261

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 58/181 (32%), Positives = 89/181 (49%), Gaps = 18/181 (9%)

Query: 365 LKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNYI 424
           L+ INL+++ G+K+ ILG +GSGK+TL   I G  +   G I ING++V K    I NYI
Sbjct: 21  LENINLEVN-GEKVIILGPNGSGKTTLLRAISG-LLPYSGNIFINGMEVRK----IRNYI 74

Query: 425 GVIHQTP--YLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAG 482
                 P  Y    T+       N+   + +  + L+R    +M+KAL  G E ++    
Sbjct: 75  RYSTNLPEAYEIGVTV-------NDIVYLYEELKGLDRDLFLEMLKALKLG-EEILRRKL 126

Query: 483 MRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKTLIWITHH 542
            + S G+   +  +  L     I+ LDEP   +D    + VIS + +E   K  I +TH 
Sbjct: 127 YKLSAGQSVLVRTSLALASQPEIVGLDEPFENVD-AARRHVISRYIKEY-GKEGILVTHE 184

Query: 543 L 543
           L
Sbjct: 185 L 185


>3fvqB [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 350

 Score = 55.5 bits (132), Expect = 4e-10
 Identities = 55/235 (23%), Positives = 97/235 (41%), Gaps = 24/235 (10%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI--- 420
           +L  I+L +  G+ L I+G SG GK+TL   + G      G I+++G  +      +   
Sbjct: 18  VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVR 77

Query: 421 SNYIGVIHQTPYLF-NTTILNNLR--IGNEEATIEQVWQ----VLERVGLKDMVKALPQG 473
              +G + Q   LF + T+  N+   +GN +    Q  Q    +LE  G+ ++    P  
Sbjct: 78  ERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHE 137

Query: 474 LETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELK- 532
           L           SGG             D  +I+LDEP   LD    +++       L+ 
Sbjct: 138 L-----------SGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRA 186

Query: 533 -DKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAIDEG 585
             K+ ++++H   + ++  D++  ++ G I    SP  L +          I EG
Sbjct: 187 NGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEG 241


>3fvqA [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
          Length = 343

 Score = 55.5 bits (132), Expect = 4e-10
 Identities = 55/235 (23%), Positives = 97/235 (41%), Gaps = 24/235 (10%)

Query: 364 ILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI--- 420
           +L  I+L +  G+ L I+G SG GK+TL   + G      G I+++G  +      +   
Sbjct: 18  VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGKTIFSKNTNLPVR 77

Query: 421 SNYIGVIHQTPYLF-NTTILNNLR--IGNEEATIEQVWQ----VLERVGLKDMVKALPQG 473
              +G + Q   LF + T+  N+   +GN +    Q  Q    +LE  G+ ++    P  
Sbjct: 78  ERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHE 137

Query: 474 LETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELK- 532
           L           SGG             D  +I+LDEP   LD    +++       L+ 
Sbjct: 138 L-----------SGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRA 186

Query: 533 -DKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAIDEG 585
             K+ ++++H   + ++  D++  ++ G I    SP  L +          I EG
Sbjct: 187 NGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFIGEG 241


>3bk7A [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
          Length = 593

 Score = 55.5 bits (132), Expect = 4e-10
 Identities = 50/199 (25%), Positives = 90/199 (45%), Gaps = 30/199 (15%)

Query: 371 DISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNYIGVIHQT 430
           +I  G+ + I+G +G GK+T   ++ G    TEG +  +     K     + Y G +++ 
Sbjct: 364 EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEWDLTVAYKPQYIKAEYEGTVYEL 423

Query: 431 PYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER 490
               +++ LN+     E                  ++K  P G+  + D      SGGE 
Sbjct: 424 LSKIDSSKLNSNFYKTE------------------LLK--PLGIIDLYDRNVEDLSGGEL 463

Query: 491 HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNREL---KDKTLIWITHHLQGVE 547
            R+A+A  LL+DA I +LDEP+  LD + ++  +S   R L    +KT + + H +  ++
Sbjct: 464 QRVAIAATLLRDADIYLLDEPSAYLD-VEQRLAVSRAIRHLMEKNEKTALVVEHDVLMID 522

Query: 548 AMDQVIFIEDGTIEMQGSP 566
                 ++ D  I  +G P
Sbjct: 523 ------YVSDRLIVFEGEP 535



 Score = 37.4 bits (85), Expect = 1e-04
 Identities = 23/76 (30%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 484 RFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIWITHH 542
           + SGGE  R+A+A  LL+ A     DEP+  LD     +V  +  R   + K ++ + H 
Sbjct: 214 QLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHD 273

