BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABD98844.1 lsal0 ABD98844.1 GIB00337CH01 "Glucose uptake
protein"
         (288 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YSUP_LACHE RecName: Full=Putative sugar uptake protein;               154   7e-40
Y2594_LACPL RecName: Full=Putative sugar uptake protein lp_2594;      153   2e-39
Y170_LACJO RecName: Full=Putative sugar uptake protein LJ_0170;       149   4e-38
Y169_LISMO RecName: Full=Putative sugar uptake protein lmo0169;       137   1e-34
Y212_LISIN RecName: Full=Putative sugar uptake protein lin0212;       137   2e-34
Y928_ENTFA RecName: Full=Putative sugar uptake protein EF_0928;       121   7e-30
Y2503_LACPL RecName: Full=Putative sugar uptake protein lp_2503;      110   2e-26
RBSU_STAES RecName: Full=Putative ribose uptake protein rbsU;         108   6e-26
RBSU_STAEQ RecName: Full=Putative ribose uptake protein rbsU;         107   1e-25
RBSU_ENTFA RecName: Full=Putative ribose uptake protein rbsU;         105   4e-25
GLCU_BACME RecName: Full=Probable glucose uptake protein glcU;        104   1e-24
RBSU_LACSS RecName: Full=Putative ribose uptake protein rbsU;         103   1e-24
GLCU_BACSU RecName: Full=Glucose uptake protein glcU;                 103   2e-24
RBSU_STAAN RecName: Full=Putative ribose uptake protein rbsU;         100   1e-23
RBSU_STAAM RecName: Full=Putative ribose uptake protein rbsU;         100   1e-23
RBSU_STAAW RecName: Full=Putative ribose uptake protein rbsU;         100   2e-23
RBSU_STAAS RecName: Full=Putative ribose uptake protein rbsU;         100   2e-23
RBSU_STAAR RecName: Full=Putative ribose uptake protein rbsU;         100   2e-23
RBSU_STAAC RecName: Full=Putative ribose uptake protein rbsU;         100   2e-23
Y220_BACC1 RecName: Full=Putative sugar uptake protein BCE_0220;       99   6e-23
Y219_BACCR RecName: Full=Putative sugar uptake protein BC_0219;        99   6e-23
Y200_BACAN RecName: Full=Putative sugar uptake protein BA_0200/G...    98   8e-23
Y215_LISIN RecName: Full=Putative sugar uptake protein lin0215;        97   2e-22
Y176_LISMO RecName: Full=Putative sugar uptake protein lmo0176;        95   7e-22
GLCU_STAES RecName: Full=Probable glucose uptake protein glcU;         91   2e-20
GLCU_STAEQ RecName: Full=Probable glucose uptake protein glcU;         91   2e-20
YXFA_LACLA RecName: Full=Putative sugar uptake protein yxfA;           90   2e-20
GLCU_STAAW RecName: Full=Probable glucose uptake protein glcU;         89   4e-20
GLCU_STAAS RecName: Full=Probable glucose uptake protein glcU;         89   4e-20
GLCU_STAAR RecName: Full=Probable glucose uptake protein glcU;         89   4e-20
GLCU_STAAN RecName: Full=Probable glucose uptake protein glcU;         89   4e-20
GLCU_STAAM RecName: Full=Probable glucose uptake protein glcU;         89   4e-20
GLCU_STAAC RecName: Full=Probable glucose uptake protein glcU;         89   4e-20
RBSU_LACPL RecName: Full=Putative ribose uptake protein rbsU;          89   5e-20
RBSU_LACJO RecName: Full=Putative ribose uptake protein rbsU;          87   1e-19
GLCU_BACCR RecName: Full=Probable glucose uptake protein glcU;         87   1e-19
GLCU_BACC1 RecName: Full=Probable glucose uptake protein glcU;         87   2e-19
GLCU_STAXY RecName: Full=Glucose uptake protein glcU;                  85   9e-19
GLCU_BACAN RecName: Full=Probable glucose uptake protein glcU;         85   9e-19
Y2157_STRA5 RecName: Full=Putative sugar uptake protein SAG2157;       82   6e-18
Y2116_STRA3 RecName: Full=Putative sugar uptake protein gbs2116;       82   6e-18
YSUP_LACDL RecName: Full=Putative sugar uptake protein;Flags: Fr...    78   8e-17
Y2243_STRP8 RecName: Full=Putative sugar uptake protein spyM18_2...    75   5e-16
Y2205_STRP1 RecName: Full=Putative sugar uptake protein SPy_2205...    75   5e-16
Y1874_STRP6 RecName: Full=Putative sugar uptake protein M6_Spy1874;    75   5e-16
Y1856_STRP3 RecName: Full=Putative sugar uptake protein SpyM3_18...    75   5e-16
Y444_LISIN RecName: Full=Putative sugar uptake protein lin0444;        68   1e-13
Y424_LISMO RecName: Full=Putative sugar uptake protein lmo0424;        68   1e-13

>YSUP_LACHE RecName: Full=Putative sugar uptake protein;
          Length = 280

 Score =  154 bits (390), Expect = 7e-40
 Identities = 108/268 (40%), Positives = 144/268 (53%), Gaps = 7/268 (2%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGG-PANQXXXXXXXXXXXXXXXFAIMHPTITASAFI 59
           MNI+IALIPA+ WGIF LIA K     PAN+                     +   + F 
Sbjct: 1   MNILIALIPALGWGIFSLIAGKIKNSHPANELMXXXXXXXXXXXXXXXXHPASSNITIFS 60

Query: 60  WAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKX 119
            + ++G    +GQ GQFISM+   +G++ TMP+S GFQL+GN+LIG +  G W+ ++   
Sbjct: 61  LSLISGMFCALGQSGQFISMR--NIGISKTMPLSTGFQLIGNTLIGAIIFGEWTSSSQYL 118

Query: 120 XXXXXXXXXXXXXXXXXXXDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPT 179
                               D KS    ++D++ LL T+IGYWIYSSFP        +  
Sbjct: 119 IGTLALILIIVGVSLTAISKD-KSAKLKMRDIILLLFTSIGYWIYSSFPKAITA---NAQ 174

Query: 180 ALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSS 239
            L+LP+M              R+T  L  + +W                 FSAQ NG  +
Sbjct: 175 TLFLPQMXXXXXXXXXXXXXXRQTKVLKEKATWLNIFSGFSYGIAAFSYIFSAQLNGVIT 234

Query: 240 AFIYTQLSVVISTLGGMLFLHERKTSRE 267
           AFIY+QL V+ISTLGG+ F+ E KT  E
Sbjct: 235 AFIYSQLCVIISTLGGIFFIGENKTKSE 262


>Y2594_LACPL RecName: Full=Putative sugar uptake protein lp_2594;
          Length = 282

 Score =  153 bits (387), Expect = 2e-39
 Identities = 99/264 (37%), Positives = 130/264 (49%), Gaps = 10/264 (3%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASA--F 58
           M  +IA+IPA+CWGI PL+  K  G   N+               +    PT+T S   F
Sbjct: 1   MIFLIAIIPALCWGINPLLVGKINGHSENEMFGMGIGDGLIALIFWLFSQPTVTISGVTF 60

Query: 59  IWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAK 118
             A ++GA W IGQ+GQ+IS +   +GV+ TMPIS   QLVG SLIG+L  G W  +  K
Sbjct: 61  GLAMISGAAWAIGQLGQYISYR--LLGVSKTMPISTALQLVGTSLIGVLMFGEWGSSNQK 118

Query: 119 XXXXXXXXXXXXXXXXXXXXDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                                D + +  S    L LL+TTIGYWIYS  P L     V  
Sbjct: 119 ILGLLAIMLIVAGSALSAGTSDGRKKGFSC--YLPLLMTTIGYWIYSCIPKLV---KVDA 173

