BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE00071.1 lsal0 proC GIB00337CH01 "Pyrroline-5-carboxylate
reductase"
         (264 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2amfE [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE                     172   1e-45
2amfD [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE                     172   1e-45
2amfC [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE                     172   1e-45
2amfA [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE                     172   1e-45
2ahrE [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE                146   6e-38
2ahrD [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE                146   6e-38
2ahrC [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE                146   6e-38
2ahrA [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE                146   6e-38
2izzE [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2izzD [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2izzC [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2izzB [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2izzA [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2gr9A [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2gerA [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     139   7e-36
2gerB [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     135   1e-34
2gr9B [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1                     135   2e-34
2rcyC [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE                         112   1e-27
2rcyA [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE                         112   1e-27
2rcyB [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE                         102   1e-24
2rcyD [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE                         100   4e-24
2rcyE [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE                         100   8e-24
3gt0A [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE                        62   1e-12
1yqgA [c.2.1 - a.100.1 (1xc2A)] PYRROLINE-5-CARBOXYLATE REDUCTASE      54   4e-10
3dojA [x.x.x] DEHYDROGENASE-LIKE PROTEIN                               37   9e-05
1i36A [c.2.1 - a.100.1] CONSERVED HYPOTHETICAL PROTEIN MTH1747         33   0.001
1hyhC [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE           33   0.001
1hyhB [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE           33   0.001
1hyhA [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE           33   0.001
2gf2D [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE                       33   0.001
2gf2B [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE                       33   0.001
2gf2A [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE                       33   0.001

>2amfE [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
          Length = 259

 Score =  172 bits (435), Expect = 1e-45
 Identities = 101/265 (38%), Positives = 152/265 (57%), Gaps = 13/265 (4%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
           MKIG IGVG MA AII+GL     E   + I  +     +  +++  +    S+ ++I++
Sbjct: 4   MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQ 60

Query: 61  SDVVFLAVKPIVVEKVLKEV--KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTM 118
            D+V L +KP + E VLK +  K  +++                L   +G +D+ ++R M
Sbjct: 61  VDLVILGIKPQLFETVLKPLHFKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIM 112

Query: 119 PNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFV 178
           PN+N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++
Sbjct: 113 PNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYI 172

Query: 179 YFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAG 238
           Y FI++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG
Sbjct: 173 YLFIEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG 232

Query: 239 LLAMEEAGFMTSIVKGVDATISKDK 263
           L+ +E  G   ++   +D TI K K
Sbjct: 233 LMELERLGLTATVSSAIDKTIDKAK 257


>2amfD [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
          Length = 258

 Score =  172 bits (435), Expect = 1e-45
 Identities = 101/265 (38%), Positives = 152/265 (57%), Gaps = 13/265 (4%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
           MKIG IGVG MA AII+GL     E   + I  +     +  +++  +    S+ ++I++
Sbjct: 3   MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQ 59

Query: 61  SDVVFLAVKPIVVEKVLKEV--KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTM 118
            D+V L +KP + E VLK +  K  +++                L   +G +D+ ++R M
Sbjct: 60  VDLVILGIKPQLFETVLKPLHFKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIM 111

Query: 119 PNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFV 178
           PN+N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++
Sbjct: 112 PNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYI 171

Query: 179 YFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAG 238
           Y FI++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG
Sbjct: 172 YLFIEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG 231

Query: 239 LLAMEEAGFMTSIVKGVDATISKDK 263
           L+ +E  G   ++   +D TI K K
Sbjct: 232 LMELERLGLTATVSSAIDKTIDKAK 256


>2amfC [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
          Length = 256

 Score =  172 bits (435), Expect = 1e-45
 Identities = 101/265 (38%), Positives = 152/265 (57%), Gaps = 13/265 (4%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
           MKIG IGVG MA AII+GL     E   + I  +     +  +++  +    S+ ++I++
Sbjct: 1   MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQ 57