Query: 543 LQGVEAMDQVIFIEDG 558
           L  ++ +  VI +  G
Sbjct: 274 LAVLDYLSDVIHVVYG 289


>1sgwA [c.37.1] PUTATIVE ABC TRANSPORTER
          Length = 200

 Score = 53.9 bits (128), Expect = 1e-09
 Identities = 50/185 (27%), Positives = 83/185 (44%), Gaps = 23/185 (12%)

Query: 362 REILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQI- 420
           + +L+ I + I  G+ +   G +G GK+TL   I       +G I  NG+ ++KV  +I 
Sbjct: 14  KPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIF 73

Query: 421 --SNYIGV---IHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLE 475
                I V   I    YL     L  +++   E     +   LE V + D+ K L +   
Sbjct: 74  FLPEEIIVPRKISVEDYLKAVASLYGVKVNKNE-----IMDALESVEVLDLKKKLGE--- 125

Query: 476 TMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKT 535
                     S G   R+ LA  LL +A I +LD+P V +D  ++ +V+      LK+K 
Sbjct: 126 ---------LSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKG 176

Query: 536 LIWIT 540
           ++ I+
Sbjct: 177 IVIIS 181


>1yqtA [x.x.x] RNASE L INHIBITOR
          Length = 507

 Score = 53.1 bits (126), Expect = 2e-09
 Identities = 51/187 (27%), Positives = 85/187 (45%), Gaps = 26/187 (13%)

Query: 371 DISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNYIGVIHQT 430
           +I  G+ + I+G +G GK+T   L  G    TEG I  +     K     ++Y G +++ 
Sbjct: 284 EIKKGEVIGIVGPNGIGKTTFVKLA-GVEEPTEGKIEWDLTVAYKPQYIKADYEGTVYEL 342

Query: 431 PYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGER 490
               + + LN+     E                  ++K  P G+  + D      SGGE 
Sbjct: 343 LSKIDASKLNSNFYKTE------------------LLK--PLGIIDLYDREVNELSGGEL 382

Query: 491 HRMALARILLKDAPIIILDEPTVGLDPLTEQEVI---SIFNRELKDKTLIWITHHLQGVE 547
            R+A+A  LL+DA I +LDEP+  LD   EQ +    +I + E  +KT + + H +    
Sbjct: 383 QRVAIAATLLRDADIYLLDEPSAYLD--VEQRLAVSRAIRHLEKNEKTALVVEHDVLIDY 440

Query: 548 AMDQVIF 554
             D+++F
Sbjct: 441 VSDRLVF 447



 Score = 34.7 bits (78), Expect = 7e-04
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 486 SGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIWITHHLQ 544
           SGGE  R+A+A  LL++A     DEP+  LD            R  ++ K+++ + H L 
Sbjct: 136 SGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLA 195

Query: 545 GVEAMDQVIFIEDG 558
            ++ +  +I +  G
Sbjct: 196 VLDYLSDIIHVVYG 209


>1oxxK [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
          Length = 352

 Score = 52.4 bits (124), Expect = 3e-09
 Identities = 46/176 (26%), Positives = 82/176 (46%), Gaps = 14/176 (7%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           I + NV   ++ G    L  +N++I +G++  ILG SG+GK+T   +I G  V + G + 
Sbjct: 4   IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63

Query: 408 INGIDVSKVGDQI----SNYIGVIHQTPYLF-NTTILNNLR--IGNEEATIEQVWQVLER 460
            +   V+  G  I       IG++ QT  L+ N T   N+   + N + + E++     R
Sbjct: 64  FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEI-----R 118

Query: 461 VGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLD 516
             ++++ K L   +  +++      SG             KD  +++LDEP   LD
Sbjct: 119 KRVEEVAKIL--DIHHVLNHFPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLD 172


>2awnA [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 330

 Score = 50.1 bits (118), Expect = 2e-08
 Identities = 51/223 (22%), Positives = 93/223 (41%), Gaps = 54/223 (24%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 INGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMV 467
           I    ++         +G++ Q+   +   ++N          + QV +VL         
Sbjct: 61  IGEKRMNDT-PPAERGVGMVFQS---YALEVINQ--------RVNQVAEVL--------- 99

Query: 468 KALPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEV---I 524
                                     A+ R L+ +  + +LDEP   LD     ++   I
Sbjct: 100 --------------------------AIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEI 133

Query: 525 SIFNRELKDKTLIWITH-HLQGVEAMDQVIFIEDGTIEMQGSP 566
           S  ++ L  +T+I++TH  ++ +   D+++ ++ G +   G P
Sbjct: 134 SRLHKRL-GRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP 175