Query: 179 TALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTS 238
             L+LP+MLGIL  A+ +    + T     ++SW                  SA+  G +
Sbjct: 174 LQLFLPQMLGILIVAVGWAIYHQPT-VYRDKQSWQNTLPGILYGIAAFMYILSARSIGVT 232

Query: 239 SAFIYTQLSVVISTLGGMLFLHER 262
           +A+I  QLSVVISTL G+ FLHER
Sbjct: 233 NAYIIGQLSVVISTLSGLFFLHER 256


>Y170_LACJO RecName: Full=Putative sugar uptake protein LJ_0170;
          Length = 287

 Score =  149 bits (375), Expect = 4e-38
 Identities = 118/270 (43%), Positives = 160/270 (59%), Gaps = 9/270 (3%)

Query: 1   MNIIIALIPAVCWGIFPL-IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFI 59
           M  +   +PA+ WG+ PL IAS       NQ                AIMHP ++ S F+
Sbjct: 1   MKYVYLFLPAIGWGLMPLVIASVKNSTVYNQIVGTVAASFIFGAIVMAIMHPAMSWSLFL 60

Query: 60  WAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKX 119
            + + GACW IGQ+GQ+IS   E++GV+ TMPIS G QL+G  L+G+L  G WS   AK 
Sbjct: 61  LSALGGACWVIGQVGQYISY--EKIGVSETMPISTGLQLIGVPLVGVLAFGEWSSPQAKL 118

Query: 120 XXXXXXXXXXXXXXXXXXXDDNKSE---SASVKDVLFLLVTTIGYWIYSSFPNLPAVRHV 176
                              D   SE   S  V  ++ L++T++GY   SS   +P   H 
Sbjct: 119 YXXXXXXXXXXXXXXTSFTDRGTSEGNKSNQVSTIILLVLTSLGYITSSS---IPKALHG 175

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
           +  +++  +  G+L    I+   T+       + +                   S Q+NG
Sbjct: 176 NSVSIFFGQTFGMLVAVFIYTLVTKNLHVWKEKSTVQSXXXXXXXXXXXXXXXXSVQDNG 235

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSR 266
            + AF+ +QL VVISTLGG++FLHE+KT +
Sbjct: 236 VNMAFVISQLCVVISTLGGLIFLHEKKTRK 265


>Y169_LISMO RecName: Full=Putative sugar uptake protein lmo0169;
          Length = 285

 Score =  137 bits (345), Expect = 1e-34
 Identities = 87/270 (32%), Positives = 134/270 (49%), Gaps = 11/270 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           MNI+IALIPAV WGI PL+ SK GG P  Q               F   +P  TA+  I 
Sbjct: 1   MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGVFIFTNPEYTATIIIA 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
           +F++GA W++GQ+ QF +    ++GV+ TMP+S G QLVG SL G+     W GTT+K  
Sbjct: 61  SFVSGAFWSLGQMNQFRAF--TQVGVSKTMPLSTGMQLVGTSLFGVFAFHEW-GTTSKLV 117

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPAVRHVS 177
                               +K E++     K ++ LL++++G   Y  +  +     +S
Sbjct: 118 LGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIITLLISSVG---YVGYVVITRWFDIS 174

Query: 178 PTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGT 237
                LP+ +G++   L+F   + E      +++W                 FS +  G 
Sbjct: 175 GWDAILPQAIGMVVAGLLFSIKSEEKR--FTKQTWLNMIPGVMWATGNLALLFSNKLVGI 232

Query: 238 SSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
           ++ F  +Q+ VVIST+GG+LFL E+KT +E
Sbjct: 233 ATGFSLSQMGVVISTIGGILFLGEKKTKKE 262


>Y212_LISIN RecName: Full=Putative sugar uptake protein lin0212;
          Length = 285

 Score =  137 bits (344), Expect = 2e-34
 Identities = 87/270 (32%), Positives = 134/270 (49%), Gaps = 11/270 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           MNI+IALIPAV WGI PL+ SK GG P  Q               F   +P  TA+  I 
Sbjct: 1   MNIVIALIPAVMWGIMPLVVSKIGGKPRQQIIGTTFGALAFAIGVFIFTNPEYTATIIIA 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
           +F++GA W++GQ+ QF +    ++GV+ TMP+S G QLVG SL G+     W GTT+K  
Sbjct: 61  SFISGAFWSLGQMNQFRAF--TQVGVSKTMPLSTGMQLVGTSLFGVFAFHEW-GTTSKLI 117

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPAVRHVS 177
                               +K E++     K ++ LL++++G   Y  +  +     +S
Sbjct: 118 LGFSALALIIIGIFLTSYQQHKDENSGQNMKKGIVTLLISSVG---YVGYVVITRWFDIS 174

Query: 178 PTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGT 237
                LP+ +G++   L+F   + E      +++W                 FS +  G 
Sbjct: 175 GWDAILPQAIGMVVAGLLFSIKSEEKR--FTKQTWLNMIPGVMWATGNLALLFSNKLVGI 232

Query: 238 SSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
           ++ F  +Q+ VVIST+GG+LFL E+KT +E
Sbjct: 233 ATGFSLSQMGVVISTIGGILFLGEKKTKKE 262


>Y928_ENTFA RecName: Full=Putative sugar uptake protein EF_0928;
          Length = 287

 Score =  121 bits (304), Expect = 7e-30
 Identities = 78/273 (28%), Positives = 123/273 (45%), Gaps = 15/273 (5%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+++IAL+P + WG   L++ K GG    Q               F ++ PT+T +  I 
Sbjct: 1   MSLLIALVPMIAWGSIGLVSGKIGGSANQQTLGMTIGALLFSIVVFFVIQPTLTTATLIV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
            F++G  W++GQ  QF SMK   MGV+  +PIS G QLV N++ G +F   W+ T     
Sbjct: 61  GFISGLFWSLGQNQQFHSMK--YMGVSVGLPISTGMQLVVNTVAGAVFFHEWTKTKDFVV 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESAS------VKDVLFLLVTTIGYWIYSSFPNLPAVR 174
                             DD+     S       K +  L+ +T+GY +Y+   N     
Sbjct: 119 GFIALAFLVFGVYLTARQDDDSQPKTSNSMLDFNKGIRALIFSTVGYGVYTIIINATG-- 176

Query: 175 HVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQE 234
            + P  + LP+ +G+L GA  F F   +      R  W                  + +E
Sbjct: 177 -LDPWGIILPQSIGMLVGASFFAFKKVKVD----RFVWMNMTTGLLWGLGNICMLLTMRE 231

Query: 235 NGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            G + +F  +Q+ ++ISTLGG+  L ERK+ +E
Sbjct: 232 IGLAISFSLSQMGIIISTLGGIFLLGERKSKKE 264


>Y2503_LACPL RecName: Full=Putative sugar uptake protein lp_2503;
          Length = 285

 Score =  110 bits (274), Expect = 2e-26
 Identities = 76/270 (28%), Positives = 123/270 (45%), Gaps = 11/270 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M I+IALIPA+ WG   LI+ + GG    Q               +A+  PT+T+  ++ 
Sbjct: 1   MGILIALIPAIAWGSIGLISGRMGGTARQQTLGMTMGALVFGLALWAVEQPTLTSKIWLI 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
             ++G  W+IGQ  QF SMK   +G++ T PIS G QLV N+L G+L    W G      
Sbjct: 61  GIVSGLFWSIGQGQQFTSMKA--VGISRTTPISTGMQLVANALAGVLLFNEWHGNMYWIG 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESASVK---DVLFLLVTTIGYWIYSSFPNLPAVRHVS 177
                               + + SAS      +  L+++TIG   Y+ +  +    +V+
Sbjct: 119 SASVIVLIAGAVLTSLTDKTDPNRSASENWGVGIRALILSTIG---YAGYTIVVHYGNVN 175