Query: 61  SDVVFLAVKPIVVEKVLKEV--KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTM 118
            D+V L +KP + E VLK +  K  +++                L   +G +D+ ++R M
Sbjct: 58  VDLVILGIKPQLFETVLKPLHFKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIM 109

Query: 119 PNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFV 178
           PN+N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++
Sbjct: 110 PNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYI 169

Query: 179 YFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAG 238
           Y FI++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG
Sbjct: 170 YLFIEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG 229

Query: 239 LLAMEEAGFMTSIVKGVDATISKDK 263
           L+ +E  G   ++   +D TI K K
Sbjct: 230 LMELERLGLTATVSSAIDKTIDKAK 254


>2amfA [x.x.x] 1-PYRROLINE-5-CARBOXYLATE REDUCTASE
          Length = 257

 Score =  172 bits (435), Expect = 1e-45
 Identities = 101/265 (38%), Positives = 152/265 (57%), Gaps = 13/265 (4%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
           MKIG IGVG MA AII+GL     E   + I  +     +  +++  +    S+ ++I++
Sbjct: 2   MKIGIIGVGKMASAIIKGLKQTPHE---LIISGSSLERSKEIAEQLALPYAMSHQDLIDQ 58

Query: 61  SDVVFLAVKPIVVEKVLKEV--KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTM 118
            D+V L +KP + E VLK +  K  +++                L   +G +D+ ++R M
Sbjct: 59  VDLVILGIKPQLFETVLKPLHFKQPIIS-------MAAGISLQRLATFVG-QDLPLLRIM 110

Query: 119 PNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFV 178
           PN+N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++
Sbjct: 111 PNMNAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYI 170

Query: 179 YFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAG 238
           Y FI++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG
Sbjct: 171 YLFIEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG 230

Query: 239 LLAMEEAGFMTSIVKGVDATISKDK 263
           L+ +E  G   ++   +D TI K K
Sbjct: 231 LMELERLGLTATVSSAIDKTIDKAK 255


>2ahrE [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
          Length = 252

 Score =  146 bits (369), Expect = 6e-38
 Identities = 102/262 (38%), Positives = 147/262 (56%), Gaps = 15/262 (5%)

Query: 2   KIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKS 61
           KIG IGVG  A AII+GL  K    + I   S+ + + E+  Q     A  S+ ++I++ 
Sbjct: 4   KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQV 58

Query: 62  DVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNV 121
           D+V L +KP + E VLK +      H               L   +G +D+ ++R +PN 
Sbjct: 59  DLVILGIKPQLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN- 109

Query: 122 NVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFF 181
           N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++Y F
Sbjct: 110 NAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLF 169

Query: 182 IDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLA 241
           I++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG L 
Sbjct: 170 IEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG-LE 228

Query: 242 MEEAGFMTSIVKGVDATISKDK 263
           +E  G   ++   +D TI K K
Sbjct: 229 LERLGLTATVSSAIDKTIDKAK 250


>2ahrD [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
          Length = 251

 Score =  146 bits (369), Expect = 6e-38
 Identities = 102/262 (38%), Positives = 147/262 (56%), Gaps = 15/262 (5%)

Query: 2   KIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKS 61
           KIG IGVG  A AII+GL  K    + I   S+ + + E+  Q     A  S+ ++I++ 
Sbjct: 3   KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQV 57

Query: 62  DVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNV 121
           D+V L +KP + E VLK +      H               L   +G +D+ ++R +PN 
Sbjct: 58  DLVILGIKPQLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN- 108

Query: 122 NVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFF 181
           N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++Y F
Sbjct: 109 NAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLF 168

Query: 182 IDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLA 241
           I++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG L 
Sbjct: 169 IEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG-LE 227

Query: 242 MEEAGFMTSIVKGVDATISKDK 263
           +E  G   ++   +D TI K K
Sbjct: 228 LERLGLTATVSSAIDKTIDKAK 249


>2ahrC [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
          Length = 249

 Score =  146 bits (369), Expect = 6e-38
 Identities = 102/262 (38%), Positives = 147/262 (56%), Gaps = 15/262 (5%)

