BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE00286.1 lsal0 rluD.4 GIB00337CH01 "Ribosomal large subunit
pseudouridine synthase D"
         (296 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1v9fA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D       99   2e-23
2istA [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D         99   2e-23
1xpiB [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C         97   5e-23
1xpiA [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C         96   1e-22
2i82A [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A         89   1e-20
1v9kA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C       89   2e-20
2i82C [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A         87   5e-20
2i82B [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A         87   8e-20
1qyuA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D       83   1e-18
1przA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D       70   8e-15
3dh3C [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F         44   8e-07
3dh3B [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F         44   8e-07
3dh3A [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F         44   8e-07

>1v9fA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
          Length = 250

 Score = 99.0 bits (245), Expect = 2e-23
 Identities = 76/230 (33%), Positives = 110/230 (47%), Gaps = 17/230 (7%)

Query: 76  PLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRD 135
           PLDI+Y        +KP  L   PG  N   T++N +  H +   +      ++ RLD+D
Sbjct: 7   PLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKD 65

Query: 136 TSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQM- 194
           T+GL++VAK   AQ  + + ++   I ++Y AV  G +T   G +D+P+         M 
Sbjct: 66  TTGLMVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMA 124

Query: 195 VTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR--- 251
           V   GK A T Y + E+     T       TGRTHQIR H + I H LVGD +YGGR   
Sbjct: 125 VHPMGKPAVTHYRIMEHFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRPRP 183

Query: 252 ----------LDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLI 291
                          +RQALHA  L    P +  E  + + +P+D+  LI
Sbjct: 184 PKGASEAFISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELI 233


>2istA [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
          Length = 321

 Score = 99.0 bits (245), Expect = 2e-23
 Identities = 76/230 (33%), Positives = 110/230 (47%), Gaps = 17/230 (7%)

Query: 76  PLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRD 135
           PLDI+Y        +KP  L   PG  N   T++N +  H +   +      ++ RLD+D
Sbjct: 79  PLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKD 137

Query: 136 TSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQM- 194
           T+GL++VAK   AQ  + + ++   I ++Y AV  G +T   G +D+P+         M 
Sbjct: 138 TTGLMVVAKTVPAQTRLVESLQRREITREYEAVAIGHMTAG-GTVDEPISRHPTKRTHMA 196

Query: 195 VTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR--- 251
           V   GK A T Y + E+     T       TGRTHQIR H + I H LVGD +YGGR   
Sbjct: 197 VHPMGKPAVTHYRIMEHFRVH-TXXXXXXETGRTHQIRVHMAHITHPLVGDPVYGGRPRP 255

Query: 252 ----------LDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLI 291
                          +RQALHA  L    P +  E  + + +P+D+  LI
Sbjct: 256 PKGASEAFISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELI 305


>1xpiB [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
          Length = 229

 Score = 97.4 bits (241), Expect = 5e-23
 Identities = 77/229 (33%), Positives = 115/229 (50%), Gaps = 17/229 (7%)

Query: 79  IIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSG 138
           I+YED + LV++KP   ++V G S  +  ++  ++    + +  +LV     RLDRDTSG
Sbjct: 7   ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTSG 61

Query: 139 LVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQ---MV 195
           ++LVAK R A   +++Q+ E  + K YLA+V G        +  PL       G+    V
Sbjct: 62  VLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRV 121

Query: 196 TDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR---- 251
           +  GK ++T + V E     ATLV C   TGRTHQIR H     H +  D+ YG R    
Sbjct: 122 SQEGKPSETRFKVEERYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFDR 180

Query: 252 ----LDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVRLKN 296
                  GL R  LHA  L +  P T E    ++ M + L+  + +L+N
Sbjct: 181 QLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKRCLQKLRN 229


>1xpiA [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
          Length = 229

 Score = 95.9 bits (237), Expect = 1e-22
 Identities = 76/229 (33%), Positives = 116/229 (50%), Gaps = 19/229 (8%)

Query: 79  IIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSG 138
           I+YED + LV++KP   ++V G S  +  ++  ++      +++ L   ++ RLDRDTSG
Sbjct: 7   ILYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLR----ALRARFL--ELVHRLDRDTSG 59

Query: 139 LVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQ---MV 195
           ++LVAK R A   +++Q+ E  + K YLA+V G        +  PL       G+    V
Sbjct: 60  VLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRV 119

Query: 196 TDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR---- 251
           +  GK ++T + V E     ATLV C   TGRTHQIR H     H +  D+ YG R    
Sbjct: 120 SQEGKPSETRFKVEERYA-FATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFDR 178

Query: 252 ----LDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVRLKN 296
                  GL R  LHA  L +  P T E    ++ M + L+  + +L+N
Sbjct: 179 QLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKRCLQKLRN 227


>2i82A [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
          Length = 209

 Score = 89.4 bits (220), Expect = 1e-20
 Identities = 70/203 (34%), Positives = 104/203 (51%), Gaps = 21/203 (10%)