Query: 178 PTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGT 237
             A+ +P+ +G+L GALI+ F   +      + ++                  +  + G 
Sbjct: 176 AQAVVMPQAVGMLLGALIWSF---KDKPWVVKATYRNIVTGLVWGIGNLFMFMAMAQIGQ 232

Query: 238 SSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
           + A+  +Q+ +VIST G +  L E KT RE
Sbjct: 233 AVAYSLSQMGIVISTFGSIYLLGEHKTKRE 262


>RBSU_STAES RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  108 bits (270), Expect = 6e-26
 Identities = 83/263 (31%), Positives = 123/263 (46%), Gaps = 21/263 (7%)

Query: 16  FPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITA------SAFIWAFMAGACWT 69
           FP IASK GG P NQ               FAI+             A +++ ++GA W 
Sbjct: 19  FPTIASKFGGRPVNQIFGATVGTLI-----FAIVLALFKGIGLPGGMALVFSLISGAGWA 73

Query: 70  IGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXX 129
            GQI  F +   E +G +  MPI+  FQL+G SL G+  LGNW G T K           
Sbjct: 74  FGQIITFKAF--ELVGSSRAMPITTAFQLLGASLWGVFALGNWPGITNKIIGFLALLVIL 131

Query: 130 XXXXXXXXXDDNKSE-SASVKD-VLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEML 187
                    +  + E S +++  VL LLV  IGYWIYS+    P    +     +LP+ +
Sbjct: 132 IGARMTVWTETKQQEYSKNLRSAVLLLLVGEIGYWIYSA---APQATDIGGFKAFLPQAI 188

Query: 188 GILCGALIFVFAT-RETSALTARESWXXXXXXXXXXXXXXXXXFSAQE--NGTSSAFIYT 244
           G++  A+I+      + +A   + SW                  SAQ   NG ++ F+ +
Sbjct: 189 GMVIVAVIYALMNMSKGNAFKEKVSWQQIISGFFFAFAALTYLISAQPNMNGLATGFVLS 248

Query: 245 QLSVVISTLGGMLFLHERKTSRE 267
           Q SVV++TL G+ FL+++KTS+E
Sbjct: 249 QTSVVLATLTGIFFLNQKKTSKE 271


>RBSU_STAEQ RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  107 bits (268), Expect = 1e-25
 Identities = 82/263 (31%), Positives = 123/263 (46%), Gaps = 21/263 (7%)

Query: 16  FPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITA------SAFIWAFMAGACWT 69
           FP IASK GG P NQ               FAI+             A +++ ++GA W 
Sbjct: 19  FPTIASKFGGRPVNQIFGATVGTLI-----FAIVLALFKGIGLPGGMALVFSLISGAGWA 73

Query: 70  IGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXX 129
            GQI  F +   E +G +  MPI+  FQL+G SL G+  LGNW G T K           
Sbjct: 74  FGQIITFKAF--ELVGSSRAMPITTAFQLLGASLWGVFALGNWPGITNKIIGFLALLVIL 131

Query: 130 XXXXXXXXXDDNKSE-SASVKD-VLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEML 187
                    +  + E S +++  V+ LLV  IGYWIYS+    P    +     +LP+ +
Sbjct: 132 IGARMTVWTETKQQEYSKNLRSAVILLLVGEIGYWIYSA---APQATDIGGFKAFLPQAI 188

Query: 188 GILCGALIFVFAT-RETSALTARESWXXXXXXXXXXXXXXXXXFSAQE--NGTSSAFIYT 244
           G++  A+I+      + +A   + SW                  SAQ   NG ++ F+ +
Sbjct: 189 GMVIVAVIYALMNMSKGNAFKEKVSWQQTISGFFFAFAALTYLISAQPNMNGLATGFVLS 248

Query: 245 QLSVVISTLGGMLFLHERKTSRE 267
           Q SVV++TL G+ FL+++KTS+E
Sbjct: 249 QTSVVLATLTGIFFLNQKKTSKE 271


>RBSU_ENTFA RecName: Full=Putative ribose uptake protein rbsU;
          Length = 295

 Score =  105 bits (263), Expect = 4e-25
 Identities = 83/266 (31%), Positives = 118/266 (44%), Gaps = 24/266 (9%)

Query: 16  FPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWT 69
           FP IASK GG P NQ               FA +   I   AF       ++ ++G  W 
Sbjct: 19  FPTIASKIGGRPVNQILGTSLGTLI-----FAAIFSMINGLAFPAGMDLFFSILSGVGWA 73

Query: 70  IGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXX 129
             QI  F       +G +  MP++  FQL+G SL G+ FLGNW G TAK           
Sbjct: 74  CAQIITFKCFT--MIGSSRAMPVTTAFQLLGASLWGVFFLGNWPGATAKLLGAFALVLIM 131

Query: 130 XXXXXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEML 187
                    +   +ESA +  K VL L V  IGYW YS+ P   A+  +     +LP+ +
Sbjct: 132 IGAKMTVWSETESAESAGIMKKAVLLLAVGEIGYWAYSAAPQATAIDGMH---AFLPQAI 188

Query: 188 GILCGALIF----VFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQE--NGTSSAF 241
           G++  A+I+         E S      S+                  SAQ   NG ++ F
Sbjct: 189 GMVIVAVIYSAVVTIKGGEISPFIEAVSYKQIFSGFFFAFAALTYLISAQPDMNGLATGF 248

Query: 242 IYTQLSVVISTLGGMLFLHERKTSRE 267
           I +Q SVV++TL G+ FL ++KT++E
Sbjct: 249 ILSQTSVVLATLTGIWFLGQKKTAKE 274


>GLCU_BACME RecName: Full=Probable glucose uptake protein glcU;
          Length = 286

 Score =  104 bits (259), Expect = 1e-24
 Identities = 76/272 (27%), Positives = 121/272 (44%), Gaps = 14/272 (5%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+I +A++PA+ WG   L   K GGGP +Q               +  +HPT T   F  
Sbjct: 1   MDIFLAVLPAIFWGSIVLFNVKLGGGPYSQTLGTTLGALIFSIGIYIFVHPTFTPLIFGV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTA--- 117
             ++G  W +GQ  Q  S+  + +GV+ TMPIS G QLV  SL G++    WS  T+   
Sbjct: 61  GVVSGLFWAVGQSNQLKSI--DLIGVSKTMPISTGLQLVSTSLFGVIVFHEWSTKTSIIL 118

Query: 118 --KXXXXXXXXXXXXXXXXXXXXDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRH 175
                                              ++ LL++T+GY +Y     L    +
Sbjct: 119 GVLALIFIIVGIVLASLQSXXXXXXXXXXXXXXXXIVILLISTVGYLVYVVVARL---FN 175

Query: 176 VSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQEN 235
           V   +  LP+ +G++ G ++  F  +  +    R                     S  + 
Sbjct: 176 VDGWSALLPQAIGMVIGGVLLTFKHKPFNKYAIRN----IIPGLIWAAGNMFLFISQPKV 231

Query: 236 GTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
           G +++F  +Q+ +VISTLGG++ L E+KT R+
Sbjct: 232 GVATSFSLSQMGIVISTLGGIIILGEKKTKRQ 263


>RBSU_LACSS RecName: Full=Putative ribose uptake protein rbsU;
          Length = 294

 Score =  103 bits (258), Expect = 1e-24
 Identities = 80/275 (29%), Positives = 117/275 (42%), Gaps = 14/275 (5%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMH--PTITASAF 58
           +NI+I L+P + WGIFP+I  K GG PA+Q                AI    P      F
Sbjct: 4   VNILIGLMPMIGWGIFPVIVGKIGGKPASQILGTTFGTLILAIVV-AIFRGTPIPETKTF 62