Query: 2   KIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKS 61
           KIG IGVG  A AII+GL  K    + I   S+ + + E+  Q     A  S+ ++I++ 
Sbjct: 1   KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQV 55

Query: 62  DVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNV 121
           D+V L +KP + E VLK +      H               L   +G +D+ ++R +PN 
Sbjct: 56  DLVILGIKPQLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN- 106

Query: 122 NVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFF 181
           N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++Y F
Sbjct: 107 NAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLF 166

Query: 182 IDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLA 241
           I++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG L 
Sbjct: 167 IEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG-LE 225

Query: 242 MEEAGFMTSIVKGVDATISKDK 263
           +E  G   ++   +D TI K K
Sbjct: 226 LERLGLTATVSSAIDKTIDKAK 247


>2ahrA [x.x.x] PUTATIVE PYRROLINE CARBOXYLATE REDUCTASE
          Length = 250

 Score =  146 bits (369), Expect = 6e-38
 Identities = 102/262 (38%), Positives = 147/262 (56%), Gaps = 15/262 (5%)

Query: 2   KIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKS 61
           KIG IGVG  A AII+GL  K    + I   S+ + + E+  Q     A  S+ ++I++ 
Sbjct: 2   KIGIIGVGK-ASAIIKGL--KQTPHELIISGSSLERSKEIAEQLALPYA--SHQDLIDQV 56

Query: 62  DVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNV 121
           D+V L +KP + E VLK +      H               L   +G +D+ ++R +PN 
Sbjct: 57  DLVILGIKPQLFETVLKPL------HFKQPIISAAGISLQRLATFVG-QDLPLLR-IPN- 107

Query: 122 NVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFF 181
           N +I +  TAL  N  VS E    V++L +  G   DI EKDF TF ALAGSSPA++Y F
Sbjct: 108 NAQILQSSTALTGNALVSQELQARVRDLTDSFGSTFDISEKDFDTFTALAGSSPAYIYLF 167

Query: 182 IDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLA 241
           I++LA++GVK G+ K KA +I  Q VL SA  +  S ++P + +D + SPGGTT+AG L 
Sbjct: 168 IEALAKAGVKNGIPKAKALEIVTQTVLASASNLKTSSQSPHDFIDAICSPGGTTIAG-LE 226

Query: 242 MEEAGFMTSIVKGVDATISKDK 263
           +E  G   ++   +D TI K K
Sbjct: 227 LERLGLTATVSSAIDKTIDKAK 248


>2izzE [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 272

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 1   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 60

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 61  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 120

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 121 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 180

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 181 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 240

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 241 ALHVLESGGFRSLLINAVEAS 261


>2izzD [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 276

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 6   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 65

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 66  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 125

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 126 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 185

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 186 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 245

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 246 ALHVLESGGFRSLLINAVEAS 266


>2izzC [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 276

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 2   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 61

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 62  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 121

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 122 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 181

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 182 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 241

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 242 ALHVLESGGFRSLLINAVEAS 262


>2izzB [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 279

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 7   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 66

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 67  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 126

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 127 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 186

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 187 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 246

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 247 ALHVLESGGFRSLLINAVEAS 267


>2izzA [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 272

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 2   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 61

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 62  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 121

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 122 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 181

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 182 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 241

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 242 ALHVLESGGFRSLLINAVEAS 262


>2gr9A [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 277

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 3   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 62

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 63  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 122

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 123 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 182

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 183 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 242

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 243 ALHVLESGGFRSLLINAVEAS 263


>2gerA [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 277

 Score =  139 bits (351), Expect = 7e-36
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 3/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 3   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV 62

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 63  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 122

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 123 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 182

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 183 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 242

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 243 ALHVLESGGFRSLLINAVEAS 263


>2gerB [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 276

 Score =  135 bits (341), Expect = 1e-34
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 4/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 3   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKT-PHNKETV 61

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 62  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 121

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 122 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 181

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 182 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 241

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 242 ALHVLESGGFRSLLINAVEAS 262