>2ix3A [x.x.x] ELONGATION FACTOR 3
          Length = 972

 Score = 48.5 bits (114), Expect = 5e-08
 Identities = 20/59 (33%), Positives = 37/59 (62%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K+ N+ F+Y   S+  +  IN   S   ++A++G +G+GKSTL N++ G+ + T G +
Sbjct: 666 VKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 724



 Score = 48.1 bits (113), Expect = 6e-08
 Identities = 46/179 (25%), Positives = 75/179 (41%), Gaps = 22/179 (12%)

Query: 350 LDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITIN 409
           L N  F    G++ +L    L +    +  I G +G GKSTL   I   +V  +G  T  
Sbjct: 430 LCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQV--DGFPT-- 485

Query: 410 GIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKA 469
                    +    + V H      + T + +    +   T E +   L   G  D + A
Sbjct: 486 --------QEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIA 537

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           +P              SGG + ++ALAR +L++A I++LDEPT  LD +    +++  N
Sbjct: 538 MPISA----------LSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLN 586


>2iwhB [x.x.x] ELONGATION FACTOR 3A
          Length = 980

 Score = 48.5 bits (114), Expect = 5e-08
 Identities = 20/59 (33%), Positives = 37/59 (62%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K+ N+ F+Y   S+  +  IN   S   ++A++G +G+GKSTL N++ G+ + T G +
Sbjct: 670 VKVTNMEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 728



 Score = 48.1 bits (113), Expect = 6e-08
 Identities = 46/179 (25%), Positives = 75/179 (41%), Gaps = 22/179 (12%)

Query: 350 LDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITIN 409
           L N  F    G++ +L    L +    +  I G +G GKSTL   I   +V  +G  T  
Sbjct: 434 LCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQV--DGFPT-- 489

Query: 410 GIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKA 469
                    +    + V H      + T + +    +   T E +   L   G  D + A
Sbjct: 490 --------QEECRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEMIA 541

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           +P              SGG + ++ALAR +L++A I++LDEPT  LD +    +++  N
Sbjct: 542 MPISA----------LSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLN 590


>2ix8A [x.x.x] ELONGATION FACTOR 3A
          Length = 953

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K+ N  F+Y   S+  +  IN   S   ++A++G +G+GKSTL N++ G+ + T G +
Sbjct: 654 VKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 711



 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 26/179 (14%)

Query: 350 LDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITIN 409
           L N  F    G++ +L    L +    +  I G +G GKSTL  +  G          ++
Sbjct: 422 LCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQ---------VD 472

Query: 410 GIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKA 469
           G    +        + V H      + T + +    +   T E +   L   G  D +  
Sbjct: 473 GFPTQEE----CRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEIAP 528

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           +               SGG + ++ALAR +L++A I++LDEPT  LD +    +++  N
Sbjct: 529 ISA------------LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLN 574


>2iw3B [x.x.x] ELONGATION FACTOR 3A
          Length = 958

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K+ N  F+Y   S+  +  IN   S   ++A++G +G+GKSTL N++ G+ + T G +
Sbjct: 658 VKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 715



 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 26/179 (14%)

Query: 350 LDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITIN 409
           L N  F    G++ +L    L +    +  I G +G GKSTL  +  G          ++
Sbjct: 426 LCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQ---------VD 476

Query: 410 GIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKA 469
           G    +        + V H      + T + +    +   T E +   L   G  D +  
Sbjct: 477 GFPTQEE----CRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEIAP 532

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           +               SGG + ++ALAR +L++A I++LDEPT  LD +    +++  N
Sbjct: 533 ISA------------LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLN 578


>2iw3A [x.x.x] ELONGATION FACTOR 3A
          Length = 950

 Score = 43.5 bits (101), Expect = 2e-06
 Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
           +K+ N  F+Y   S+  +  IN   S   ++A++G +G+GKSTL N++ G+ + T G +
Sbjct: 654 VKVTN-EFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTSGEV 711



 Score = 40.8 bits (94), Expect = 1e-05
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 26/179 (14%)

Query: 350 LDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAITIN 409
           L N  F    G++ +L    L +    +  I G +G GKSTL  +  G          ++
Sbjct: 422 LCNCEFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLRAIANGQ---------VD 472

Query: 410 GIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATIEQVWQVLERVGLKDMVKA 469
           G    +        + V H      + T + +    +   T E +   L   G  D +  
Sbjct: 473 GFPTQEE----CRTVYVEHDIDGTHSDTSVLDFVFESGVGTKEAIKDKLIEFGFTDEIAP 528

Query: 470 LPQGLETMVDEAGMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFN 528
           +               SGG + ++ALAR +L++A I++LDEPT  LD +    +++  N
Sbjct: 529 ISA------------LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLN 574


>1ii8B [c.37.1] RAD50 ABC-ATPASE
          Length = 174

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 9/87 (10%)

Query: 486 SGGER------HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIW 538
           SGGER       R+A++  L  +  ++ILDEPT  LD    +++I+I  R LK    +I 
Sbjct: 85  SGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVIL 144

Query: 539 ITHHLQGVEAMDQVIFI--EDGTIEMQ 563
           ++H  +  +A D VI I  E+G+ +++
Sbjct: 145 VSHDEELKDAADHVIRISLENGSSKVE 171


>1f2uD [c.37.1] RAD50 ABC-ATPASE
          Length = 142

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 9/87 (10%)

Query: 486 SGGER------HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIW 538
           SGGER       R+A++  L  +  ++ILDEPT  LD    +++I+I  R LK    +I 
Sbjct: 53  SGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVIL 112

Query: 539 ITHHLQGVEAMDQVIFI--EDGTIEMQ 563
           ++H  +  +A D VI I  E+G+ +++
Sbjct: 113 VSHDEELKDAADHVIRISLENGSSKVE 139


>1f2uB [c.37.1] RAD50 ABC-ATPASE
          Length = 145

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 9/87 (10%)

Query: 486 SGGER------HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIW 538
           SGGER       R+A++  L  +  ++ILDEPT  LD    +++I+I  R LK    +I 
Sbjct: 56  SGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVIL 115

Query: 539 ITHHLQGVEAMDQVIFI--EDGTIEMQ 563
           ++H  +  +A D VI I  E+G+ +++
Sbjct: 116 VSHDEELKDAADHVIRISLENGSSKVE 142


>1f2tB [c.37.1] RAD50 ABC-ATPASE
          Length = 143

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 30/87 (34%), Positives = 50/87 (57%), Gaps = 9/87 (10%)

Query: 486 SGGER------HRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIW 538
           SGGER       R+A++  L  +  ++ILDEPT  LD    +++I+I  R LK    +I 
Sbjct: 54  SGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVIL 113

Query: 539 ITHHLQGVEAMDQVIFI--EDGTIEMQ 563
           ++H  +  +A D VI I  E+G+ +++
Sbjct: 114 VSHDEELKDAADHVIRISLENGSSKVE 140


>1us8B [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
          Length = 140

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 28/85 (32%), Positives = 49/85 (57%), Gaps = 3/85 (3%)

Query: 482 GMRFSGGERHRMALARILLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKD-KTLIWIT 540
           G R + G   R+A++  L  +  ++ILDEPT  LD    +++I+I  R LK    +I ++
Sbjct: 53  GERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVS 112

Query: 541 HHLQGVEAMDQVIFI--EDGTIEMQ 563
           H  +  +A D VI I  E+G+ +++
Sbjct: 113 HDEELKDAADHVIRISLENGSSKVE 137


>2awoD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 299

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 I 408
           I
Sbjct: 61  I 61


>2awnD [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
          Length = 301

 Score = 40.0 bits (92), Expect = 2e-05
 Identities = 24/61 (39%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 348 IKLDNVHFRYENGSREILKGINLDISSGDKLAILGRSGSGKSTLANLIRGDRVATEGAIT 407
           ++L NV   +  G   + K INLDI  G+ +  +G SG GKSTL  +I G    T G + 
Sbjct: 3   VQLQNVTKAW--GEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLF 60

Query: 408 I 408
           I
Sbjct: 61  I 61


>2vf8B [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 835

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 447 EEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDA--- 503
           +E+ I +    L  VGL  +    P              SGGE  R+ LA  L +     
Sbjct: 696 DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEAQRIKLATELRRSGRGG 745

Query: 504 PIIILDEPTVGLDPL----TEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFI---- 555
            + +LDEPT GL P      +++++ + +      T+I + H +Q V A D V+ I    
Sbjct: 746 TVYVLDEPTTGLHPADVERLQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIGPGA 802

Query: 556 --EDGTIEMQGSP 566
             + G +  QG+P
Sbjct: 803 GEDGGRLVAQGTP 815


>2vf8A [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 806

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 447 EEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDA--- 503
           +E+ I +    L  VGL  +    P              SGGE  R+ LA  L +     
Sbjct: 667 DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEAQRIKLATELRRSGRGG 716

Query: 504 PIIILDEPTVGLDPL----TEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFI---- 555
            + +LDEPT GL P      +++++ + +      T+I + H +Q V A D V+ I    
Sbjct: 717 TVYVLDEPTTGLHPADVERLQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIGPGA 773