Query: 59  IWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAK 118
           I+  ++GACW + QI  F     E MGV+ TMPI+ GFQLVG SL G+  LGNWS + +K
Sbjct: 63  IFCLISGACWALAQIITFHVF--ETMGVSRTMPITTGFQLVGASLWGVFVLGNWSSSQSK 120

Query: 119 XXXXXXXXXXXXXXXXXXXXDD--NKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHV 176
                               +D                         YS+FP   +    
Sbjct: 121 LIGFTAIALIIIGVYLTAWSEDXXXXXXXXXXXXXXXXXXXXXXXXXYSAFPQAVSADGF 180

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARE--SWXXXXXXXXXXXXXXXXXFSAQE 234
                +LP+ +G+    +IF     +      +E  S+                  SAQ 
Sbjct: 181 QG---FLPQAIGMTIVGIIFGLTQTKKDYKPFKEATSYKNIFSGFFFAFAALTYLISAQP 237

Query: 235 --NGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
             NG ++ F+ +Q SV+ +T+GG+  L E+K+ +E
Sbjct: 238 SVNGLATGFVLSQTSVIFATIGGIYILKEKKSKKE 272


>GLCU_BACSU RecName: Full=Glucose uptake protein glcU;
          Length = 287

 Score =  103 bits (256), Expect = 2e-24
 Identities = 73/259 (28%), Positives = 111/259 (42%), Gaps = 13/259 (5%)

Query: 13  WGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAFMAGACWTIGQ 72
           WG   L   K GGGP +Q               +  + P ++   FI   ++G  W++GQ
Sbjct: 13  WGSIVLFNVKLGGGPYSQTLGTTIGALIVSIVIYFFVQPVLSLRIFIVGIVSGLFWSLGQ 72

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
             Q  S+  + MGV+ TMPIS G QLV  SL G++    WS   A               
Sbjct: 73  ANQLKSI--QLMGVSKTMPISTGMQLVSTSLFGVIVFREWSTPIAITLGVLALIFIIVGI 130

Query: 133 XXXXXXDDNKSE----SASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLG 188
                 D N  +    S   K +L LLV+T+GY +Y     L    +VS  +  LP+ +G
Sbjct: 131 ILTSLEDKNDKKEGEPSNLKKGILILLVSTLGYLVYVVVARL---FNVSGWSALLPQAIG 187

Query: 189 ILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSSAFIYTQLSV 248
           ++ G L+  +  +  +    R                     S    G +++F  +Q+ +
Sbjct: 188 MVVGGLVLTYRHKPFNKYAIRN----ILPGLIWAGGNMFLFISQPRVGVATSFSLSQMGI 243

Query: 249 VISTLGGMLFLHERKTSRE 267
           VISTLGG+  L E+KT R+
Sbjct: 244 VISTLGGIFILREKKTKRQ 262


>RBSU_STAAN RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  100 bits (250), Expect = 1e-23
 Identities = 75/260 (28%), Positives = 124/260 (47%), Gaps = 21/260 (8%)

Query: 19  IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWTIGQ 72
           +ASK GG P +Q               FAI+   +T+S F      ++A ++GA W  GQ
Sbjct: 22  VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQ 76

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
           I  F +   E +G +  MP++  FQL+G SL G+  LGNW G   K              
Sbjct: 77  IITFKAF--ELIGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGA 134

Query: 133 XXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGIL 190
                 +  ++ +A    + V+ LL+   GYW+YS+ P   ++  ++    +LP+ +G++
Sbjct: 135 RMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMV 191

Query: 191 CGALIFVFATRET-SALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFIYTQLS 247
             A+I+ F   ++ +    + +W                  SAQ N  G ++ FI +Q S
Sbjct: 192 IVAVIYGFMNMKSENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTS 251

Query: 248 VVISTLGGMLFLHERKTSRE 267
           VV++TL G+ FL + KTS+E
Sbjct: 252 VVLATLTGIYFLKQHKTSKE 271


>RBSU_STAAM RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  100 bits (250), Expect = 1e-23
 Identities = 75/260 (28%), Positives = 124/260 (47%), Gaps = 21/260 (8%)

Query: 19  IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWTIGQ 72
           +ASK GG P +Q               FAI+   +T+S F      ++A ++GA W  GQ
Sbjct: 22  VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQ 76

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
           I  F +   E +G +  MP++  FQL+G SL G+  LGNW G   K              
Sbjct: 77  IITFKAF--ELIGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGA 134

Query: 133 XXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGIL 190
                 +  ++ +A    + V+ LL+   GYW+YS+ P   ++  ++    +LP+ +G++
Sbjct: 135 RMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMV 191

Query: 191 CGALIFVFATRET-SALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFIYTQLS 247
             A+I+ F   ++ +    + +W                  SAQ N  G ++ FI +Q S
Sbjct: 192 IVAVIYGFMNMKSENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTS 251

Query: 248 VVISTLGGMLFLHERKTSRE 267
           VV++TL G+ FL + KTS+E
Sbjct: 252 VVLATLTGIYFLKQHKTSKE 271


>RBSU_STAAW RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  100 bits (249), Expect = 2e-23
 Identities = 75/260 (28%), Positives = 123/260 (47%), Gaps = 21/260 (8%)

Query: 19  IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWTIGQ 72
           +ASK GG P +Q               FAI+   +T+S F      ++A ++GA W  GQ
Sbjct: 22  VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQ 76

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
           I  F +   E +G +  MP++  FQL+G SL G+  LGNW G   K              
Sbjct: 77  IITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGA 134

Query: 133 XXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGIL 190
                 +  ++ +A    + V+ LL+   GYW+YS+ P   ++  ++    +LP+ +G++
Sbjct: 135 RMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMV 191

Query: 191 CGALIFVFATRET-SALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFIYTQLS 247
             A+I+ F   +  +    + +W                  SAQ N  G ++ FI +Q S
Sbjct: 192 IVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTS 251

Query: 248 VVISTLGGMLFLHERKTSRE 267
           VV++TL G+ FL + KTS+E
Sbjct: 252 VVLATLTGIYFLKQHKTSKE 271


>RBSU_STAAS RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  100 bits (249), Expect = 2e-23
 Identities = 75/260 (28%), Positives = 123/260 (47%), Gaps = 21/260 (8%)

Query: 19  IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWTIGQ 72
           +ASK GG P +Q               FAI+   +T+S F      ++A ++GA W  GQ
Sbjct: 22  VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQ 76

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
           I  F +   E +G +  MP++  FQL+G SL G+  LGNW G   K              
Sbjct: 77  IITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGA 134

Query: 133 XXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGIL 190
                 +  ++ +A    + V+ LL+   GYW+YS+ P   ++  ++    +LP+ +G++
Sbjct: 135 RMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMV 191

Query: 191 CGALIFVFATRET-SALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFIYTQLS 247
             A+I+ F   +  +    + +W                  SAQ N  G ++ FI +Q S
Sbjct: 192 IVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTS 251

Query: 248 VVISTLGGMLFLHERKTSRE 267
           VV++TL G+ FL + KTS+E
Sbjct: 252 VVLATLTGIYFLKQHKTSKE 271


>RBSU_STAAR RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  100 bits (249), Expect = 2e-23
 Identities = 75/260 (28%), Positives = 123/260 (47%), Gaps = 21/260 (8%)

Query: 19  IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWTIGQ 72
           +ASK GG P +Q               FAI+   +T+S F      ++A ++GA W  GQ
Sbjct: 22  VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQ 76

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
           I  F +   E +G +  MP++  FQL+G SL G+  LGNW G   K              
Sbjct: 77  IITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGA 134

Query: 133 XXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGIL 190
                 +  ++ +A    + V+ LL+   GYW+YS+ P   ++  ++    +LP+ +G++
Sbjct: 135 RMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMV 191