>2gr9B [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE 1
          Length = 276

 Score =  135 bits (339), Expect = 2e-34
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 4/261 (1%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYS--QETGVSACESNSEVI 58
           M +GFIG G +A A+ +G  + GV A +  + S+   +    S  ++ GV     N E +
Sbjct: 3   MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVLT-PHNKETV 61

Query: 59  EKSDVVFLAVKPIVVEKVLKEV-KDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRT 117
           + SDV+FLAVKP ++  +L E+  D    H              E +        +++R 
Sbjct: 62  QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC 121

Query: 118 MPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAF 177
           M N  V + EG T      +   ED +L+++L   +G   ++EE        L+GS PA+
Sbjct: 122 MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY 181

Query: 178 VYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVA 237
            +  +D+LA  GVK GL ++ A ++ AQA+LG+A  +L S++ P +L D+VSSPGG T+ 
Sbjct: 182 AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH 241

Query: 238 GLLAMEEAGFMTSIVKGVDAT 258
            L  +E  GF + ++  V+A+
Sbjct: 242 ALHVLESGGFRSLLINAVEAS 262


>2rcyC [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
          Length = 251

 Score =  112 bits (280), Expect = 1e-27
 Identities = 86/265 (32%), Positives = 139/265 (52%), Gaps = 21/265 (7%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAK-NIFIHSAHKSNYEV-YSQETGVSACESNSEVI 58
           +K+GF G+G    A+  G+ +  +  K N+F +   K N  + YS         SN E+ 
Sbjct: 3   IKLGF-GLGQ-GSALAHGIANANIIKKENLFYYGPSKKNTTLNYS---------SNEELA 51

Query: 59  EKSDVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTM 118
              D++  AVKP +   VL  +K  + +               +LE++ GS++ KIV  +
Sbjct: 52  RHCDIIVCAVKPDIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WV 106

Query: 119 PNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFV 178
           PN    +GEG      N NV+  D + V ++F   G + +I+EKD     A++G  PA+V
Sbjct: 107 PNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYV 165

Query: 179 YFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAG 238
           Y FI+SL  +GVK GL+++ +  +  Q + GS ++V KSD+   +L D++ SPGG T  G
Sbjct: 166 YLFIESLIDAGVKNGLSRELSKNLVLQTIKGS-VEVKKSDQPVQQLKDNIVSPGGITAVG 224

Query: 239 LLAMEEAGFMTSIVKGVDATISKDK 263
           L ++E+  F  + V  V+A   K K
Sbjct: 225 LYSLEKNSFKYT-VNAVEAACEKSK 248


>2rcyA [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
          Length = 252

 Score =  112 bits (280), Expect = 1e-27
 Identities = 86/265 (32%), Positives = 139/265 (52%), Gaps = 21/265 (7%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAK-NIFIHSAHKSNYEV-YSQETGVSACESNSEVI 58
           +K+GF G+G    A+  G+ +  +  K N+F +   K N  + YS         SN E+ 
Sbjct: 4   IKLGF-GLGQ-GSALAHGIANANIIKKENLFYYGPSKKNTTLNYS---------SNEELA 52

Query: 59  EKSDVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTM 118
              D++  AVKP +   VL  +K  + +               +LE++ GS++ KIV  +
Sbjct: 53  RHCDIIVCAVKPDIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WV 107

Query: 119 PNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFV 178
           PN    +GEG      N NV+  D + V ++F   G + +I+EKD     A++G  PA+V
Sbjct: 108 PNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYV 166

Query: 179 YFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAG 238
           Y FI+SL  +GVK GL+++ +  +  Q + GS ++V KSD+   +L D++ SPGG T  G
Sbjct: 167 YLFIESLIDAGVKNGLSRELSKNLVLQTIKGS-VEVKKSDQPVQQLKDNIVSPGGITAVG 225

Query: 239 LLAMEEAGFMTSIVKGVDATISKDK 263
           L ++E+  F  + V  V+A   K K
Sbjct: 226 LYSLEKNSFKYT-VNAVEAACEKSK 249


>2rcyB [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
          Length = 244