Query: 68  ENVKMSKEP-LDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVP 126
           EN    +EP L I+Y+D + +VV+KP  L SVPG        V R++    Q +S     
Sbjct: 1   ENYNPPQEPWLVILYQDDH-IVVNKPSGLLSVPGRLEEHKDSVTRIQRDYPQAES----- 54

Query: 127 HVITRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPL-- 184
             + RLD  TSG+++VA  + A+  + +Q  E    K+Y+A V G  +   G++D PL  
Sbjct: 55  --VHRLDA-TSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLIC 111

Query: 185 ----GPRENGIGQMVTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINH 240
                P++    ++  +TGK A+TEY V EY  D    V  K  TGR+HQ+R H  ++ H
Sbjct: 112 DWPNRPKQ----KVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQLRVHL-ALGH 166

Query: 241 ALVGDELYGGRLDWGLERQALHA 263
            ++GD  Y         R  LHA
Sbjct: 167 PILGDRFYASPEARAAPRLLLHA 189


>1v9kA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
          Length = 222

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 74/212 (34%), Positives = 106/212 (50%), Gaps = 18/212 (8%)

Query: 78  DIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTS 137
           D+IYED + LV++KP   ++V G S  +  ++  ++    + +  +LV     RLDRDTS
Sbjct: 1   DVIYEDDHILVLNKPSG-TAVHGGSGLSFGVIEGLRALRPEARFLELVH----RLDRDTS 55

Query: 138 GLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQM--- 194
           G++LVAK R A   +++Q+ E    K YLA+V G        +  PL       G+    
Sbjct: 56  GVLLVAKKRSALRSLHEQLREKG-QKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVR 114

Query: 195 VTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR--- 251
           V+  GK ++T + V E     ATLV C   TGRTHQIR H     H +  D+ YG R   
Sbjct: 115 VSQEGKPSETRFKVEERYAF-ATLVRCSPVTGRTHQIRVHTQYAGHPIAFDDRYGDREFD 173

Query: 252 -----LDWGLERQALHAYQLAYVDPFTQEEKL 278
                   GL R  LHA  L +  P T E ++
Sbjct: 174 RQLTEAGTGLNRLFLHAAALKFTHPGTGEVRI 205


>2i82C [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
          Length = 208

 Score = 87.4 bits (215), Expect = 5e-20
 Identities = 69/202 (34%), Positives = 103/202 (50%), Gaps = 21/202 (10%)

Query: 69  NVKMSKEP-LDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPH 127
           N    +EP L I+Y+D + +VV+KP  L SVPG        V R++    Q +S      
Sbjct: 1   NYNPPQEPWLVILYQDDH-IVVNKPSGLLSVPGRLEEHKDSVTRIQRDYPQAES------ 53

Query: 128 VITRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPL--- 184
            + RLD  TSG+++VA  + A+  + +Q  E    K+Y+A V G  +   G++D PL   
Sbjct: 54  -VHRLDA-TSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICD 111

Query: 185 ---GPRENGIGQMVTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHA 241
               P++    ++  +TGK A+TEY V EY  D    V  K  TGR+HQ+R H  ++ H 
Sbjct: 112 WPNRPKQ----KVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQLRVHL-ALGHP 166

Query: 242 LVGDELYGGRLDWGLERQALHA 263
           ++GD  Y         R  LHA
Sbjct: 167 ILGDRFYASPEARAAPRLLLHA 188


>2i82B [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
          Length = 207

 Score = 86.7 bits (213), Expect = 8e-20
 Identities = 68/197 (34%), Positives = 102/197 (51%), Gaps = 21/197 (10%)

Query: 74  KEP-LDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRL 132
           +EP L I+Y+D + +VV+KP  L SVPG        V R++    Q +S       + RL
Sbjct: 5   QEPWLVILYQDDH-IVVNKPSGLLSVPGRLEEHKDSVTRIQRDYPQAES-------VHRL 56

Query: 133 DRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPL------GP 186
           D  TSG+++VA  + A+  + +Q  E    K+Y+A V G  +   G++D PL       P
Sbjct: 57  DA-TSGVIVVALTKAAERELKRQFREREPKKQYVARVWGHPSPAEGLVDLPLICDWPNRP 115

Query: 187 RENGIGQMVTDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDE 246
           ++    ++  +TGK A+TEY V EY  D    V  K  TGR+HQ+R H  ++ H ++GD 
Sbjct: 116 KQ----KVCYETGKPAQTEYEVVEYAADNTARVVLKPITGRSHQLRVHL-ALGHPILGDR 170

Query: 247 LYGGRLDWGLERQALHA 263
            Y         R  LHA
Sbjct: 171 FYASPEARAAPRLLLHA 187


>1qyuA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
          Length = 241

 Score = 82.8 bits (203), Expect = 1e-18
 Identities = 75/231 (32%), Positives = 108/231 (46%), Gaps = 22/231 (9%)

Query: 76  PLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRD 135
           PLDI+Y        +KP  L   PG  N   T++N +  H +   +      ++ RLD+D
Sbjct: 7   PLDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKD 65

Query: 136 TSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMV 195
           T+GLV VAK   AQ  + + ++   I ++Y AV  G      G +D+P+          V
Sbjct: 66  TTGLV-VAKTVPAQTRLVESLQRREITREYEAVAIGHTAG--GTVDEPISRHPTKRTHAV 122

Query: 196 TDTGKIAKTEYWVREYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR---- 251
              GK A T Y +  +     T       TGRTHQIR H + I H LVGD +YGGR    
Sbjct: 123 HPMGKPAVTHYRIEHFRVH--TXXXXXXETGRTHQIRVH-AHITHPLVGDPVYGGRPRPP 179

Query: 252 ---------LDWGLERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVR 293
                         +RQALHA  L    P +  E+ + + +P+D+E + VR
Sbjct: 180 KGASEAFISTLRKFDRQALHA-TLRLYHPISGIEE-WHAPIPQDVELIEVR 228


>1przA [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
          Length = 242

 Score = 70.1 bits (170), Expect = 8e-15
 Identities = 70/217 (32%), Positives = 102/217 (47%), Gaps = 23/217 (10%)

Query: 90  DKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVITRLDRDTSGLVLVAKHRFAQ 149
           +KP  L   PG  N   T++N +  H +   +      ++ RLD+DT+GLV VAK   AQ
Sbjct: 23  NKPRDLVVHPGAGNPDGTVLNAL-LHYYPPIADVPRAGIVHRLDKDTTGLV-VAKTVPAQ 80

Query: 150 GLINKQVEEHSIDKKYLAVVEGIITEKHGIIDKPLGPRENGIGQMVTDTGKIAKTEYWVR 209
             + + ++   I ++Y AV  G      G +D+P+          V   GK A T Y + 
Sbjct: 81  TRLVESLQRREITREYEAVAIGHTAG--GTVDEPISRHPTKRTHAV-HPGKPAVTHYRIE 137

Query: 210 EYLGDKATLVECKLHTGRTHQIRAHFSSINHALVGDELYGGR-------------LDWGL 256
            +     T       TGRTHQIR H + I H LVGD +YGGR                  
Sbjct: 138 HFRVH--TXXXXXXETGRTHQIRVH-AHITHPLVGDPVYGGRPRPPKGASEAFISTLRKF 194

Query: 257 ERQALHAYQLAYVDPFTQEEKLFKSEMPKDLENLIVR 293
           +RQALHA  L    P +  E+ + + +P+D+E + VR
Sbjct: 195 DRQALHA-TLRLYHPISGIEE-WHAPIPQDVELIEVR 229


>3dh3C [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
          Length = 239

 Score = 43.5 bits (101), Expect = 8e-07
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 10  DEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDEN 69
           D  + L K++   G+  R  +      G V ++GK+ ++  +V  G +       K +  
Sbjct: 1   DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQ 54

Query: 70  VKMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVI 129
           +   +E  D++      + ++KP  + S      R D +V+ V        SK + P  I
Sbjct: 55  LIEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--I 100

Query: 130 TRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEK 176
            RLD+D+ GL+ +  H      I +   +H  +K+YL  V+  ITE+
Sbjct: 101 GRLDKDSQGLIFLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE 145


>3dh3B [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
          Length = 241

 Score = 43.5 bits (101), Expect = 8e-07
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 10  DEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDEN 69
           D  + L K++   G+  R  +      G V ++GK+ ++  +V  G +       K +  
Sbjct: 2   DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQ 55

Query: 70  VKMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVI 129
           +   +E  D++      + ++KP  + S      R D +V+ V        SK + P  I
Sbjct: 56  LIEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--I 101

Query: 130 TRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEK 176
            RLD+D+ GL+ +  H      I +   +H  +K+YL  V+  ITE+
Sbjct: 102 GRLDKDSQGLIFLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE 146


>3dh3A [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE F
          Length = 240

 Score = 43.5 bits (101), Expect = 8e-07
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 10  DEKMTLKKFLKNKGVSHRTLSSLKKGNGKVLVDGKKRSLSIEVGKGKITLILPPEKSDEN 69
           D  + L K++   G+  R  +      G V ++GK+ ++  +V  G +       K +  
Sbjct: 1   DSSVRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQVKPGDVV------KVNGQ 54

Query: 70  VKMSKEPLDIIYEDSNWLVVDKPPLLSSVPGPSNRTDTLVNRVKFHLWQQKSKDLVPHVI 129
           +   +E  D++      + ++KP  + S      R D +V+ V        SK + P  I
Sbjct: 55  LIEPREAEDLVL-----IALNKPVGIVSTTEDGER-DNIVDFVNH------SKRVFP--I 100

Query: 130 TRLDRDTSGLVLVAKHRFAQGLINKQVEEHSIDKKYLAVVEGIITEK 176
            RLD+D+ GL+ +  H      I +   +H  +K+YL  V+  ITE+
Sbjct: 101 GRLDKDSQGLIFLTNHGDLVNKILRAGNDH--EKEYLVTVDKPITEE 145


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.137    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 795,731,974
Number of extensions: 33128687
Number of successful extensions: 85619
Number of sequences better than 1.0e-03: 2138
Number of HSP's gapped: 83464
Number of HSP's successfully gapped: 2647
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)