Query: 191 CGALIFVFATRET-SALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFIYTQLS 247
             A+I+ F   +  +    + +W                  SAQ N  G ++ FI +Q S
Sbjct: 192 IVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTS 251

Query: 248 VVISTLGGMLFLHERKTSRE 267
           VV++TL G+ FL + KTS+E
Sbjct: 252 VVLATLTGIYFLKQHKTSKE 271


>RBSU_STAAC RecName: Full=Putative ribose uptake protein rbsU;
          Length = 293

 Score =  100 bits (249), Expect = 2e-23
 Identities = 75/260 (28%), Positives = 123/260 (47%), Gaps = 21/260 (8%)

Query: 19  IASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWTIGQ 72
           +ASK GG P +Q               FAI+   +T+S F      ++A ++GA W  GQ
Sbjct: 22  VASKFGGKPVHQIIGATVGTLI-----FAIILAVVTSSGFPTGTNLLFALLSGAGWGFGQ 76

Query: 73  IGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXXXXX 132
           I  F +   E +G +  MP++  FQL+G SL G+  LGNW G   K              
Sbjct: 77  IITFKAF--ELVGSSRAMPVTTAFQLLGASLWGVFALGNWPGIGHKIIGFTALVVILIGA 134

Query: 133 XXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGIL 190
                 +  ++ +A    + V+ LL+   GYW+YS+ P   ++  ++    +LP+ +G++
Sbjct: 135 RMTVWSERKEASNAKNLRRAVVLLLIGEFGYWLYSAAPQATSIDGLTA---FLPQAMGMV 191

Query: 191 CGALIFVFATRET-SALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFIYTQLS 247
             A+I+ F   +  +    + +W                  SAQ N  G ++ FI +Q S
Sbjct: 192 IVAVIYGFMNMKAENPFRNKITWLQIISGFFFAFGALTYLISAQPNMNGLATGFILSQTS 251

Query: 248 VVISTLGGMLFLHERKTSRE 267
           VV++TL G+ FL + KTS+E
Sbjct: 252 VVLATLTGIYFLKQHKTSKE 271


>Y220_BACC1 RecName: Full=Putative sugar uptake protein BCE_0220;
          Length = 283

 Score = 98.6 bits (244), Expect = 6e-23
 Identities = 94/271 (34%), Positives = 146/271 (53%), Gaps = 15/271 (5%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+I++AL+PA+ WG   L++ K GGG  +Q               +    P +T +  I 
Sbjct: 1   MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIMYVFTQPALTMTILIV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
            F++G  W +GQ+ Q  ++  E++GV+TT+ IS G QLV  S+ G++    W        
Sbjct: 61  GFISGLFWALGQVNQLKTV--EKLGVSTTVTISTGMQLVATSIFGVIAFREWXXXXXXXX 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESAS--VKDVLFLLVTTIGYWIYSSFPNLPAVR--HV 176
                             D   ++      K +L L+V+T GY +Y     +  +R  ++
Sbjct: 119 XXXXXXXXXXXXXFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLVY-----VIIIRWYNI 173

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
              +  LP+ +G+  GA++     +  +    R +                        G
Sbjct: 174 DGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNA----LSXXXXXXXXXXXXXXXPRVG 229

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            +++F  +Q  +VIST G ++FL E+KT R+
Sbjct: 230 VATSFPLSQTGIVISTFGAIVFLGEKKTKRQ 260


>Y219_BACCR RecName: Full=Putative sugar uptake protein BC_0219;
          Length = 283

 Score = 98.6 bits (244), Expect = 6e-23
 Identities = 94/271 (34%), Positives = 146/271 (53%), Gaps = 15/271 (5%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+I++AL+PA+ WG   L++ K GGG  +Q               +    P +T +  I 
Sbjct: 1   MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIMYVFTQPALTMTILIV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
            F++G  W +GQ+ Q  ++  E++GV+TT+ IS G QLV  S+ G++    W        
Sbjct: 61  GFISGLFWALGQVNQLKTV--EKLGVSTTVTISTGMQLVATSIFGVIAFREWXXXXXXXX 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESAS--VKDVLFLLVTTIGYWIYSSFPNLPAVR--HV 176
                             D   ++      K +L L+V+T GY +Y     +  +R  ++
Sbjct: 119 XXXXXXXXXXXXXFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLVY-----VIIIRWYNI 173

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
              +  LP+ +G+  GA++     +  +    R +                        G
Sbjct: 174 DGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNA----LSXXXXXXXXXXXXXXXPRVG 229

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            +++F  +Q  +VIST G ++FL E+KT R+
Sbjct: 230 VATSFPLSQTGIVISTFGAIVFLGEKKTKRQ 260


>Y200_BACAN RecName: Full=Putative sugar uptake protein
           BA_0200/GBAA_0200/BAS0200;
          Length = 283

 Score = 98.2 bits (243), Expect = 8e-23
 Identities = 94/271 (34%), Positives = 145/271 (53%), Gaps = 15/271 (5%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M I++AL+PA+ WG   L++ K GGG  +Q               +    P +T +  I 
Sbjct: 1   MGILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIMYVFTQPALTMTILIV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
            F++G  W +GQ+ Q  ++  E++GV+TT+ IS G QLV  S+ G++    W        
Sbjct: 61  GFISGLFWALGQVNQLKTV--EKLGVSTTVTISTGMQLVATSIFGVIAFREWXXXXXXXX 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESAS--VKDVLFLLVTTIGYWIYSSFPNLPAVR--HV 176
                             D   ++      K +L L+V+T GY +Y     +  +R  ++
Sbjct: 119 XXXXXXXXXXXXXFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLVY-----VIIIRWYNI 173

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
              +  LP+ +G+  GA++     +  +    R +                        G
Sbjct: 174 DGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNA----LSXXXXXXXXXXXXXXXPRVG 229

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            +++F  +Q  +VIST G ++FL E+KT R+
Sbjct: 230 VATSFPLSQTGIVISTFGAIVFLGEKKTKRQ 260


>Y215_LISIN RecName: Full=Putative sugar uptake protein lin0215;
          Length = 286

 Score = 96.7 bits (239), Expect = 2e-22
 Identities = 73/268 (27%), Positives = 114/268 (42%), Gaps = 7/268 (2%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           MNI+IALIPA+ WG  PLI +K GG    Q               F    P  T      
Sbjct: 1   MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIVFFFTDPVYTLKTVGI 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
           +F+ G  WT+GQ+ Q  + K   +GV+  MPIS G QLVG +L G++    W  T     
Sbjct: 61  SFITGCLWTVGQMFQLRAFK--IIGVSKAMPISTGMQLVGTTLCGVILFHEWDTTLRIIL 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESASVKD-VLFLLVTTIGYWIYSSFPNLPAVRHVSPT 179
                             +  +  + ++K  ++ L+++++G   Y     L     +   
Sbjct: 119 GFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLVISSLG---YVGLVVLIQGFKIDGI 175

Query: 180 ALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSS 239
              LP+ +G++  ALI   +         R +                   + Q  G ++
Sbjct: 176 NAILPQAIGMVLSALIMTHSGGTEKRFNKR-TLLLIIPGMIWAAGNVAMVHANQLVGVAT 234

Query: 240 AFIYTQLSVVISTLGGMLFLHERKTSRE 267
            F  +QL VVIST+GG++ L E+KT +E
Sbjct: 235 GFSLSQLGVVISTIGGIVLLKEKKTQKE 262


>Y176_LISMO RecName: Full=Putative sugar uptake protein lmo0176;
          Length = 286