 Score =  102 bits (255), Expect = 1e-24
 Identities = 70/211 (33%), Positives = 116/211 (54%), Gaps = 8/211 (3%)

Query: 53  SNSEVIEKSDVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDV 112
           S++E + +  ++  AVKP +   VL  +K  + +               +LE++ GS++ 
Sbjct: 39  SSNEELARHCIIVCAVKPDIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN- 94

Query: 113 KIVRTMPNVNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAG 172
           KIV  +PN    +GEG      N NV+  D + V ++F   G + +I+EKD     A++G
Sbjct: 95  KIV-WVPNTPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKD-DIATAISG 152

Query: 173 SSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPG 232
             PA+VY FI+SL  +GVK GL+++ +  +  Q + GS ++V KSD+   +L D++ SPG
Sbjct: 153 CGPAYVYLFIESLIDAGVKNGLSRELSKNLVLQTIKGS-VEVKKSDQPVQQLKDNIVSPG 211

Query: 233 GTTVAGLLAMEEAGFMTSIVKGVDATISKDK 263
           G T  GL ++E+  F  + V  V+A   K K
Sbjct: 212 GITAVGLYSLEKNSFKYT-VNAVEAACEKSK 241


>2rcyD [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
          Length = 239

 Score =  100 bits (250), Expect = 4e-24
 Identities = 83/263 (31%), Positives = 134/263 (50%), Gaps = 27/263 (10%)

Query: 1   MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
           +K+GF G+G    A+  G+ +  +    +F +   K     YS         SN E+I  
Sbjct: 1   IKLGF-GLGQ-GSALAHGIANANII---LFYYGPSKKTTLNYS---------SNEELI-- 44

Query: 61  SDVVFLAVKPIVVEKVLKEVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPN 120
              +  AVKP +   VL  +K  + +               +LE++ GS++ KIV  +PN
Sbjct: 45  ---IVCAVKPDIAGSVLNNIKPYLSSK--LLISICGGLNIGKLEEV-GSEN-KIV-WVPN 96

Query: 121 VNVEIGEGMTALHKNDNVSDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYF 180
               +GEG      N NV+  D + V ++F   G + +I+EKD     A++G  PA+VY 
Sbjct: 97  TPCLVGEGSFIYCSNKNVNSTDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYL 155

Query: 181 FIDSLARSGVKYGLNKQKATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLL 240
           FI+SL  +GVK GL+++ +  +  Q + GS ++V KSD+   +L D++ SPGG T  GL 
Sbjct: 156 FIESLIDAGVKNGLSRELSKNLVLQTIKGS-VEVKKSDQPVQQLKDNIVSPGGITAVGLY 214

Query: 241 AMEEAGFMTSIVKGVDATISKDK 263
           ++E+  F  + V  V+A   K K
Sbjct: 215 SLEKNSFKYT-VNAVEAACEKSK 236


>2rcyE [x.x.x] PYRROLINE CARBOXYLATE REDUCTASE
          Length = 235

 Score = 99.8 bits (247), Expect = 8e-24
 Identities = 75/245 (30%), Positives = 122/245 (49%), Gaps = 24/245 (9%)

Query: 20  MSKGVEAKNIFIHSAHKSNYEV-YSQETGVSACESNSEVIEKSDVVFLAVKPIVVEKVLK 78
           ++ G+   N+F +   K N  + YS         SN E      ++  AVKP +   VL 
Sbjct: 11  LAHGIANANLFYYGPSKKNTTLNYS---------SNEEA---RHIIVCAVKPDIAGSVLN 58

Query: 79  EVKDSVLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNV 138
            +K  + +               +LE++ GS     +  +PN    +GEG      N NV
Sbjct: 59  NIKPYLSSK--LLISICGGLNIGKLEEV-GS-----IVWVPNTPCLVGEGSFIYCSNKNV 110