Query: 556 --EDGTIEMQGSP 566
             + G +  QG+P
Sbjct: 774 GEDGGRLVAQGTP 786


>2vf7C [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 814

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 447 EEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDA--- 503
           +E+ I +    L  VGL  +    P              SGGE  R+ LA  L +     
Sbjct: 675 DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEAQRIKLATELRRSGRGG 724

Query: 504 PIIILDEPTVGLDPL----TEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFI---- 555
            + +LDEPT GL P      +++++ + +      T+I + H +Q V A D V+ I    
Sbjct: 725 TVYVLDEPTTGLHPADVERLQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIGPGA 781

Query: 556 --EDGTIEMQGSP 566
             + G +  QG+P
Sbjct: 782 GEDGGRLVAQGTP 794


>2vf7B [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 813

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 447 EEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDA--- 503
           +E+ I +    L  VGL  +    P              SGGE  R+ LA  L +     
Sbjct: 674 DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEAQRIKLATELRRSGRGG 723

Query: 504 PIIILDEPTVGLDPL----TEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFI---- 555
            + +LDEPT GL P      +++++ + +      T+I + H +Q V A D V+ I    
Sbjct: 724 TVYVLDEPTTGLHPADVERLQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIGPGA 780

Query: 556 --EDGTIEMQGSP 566
             + G +  QG+P
Sbjct: 781 GEDGGRLVAQGTP 793


>2vf7A [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
          Length = 815

 Score = 38.9 bits (89), Expect = 4e-05
 Identities = 36/133 (27%), Positives = 58/133 (43%), Gaps = 26/133 (19%)

Query: 447 EEATIEQVWQVLERVGLKDMVKALPQGLETMVDEAGMRFSGGERHRMALARILLKDA--- 503
           +E+ I +    L  VGL  +    P              SGGE  R+ LA  L +     
Sbjct: 676 DESAIFRALDTLREVGLGYLRLGQP----------ATELSGGEAQRIKLATELRRSGRGG 725

Query: 504 PIIILDEPTVGLDPL----TEQEVISIFNRELKDKTLIWITHHLQGVEAMDQVIFI---- 555
            + +LDEPT GL P      +++++ + +      T+I + H +Q V A D V+ I    
Sbjct: 726 TVYVLDEPTTGLHPADVERLQRQLVKLVD---AGNTVIAVEHKMQVVAASDWVLDIGPGA 782

Query: 556 --EDGTIEMQGSP 566
             + G +  QG+P
Sbjct: 783 GEDGGRLVAQGTP 795


>2r6fB [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 864

 Score = 37.7 bits (86), Expect = 9e-05
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 10/114 (8%)

Query: 473 GLETMVDEAGMRFSGGERHRMALARILLKDA---PIIILDEPTVGLDPLTEQEVISIFNR 529
           GL   + +     SGGE  R+ LA  L + +    + ILDEPT GL       ++ + +R
Sbjct: 730 GLGYKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHR 789

Query: 530 ELKD-KTLIWITHHLQGVEAMDQVIFI------EDGTIEMQGSPDYLRKTNERY 576
            + +  T++ I H+L  ++  D +I +        G I   G+P+ + +  E +
Sbjct: 790 LVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESH 843


>2r6fA [x.x.x] EXCINUCLEASE ABC SUBUNIT A
          Length = 884

 Score = 37.7 bits (86), Expect = 9e-05
 Identities = 30/114 (26%), Positives = 54/114 (47%), Gaps = 10/114 (8%)

Query: 473 GLETMVDEAGMRFSGGERHRMALARILLKDA---PIIILDEPTVGLDPLTEQEVISIFNR 529
           GL   + +     SGGE  R+ LA  L + +    + ILDEPT GL       ++ + +R
Sbjct: 750 GLGYKLGQPATTLSGGEAQRVKLAAELHRRSNGRTLYILDEPTTGLHVDDIARLLDVLHR 809

Query: 530 ELKD-KTLIWITHHLQGVEAMDQVIFI------EDGTIEMQGSPDYLRKTNERY 576
            + +  T++ I H+L  ++  D +I +        G I   G+P+ + +  E +
Sbjct: 810 LVDNGDTVLVIEHNLDVIKTADYIIDLGPEGGDRGGQIVAVGTPEEVAEVKESH 863


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.315    0.137    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 964,407,132
Number of extensions: 39891772
Number of successful extensions: 107265
Number of sequences better than 1.0e-03: 2045
Number of HSP's gapped: 105710
Number of HSP's successfully gapped: 2405
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)