 Score = 95.1 bits (235), Expect = 7e-22
 Identities = 73/268 (27%), Positives = 111/268 (41%), Gaps = 7/268 (2%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           MNI+IALIPA+ WG  PLI +K GG    Q               F    P  T      
Sbjct: 1   MNIMIALIPALLWGTVPLIITKFGGSTRQQTMGMTLGALTFAVIVFFFTDPVYTLKTVGI 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
           +F+ G  WT+GQ+ Q  + K   +GV+  MPIS G QLVG +L G++    W  T     
Sbjct: 61  SFITGCLWTVGQMFQLQAFK--IIGVSKAMPISTGMQLVGTTLCGVILFHEWDTTLRIIL 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESASVKD-VLFLLVTTIGYWIYSSFPNLPAVRHVSPT 179
                             +  +  + ++K  ++ L ++  G   Y     L     +   
Sbjct: 119 GFIALALIVGGIFLTSYAEKEEDGTNALKQGLITLFISACG---YVGLVVLIQGFKIDGI 175

Query: 180 ALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSS 239
              LP+ +G++  ALI   +         R +                   + Q  G ++
Sbjct: 176 NAILPQAIGMVISALIMTHSGGTEKRFNKR-TLLLTIPGVIWAAGNVAMVHANQLVGVAT 234

Query: 240 AFIYTQLSVVISTLGGMLFLHERKTSRE 267
            F  +QL VVIST+GG++ L E+KT +E
Sbjct: 235 GFSLSQLGVVISTIGGIILLKEKKTQKE 262


>GLCU_STAES RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 90.5 bits (223), Expect = 2e-20
 Identities = 76/271 (28%), Positives = 113/271 (41%), Gaps = 13/271 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTI-TASAFI 59
           ++ +IAL+PA+ WG   +I    GGGP NQ                A  H      +  I
Sbjct: 4   VDFLIALLPALFWGSVVIINVFVGGGPYNQIRGTTLGTLFIGFSLLATGHAAFDNLTVII 63

Query: 60  WAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSG--TTA 117
              ++GA W  GQ  Q  S+    +GV+ TMPIS G QLVG +L   +FLG WS      
Sbjct: 64  VGLVSGALWAFGQGNQLKSV--HLIGVSKTMPISTGMQLVGTTLFSAIFLGEWSTIVQVV 121

Query: 118 KXXXXXXXXXXXXXXXXXXXXDDNKSESASVKDVL-FLLVTTIGYWIYSSFPNLPAVRHV 176
                                 + KS++   K  +  LL++TIG   Y  +  L  +  V
Sbjct: 122 MGLIAMILLVVGISLTSLKAKSEGKSDNPEFKKAMGILLLSTIG---YVGYVVLGDIFGV 178

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
           S T     + +G+  G LI       +   TA                     +S  + G
Sbjct: 179 SGTDALFFQSIGMAIGGLILSMNHNTSIKSTA----LNLIPGVIWGIGNLFMFYSQPKVG 234

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            +++F  +QL V++STLGG+  L E+K  R+
Sbjct: 235 VATSFSLSQLLVIVSTLGGIFILGEKKDRRQ 265


>GLCU_STAEQ RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 90.5 bits (223), Expect = 2e-20
 Identities = 76/271 (28%), Positives = 113/271 (41%), Gaps = 13/271 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTI-TASAFI 59
           ++ +IAL+PA+ WG   +I    GGGP NQ                A  H      +  I
Sbjct: 4   VDFLIALLPALFWGSVVIINVFVGGGPYNQIRGTTLGTLFIGFSLLATGHAAFDNLTVII 63

Query: 60  WAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSG--TTA 117
              ++GA W  GQ  Q  S+    +GV+ TMPIS G QLVG +L   +FLG WS      
Sbjct: 64  VGLVSGALWAFGQGNQLKSV--HLIGVSKTMPISTGMQLVGTTLFSAIFLGEWSTIVQVV 121

Query: 118 KXXXXXXXXXXXXXXXXXXXXDDNKSESASVKDVL-FLLVTTIGYWIYSSFPNLPAVRHV 176
                                 + KS++   K  +  LL++TIG   Y  +  L  +  V
Sbjct: 122 MGLIAMILLVVGISLTSLKAKSEGKSDNPEFKKAMGILLLSTIG---YVGYVVLGDIFGV 178

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
           S T     + +G+  G LI       +   TA                     +S  + G
Sbjct: 179 SGTDALFFQSIGMAIGGLILSMNHNTSIKSTA----LNLIPGVIWGIGNLFMFYSQPKVG 234

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            +++F  +QL V++STLGG+  L E+K  R+
Sbjct: 235 VATSFSLSQLLVIVSTLGGIFILGEKKDRRQ 265


>YXFA_LACLA RecName: Full=Putative sugar uptake protein yxfA;
          Length = 295

 Score = 90.1 bits (222), Expect = 2e-20
 Identities = 73/276 (26%), Positives = 108/276 (39%), Gaps = 20/276 (7%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           +++AL+P   WG    +A+K GG    Q               F    PT+T   F+  F
Sbjct: 4   VLLALVPMFAWGSIGFVANKFGGDAKQQTLGMTLGAFVFALIVFLFRMPTLTWQIFLIGF 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWS-------GT 115
           + G  W IGQ GQF SMK   MGV+   P+S+G QLV   LIG+     W+       G 
Sbjct: 64  IGGLLWAIGQFGQFNSMK--YMGVSVASPLSSGSQLVIGGLIGVFAFHEWTKQIQFILGF 121

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVR- 174
            A                     ++ ++ +   K +  L  +T+GY IY    N  AV  
Sbjct: 122 IAMAVLVVGFYFSAKRDPENAVVEEGRNYT---KGLTALTYSTLGYVIYVILFNNLAVLW 178

Query: 175 ---HVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFS 231
              H     + LP  +G++ GAL+             +  +                   
Sbjct: 179 FNVHFDTLTIILPMSVGMIFGALVM----GRFKIKMEKYVYQNMIVGAMWGVGNIFMLMX 234

Query: 232 AQENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
                        QL V++ST+GG+LFL E+KT +E
Sbjct: 235 XXXXXXXXXXXXXQLGVIVSTIGGILFLGEKKTKKE 270


>GLCU_STAAW RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 89.4 bits (220), Expect = 4e-20
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 21/275 (7%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXX----FA-IMHPTITA 55
           ++ +IAL+PA+ WG   LI    GGGP NQ                   FA   +PT+  
Sbjct: 4   LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXXXXXFAKFNNPTV-- 61

Query: 56  SAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGT 115
              I   ++GA W  GQ  Q  S+    +GV+ TMP+S G QLVG +L  ++FLG WS  
Sbjct: 62  --IIVGLISGALWAFGQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSM 117

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPA 172
           T                        N+ +S +    K +  L+V+T+G   Y  F  L  
Sbjct: 118 TQIIFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVG---YVGFVVLGD 174

Query: 173 VRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSA 232
           +  V  T     + +G+  G  I     + +   TA                     +S 
Sbjct: 175 IFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA----LNLLPGVIWGIGNLFMFYSQ 230

Query: 233 QENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            + G +++F  +QL V++STLGG+  L ERK  R+
Sbjct: 231 PKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ 265


>GLCU_STAAS RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 89.4 bits (220), Expect = 4e-20
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 21/275 (7%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXX----FA-IMHPTITA 55
           ++ +IAL+PA+ WG   LI    GGGP NQ                   FA   +PT+  
Sbjct: 4   LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXXXXXFAKFNNPTV-- 61

Query: 56  SAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGT 115
              I   ++GA W  GQ  Q  S+    +GV+ TMP+S G QLVG +L  ++FLG WS  
Sbjct: 62  --IIVGLISGALWAFGQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSM 117

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPA 172
           T                        N+ +S +    K +  L+V+T+G   Y  F  L  
Sbjct: 118 TQIIFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVG---YVGFVVLGD 174