Query: 139 SDEDYQLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQK 198
           +  D + V ++F   G + +I+EKD     A++G  PA+VY FI+SL  +GVK GL+++ 
Sbjct: 111 NSTDKKYVNDIFNSCGIIHEIKEKD-DIATAISGCGPAYVYLFIESLIDAGVKNGLSREL 169

Query: 199 ATQIAAQAVLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDAT 258
           +  +  Q + GS ++V KSD+   +L D++ SPGG T  GL ++E+  F  + V  V+A 
Sbjct: 170 SKNLVLQTIKGS-VEVKKSDQPVQQLKDNIVSPGGITAVGLYSLEKNSFKYT-VNAVEAA 227

Query: 259 ISKDK 263
             K K
Sbjct: 228 CEKSK 232


>3gt0A [x.x.x] PYRROLINE-5-CARBOXYLATE REDUCTASE
          Length = 204

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 58/194 (29%), Positives = 96/194 (49%), Gaps = 13/194 (6%)

Query: 24  VEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDS 83
           V +  I     + +N +  S++ G++    N+EV + +D++ L++KP +           
Sbjct: 22  VSSNQIICSDLNTANLKNASEKYGLTTTTDNNEVAKNADILILSIKPDLYASXXXXXXXX 81

Query: 84  VLTHDPXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSDEDY 143
                             E  +   +K VK+VR +PN    +GEG +AL  N+ V+++D 
Sbjct: 82  XXXX-----VTIAAGKSIESTENAFNKKVKVVR-VPNTPALVGEG-SALCPNE-VTEKDL 133

Query: 144 QLVKELFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIA 203
           + V  +F   G+   + EK      +++GSSPA+VY  I   A + V  G   Q A + A
Sbjct: 134 EDVLNIFNSFGQTEIVSEK-LDVVTSVSGSSPAYVY--IIEAADAAVLDGPRNQ-AYKFA 189

Query: 204 AQAVLGSALKVLKS 217
           AQAVLGSA KVL++
Sbjct: 190 AQAVLGSA-KVLET 202


>1yqgA [c.2.1 - a.100.1 (1xc2A)] PYRROLINE-5-CARBOXYLATE REDUCTASE
          Length = 254

 Score = 54.3 bits (129), Expect = 4e-10
 Identities = 54/235 (22%), Positives = 107/235 (45%), Gaps = 11/235 (4%)

Query: 29  IFIHSAHKSNYEVYSQETGVSACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDSVLTHD 88
           I+I +      E   +E GV    +  E +   DV+ LAVKP   E   K ++    T+ 
Sbjct: 25  IYIANRGAEKRERLEKELGVETSATLPE-LHSDDVLILAVKP-QDEAACKNIR----TNG 78

Query: 89  PXXXXXXXXXXXAELEDILGSKDVKIVRTMPNVNVEIGEGMTALHKNDNVSDEDYQLVKE 148
                         L   LG    +IVR +PN   +IG G++  +    VS+ D ++   
Sbjct: 79  ALVLSVAAGLSVGTLSRYLGGTR-RIVR-VPNTPGKIGLGVSG-YAEAEVSETDRRIADR 135

Query: 149 LFEKIGKVADIEEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVL 208
           + + +G    +++++      ++GS PA+V++ +D+L  + ++ G + + A  ++     
Sbjct: 136 I-KSVGLTVWLDDEEKHGITGISGSGPAYVFYLLDALQNAAIRQGFDAE-ARALSLATFK 193

Query: 209 GSALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDATISKDK 263
           G+     ++ +   +L  +V+S GGTT   + A        +I +GV A + + +
Sbjct: 194 GAVALAEQTGEDFEKLQKNVTSKGGTTHEAVEAFRRHRVAEAISEGVCACVRRSQ 248


>3dojA [x.x.x] DEHYDROGENASE-LIKE PROTEIN
          Length = 292

 Score = 36.6 bits (83), Expect = 9e-05
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 1  MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
          M++GF+G+G M KA+   L+  G +   ++  +  K +  V   E G S CES +EVI+K
Sbjct: 5  MEVGFLGLGIMGKAMSMNLLKNGFKV-TVWNRTLSKCDELV---EHGASVCESPAEVIKK 60


>1i36A [c.2.1 - a.100.1] CONSERVED HYPOTHETICAL PROTEIN MTH1747
          Length = 258

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 4/70 (5%)

Query: 1  MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
          +++GFIG G +A+ +   L S+GVE     + S    +     +   V   E++ E +  
Sbjct: 1  LRVGFIGFGEVAQTLASRLRSRGVEV----VTSLEGRSPSTIERARTVGVTETSEEDVYS 56

Query: 61 SDVVFLAVKP 70
            VV  AV P
Sbjct: 57 CPVVISAVTP 66


>1hyhC [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE
          Length = 297

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 2  KIGFIGVGNMAKAIIEGLMSKGVEAKNIFI 31
          KIG IG+GN+  A+  GL+++GV    +FI
Sbjct: 3  KIGIIGLGNVGAAVAHGLIAQGVADDYVFI 32


>1hyhB [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE
          Length = 294

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 2  KIGFIGVGNMAKAIIEGLMSKGVEAKNIFI 31
          KIG IG+GN+  A+  GL+++GV    +FI
Sbjct: 3  KIGIIGLGNVGAAVAHGLIAQGVADDYVFI 32


>1hyhA [c.2.1 - d.162.1] L-2-HYDROXYISOCAPROATE DEHYDROGENASE
          Length = 297

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 2  KIGFIGVGNMAKAIIEGLMSKGVEAKNIFI 31
          KIG IG+GN+  A+  GL+++GV    +FI
Sbjct: 3  KIGIIGLGNVGAAVAHGLIAQGVADDYVFI 32


>2gf2D [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
          Length = 294

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 1  MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
          M +GFIG+GNM   + + LM  G     + I+       + + Q+ G     S ++V EK
Sbjct: 1  MPVGFIGLGNMGNPMAKNLMKHGYP---LIIYDVFPDACKEF-QDAGEQVVSSPADVAEK 56

Query: 61 SDVVFLAVKPIV--------VEKVLKEVKDSVLTHD 88
          +D +   +   +           +LK+VK   L  D
Sbjct: 57 ADRIITMLPTSINAIEAYSGANGILKKVKKGSLLID 92


>2gf2B [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
          Length = 293

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 1  MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
          M +GFIG+GNM   + + LM  G     + I+       + + Q+ G     S ++V EK
Sbjct: 1  MPVGFIGLGNMGNPMAKNLMKHGYP---LIIYDVFPDACKEF-QDAGEQVVSSPADVAEK 56

Query: 61 SDVVFLAVKPIV--------VEKVLKEVKDSVLTHD 88
          +D +   +   +           +LK+VK   L  D
Sbjct: 57 ADRIITMLPTSINAIEAYSGANGILKKVKKGSLLID 92


>2gf2A [x.x.x] 3-HYDROXYISOBUTYRATE DEHYDROGENASE
          Length = 296

 Score = 33.1 bits (74), Expect = 0.001
 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 12/96 (12%)

Query: 1  MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHKSNYEVYSQETGVSACESNSEVIEK 60
          M +GFIG+GNM   + + LM  G     + I+       + + Q+ G     S ++V EK
Sbjct: 1  MPVGFIGLGNMGNPMAKNLMKHGYP---LIIYDVFPDACKEF-QDAGEQVVSSPADVAEK 56

Query: 61 SDVVFLAVKPIV--------VEKVLKEVKDSVLTHD 88
          +D +   +   +           +LK+VK   L  D
Sbjct: 57 ADRIITMLPTSINAIEAYSGANGILKKVKKGSLLID 92


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.330    0.146    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 950,946,010
Number of extensions: 39962717
Number of successful extensions: 105606
Number of sequences better than 1.0e-03: 1959
Number of HSP's gapped: 102858
Number of HSP's successfully gapped: 2337
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)