Query: 173 VRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSA 232
           +  V  T     + +G+  G  I     + +   TA                     +S 
Sbjct: 175 IFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA----LNLLPGVIWGIGNLFMFYSQ 230

Query: 233 QENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            + G +++F  +QL V++STLGG+  L ERK  R+
Sbjct: 231 PKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ 265


>GLCU_STAAR RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 89.4 bits (220), Expect = 4e-20
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 21/275 (7%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXX----FA-IMHPTITA 55
           ++ +IAL+PA+ WG   LI    GGGP NQ                   FA   +PT+  
Sbjct: 4   LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXXXXXFAKFNNPTV-- 61

Query: 56  SAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGT 115
              I   ++GA W  GQ  Q  S+    +GV+ TMP+S G QLVG +L  ++FLG WS  
Sbjct: 62  --IIVGLISGALWAFGQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSM 117

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPA 172
           T                        N+ +S +    K +  L+V+T+G   Y  F  L  
Sbjct: 118 TQIIFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVG---YVGFVVLGD 174

Query: 173 VRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSA 232
           +  V  T     + +G+  G  I     + +   TA                     +S 
Sbjct: 175 IFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA----LNLLPGVIWGIGNLFMFYSQ 230

Query: 233 QENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            + G +++F  +QL V++STLGG+  L ERK  R+
Sbjct: 231 PKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ 265


>GLCU_STAAN RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 89.4 bits (220), Expect = 4e-20
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 21/275 (7%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXX----FA-IMHPTITA 55
           ++ +IAL+PA+ WG   LI    GGGP NQ                   FA   +PT+  
Sbjct: 4   LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXXXXXFAKFNNPTV-- 61

Query: 56  SAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGT 115
              I   ++GA W  GQ  Q  S+    +GV+ TMP+S G QLVG +L  ++FLG WS  
Sbjct: 62  --IIVGLISGALWAFGQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSM 117

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPA 172
           T                        N+ +S +    K +  L+V+T+G   Y  F  L  
Sbjct: 118 TQIIFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVG---YVGFVVLGD 174

Query: 173 VRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSA 232
           +  V  T     + +G+  G  I     + +   TA                     +S 
Sbjct: 175 IFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA----LNLLPGVIWGIGNLFMFYSQ 230

Query: 233 QENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            + G +++F  +QL V++STLGG+  L ERK  R+
Sbjct: 231 PKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ 265


>GLCU_STAAM RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 89.4 bits (220), Expect = 4e-20
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 21/275 (7%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXX----FA-IMHPTITA 55
           ++ +IAL+PA+ WG   LI    GGGP NQ                   FA   +PT+  
Sbjct: 4   LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXXXXXFAKFNNPTV-- 61

Query: 56  SAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGT 115
              I   ++GA W  GQ  Q  S+    +GV+ TMP+S G QLVG +L  ++FLG WS  
Sbjct: 62  --IIVGLISGALWAFGQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSM 117

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPA 172
           T                        N+ +S +    K +  L+V+T+G   Y  F  L  
Sbjct: 118 TQIIFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVG---YVGFVVLGD 174

Query: 173 VRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSA 232
           +  V  T     + +G+  G  I     + +   TA                     +S 
Sbjct: 175 IFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA----LNLLPGVIWGIGNLFMFYSQ 230

Query: 233 QENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            + G +++F  +QL V++STLGG+  L ERK  R+
Sbjct: 231 PKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ 265


>GLCU_STAAC RecName: Full=Probable glucose uptake protein glcU;
          Length = 287

 Score = 89.4 bits (220), Expect = 4e-20
 Identities = 91/275 (33%), Positives = 130/275 (47%), Gaps = 21/275 (7%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXX----FA-IMHPTITA 55
           ++ +IAL+PA+ WG   LI    GGGP NQ                   FA   +PT+  
Sbjct: 4   LDFLIALLPALFWGSVVLINVFVGGGPYNQIRXXXXXXXXXXXXXXXXXFAKFNNPTV-- 61

Query: 56  SAFIWAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGT 115
              I   ++GA W  GQ  Q  S+    +GV+ TMP+S G QLVG +L  ++FLG WS  
Sbjct: 62  --IIVGLISGALWAFGQANQLKSIS--LIGVSNTMPVSTGMQLVGTTLFSVIFLGEWSSM 117

Query: 116 TAKXXXXXXXXXXXXXXXXXXXXDDNKSESAS---VKDVLFLLVTTIGYWIYSSFPNLPA 172
           T                        N+ +S +    K +  L+V+T+G   Y  F  L  
Sbjct: 118 TQIIFGLIAMILLVTGVALTSLKAKNERQSDNPEFKKAMGILIVSTVG---YVGFVVLGD 174

Query: 173 VRHVSPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSA 232
           +  V  T     + +G+  G  I     + +   TA                     +S 
Sbjct: 175 IFGVGGTDALFFQSVGMAIGGFILSMNHKTSLKSTA----LNLLPGVIWGIGNLFMFYSQ 230

Query: 233 QENGTSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            + G +++F  +QL V++STLGG+  L ERK  R+
Sbjct: 231 PKVGVATSFSLSQLLVIVSTLGGIFILGERKDRRQ 265


>RBSU_LACPL RecName: Full=Putative ribose uptake protein rbsU;
          Length = 294

 Score = 89.0 bits (219), Expect = 5e-20
 Identities = 87/265 (32%), Positives = 133/265 (50%), Gaps = 23/265 (8%)

Query: 16  FPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF-----IW-AFMAGACWT 69
           +P IASK GG P NQ               FA+++  +   AF     +W + ++G  W 
Sbjct: 19  YPTIASKIGGRPVNQILGSTIGTLI-----FALIYAWVQGIAFPSGMNLWFSILSGIGWA 73

Query: 70  IGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXX 129
             QI  F       +G +  MPI+  FQL+G SL G+  LG+W G   K           
Sbjct: 74  SAQIVTFKVFT--MVGSSRAMPITTAFQLLGASLWGVFALGDWPGAMDKXXXXXXXXXXX 131

Query: 130 XXXXXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEML 187
                    +   + +A    + V++L V  IGYW YS+ P      ++     ++P+ +
Sbjct: 132 XXXWLTVWSEHKDAGNARTLRQAVIWLAVGEIGYWAYSAAPQ---ATNIGGEEAFVPQAI 188

Query: 188 GILCGALI---FVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSAFI 242
           G++  +++   F+ +  E  AL    S+                  SAQ N  G ++ FI
Sbjct: 189 GMVIVSIVYALFLASRGEKLALVEGVSYTHIISGFFFAFAALTYLISAQPNMNGLATGFI 248

Query: 243 YTQLSVVISTLGGMLFLHERKTSRE 267
            +Q SVV++TL G+ FL ++KT++E
Sbjct: 249 LSQTSVVLATLTGIWFLGQKKTTKE 273


>RBSU_LACJO RecName: Full=Putative ribose uptake protein rbsU;
          Length = 296

 Score = 87.4 bits (215), Expect = 1e-19
 Identities = 84/267 (31%), Positives = 120/267 (44%), Gaps = 25/267 (9%)

Query: 16  FPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAF------IWAFMAGACWT 69
           FP IASK GG P NQ               FA+++  +   A                  
Sbjct: 19  FPTIASKIGGKPVNQIIGTTFGTFI-----FALVYNLVQGIALPXXXXXXXXXXXXXXXX 73

Query: 70  IGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXXXXXXXX 129
             QI  F S     +G +  MPI+  FQL+G SL G+  LG+W  T+ K           
Sbjct: 74  XXQILTFHSFT--LVGSSRAMPITTAFQLLGTSLWGVFALGDWPSTSDKLVGFXXXXXXX 131

Query: 130 XXXXXXXXXDDNKSESASV--KDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEML 187
                    +    E+++   K V+ LLV  IGYW YS+ P       +  +  +LP+ +
Sbjct: 132 XGAWMTTWSEHKTDENSAKLRKAVIILLVGEIGYWAYSAAPQ---AAKIDGSKAFLPQAI 188

Query: 188 GILCGALIFVFATR-----ETSALTARESWXXXXXXXXXXXXXXXXXFSAQEN--GTSSA 240
           G+   A+ +    +     + SAL    S+                  SAQ N  G ++ 
Sbjct: 189 GMCLVAICYAVYLKVKEPSQRSALAQGVSYKQIISGFFFAFAALTYLISAQPNMNGLATG 248

Query: 241 FIYTQLSVVISTLGGMLFLHERKTSRE 267
           FI +Q SVV++TL G+ FLHE+KT +E
Sbjct: 249 FILSQTSVVLATLTGIWFLHEKKTKKE 275


>GLCU_BACCR RecName: Full=Probable glucose uptake protein glcU;
          Length = 286

 Score = 87.4 bits (215), Expect = 1e-19
 Identities = 56/202 (27%), Positives = 93/202 (46%), Gaps = 9/202 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+I +A++PA+ WG   L   K GGGP +Q               +  M P +T +    
Sbjct: 2   MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGV 61

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
             ++G  W +GQ  Q  S+  + MGV+ TMPIS G QLV  +L G++    WS T +   
Sbjct: 62  GVVSGLFWALGQANQLKSI--DLMGVSRTMPISTGLQLVATTLFGVIVFHEWSTTISVVL 119

Query: 121 XXXXXXXXXXXXXXXXXXDD---NKSESASVK-DVLFLLVTTIGYWIYSSFPNLPAVRHV 176
                              +   N  ++A+ K  ++ LL++T+GY +Y     L    +V
Sbjct: 120 GILALVCIIIGVILTSLQSEEEKNAEQAANFKRGIVILLISTVGYLVYVVVIRL---FNV 176

Query: 177 SPTALYLPEMLGILCGALIFVF 198
              +  LP+ +G++ G ++  F
Sbjct: 177 DGWSALLPQAVGMVLGGILLTF 198


>GLCU_BACC1 RecName: Full=Probable glucose uptake protein glcU;
          Length = 285

 Score = 87.0 bits (214), Expect = 2e-19
 Identities = 53/202 (26%), Positives = 90/202 (44%), Gaps = 9/202 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+I +A++PA+ WG   L   K GGGP +Q               +  M P +T +    
Sbjct: 1   MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXX 120
             ++G  W +GQ  Q  S+  + MGV+ TMPIS G QLV  +L G++    WS T +   
Sbjct: 61  GIVSGLFWALGQANQLKSI--DLMGVSRTMPISTGLQLVATTLFGVIVFHEWSTTISVVL 118

Query: 121 XXXXXXXXXXXXXXXXXXDDNKSESASV----KDVLFLLVTTIGYWIYSSFPNLPAVRHV 176
                              + +  +       + ++ LL++T+GY +Y     L    +V
Sbjct: 119 GVLALVCIIIGVILTSLQSEEEKNAEQAGNFKRGIIILLISTVGYLVYVVVIRL---FNV 175

Query: 177 SPTALYLPEMLGILCGALIFVF 198
              +  LP+ +G++ G ++  F
Sbjct: 176 DGWSALLPQAVGMVLGGILLTF 197


>GLCU_STAXY RecName: Full=Glucose uptake protein glcU;
          Length = 288

 Score = 84.7 bits (208), Expect = 9e-19
 Identities = 89/271 (32%), Positives = 131/271 (48%), Gaps = 13/271 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTIT-ASAFI 59
           M+++IAL+PA+ WG   LI    GGGP NQ                   +      +  I
Sbjct: 1   MDLLIALLPALFWGSVVLINVLVGGGPYNQIRXXXXXXXXXXXXXXXXXNAKFDDLTIII 60

Query: 60  WAFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWS-GTTAK 118
              ++GA W +GQ  Q  S+    +GV+ TMPIS G QLVG +L   +FLG WS G    
Sbjct: 61  VGLISGAFWALGQGYQLKSVS--LIGVSKTMPISTGLQLVGTTLFSAIFLGEWSTGVQVT 118

Query: 119 XXXXXXXXXXXXXXXXXXXXDDNKSESAS--VKDVLFLLVTTIGYWIYSSFPNLPAVRHV 176
                                +  SES+    K +  LL++T           +  V  +
Sbjct: 119 LGLVAMVLLVIGIALTSIKGKNEASESSKNFGKAMPILLISTXXXXXXXXXAQIFGVDGM 178

Query: 177 SPTALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENG 236
           +  AL+  + +G+  G LI + A  ETS    + +                  +S  + G
Sbjct: 179 N--ALFF-QSIGMAIGGLI-LSAKHETS---VKSTLWNLIPGIVWGIGNLFMFYSQPKVG 231

Query: 237 TSSAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            +++F ++QL V++STLGG+  L E+K  R+
Sbjct: 232 VATSFSFSQLLVIVSTLGGIFLLGEKKDKRQ 262


>GLCU_BACAN RecName: Full=Probable glucose uptake protein glcU;
          Length = 285

 Score = 84.7 bits (208), Expect = 9e-19
 Identities = 54/202 (26%), Positives = 91/202 (45%), Gaps = 9/202 (4%)

Query: 1   MNIIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIW 60
           M+I +A++PA+ WG   L   K GGGP +Q               +  M P +T +    
Sbjct: 1   MDIFLAILPAIFWGSIVLFNVKLGGGPYSQTLGTTFGALIFSIVVYIFMKPVLTPTVIGV 60

Query: 61  AFMAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSG--TTAK 118
             ++G  W +GQ  Q  S+  + MGV+ TMPIS G QLV  +L G++    WS   +   
Sbjct: 61  GIVSGLFWALGQANQLKSI--DLMGVSRTMPISTGLQLVSTTLFGVIVFHEWSTIISVVL 118

Query: 119 XXXXXXXXXXXXXXXXXXXXDDNKSESAS--VKDVLFLLVTTIGYWIYSSFPNLPAVRHV 176
                               ++  +E A    + ++ LL++T+GY +Y     L    +V
Sbjct: 119 GVLALVCIIIGVILTSLQSEEEKNAEQAGNFKRGIIILLISTVGYLVYVVVIRL---FNV 175

Query: 177 SPTALYLPEMLGILCGALIFVF 198
              +  LP+ +G++ G ++  F
Sbjct: 176 DGWSALLPQAVGMVLGGILLTF 197


>Y2157_STRA5 RecName: Full=Putative sugar uptake protein SAG2157;
          Length = 288

 Score = 82.0 bits (201), Expect = 6e-18
 Identities = 56/199 (28%), Positives = 87/199 (43%), Gaps = 8/199 (4%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           ++IALIP   WG    +++K GG P  Q               +    P +TAS +I+  
Sbjct: 4   LLIALIPMFAWGSIGFVSNKIGGRPNQQTFGMTLGALLFAIIVWLFKQPEMTASLWIFGI 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXX 122
           + G  W++GQ GQF +MK   MGV+   P+S+G QLVG SL+G L    W+         
Sbjct: 64  LGGILWSVGQNGQFQAMK--YMGVSVANPLSSGAQLVGGSLVGALVFHEWTKPIQFILGL 121

Query: 123 XXXXXXXXXXXXXXXXDDNKSESAS----VKDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                           D ++   A+     K    +  +T+GY  Y+   N   +     
Sbjct: 122 TALTLLVIGFYFSSKRDVSEQALATHQEFSKGFATIAYSTVGYISYAVLFN--NIMKFDA 179

Query: 179 TALYLPEMLGILCGALIFV 197
            A+ LP  +G+  GA+ F+
Sbjct: 180 MAVILPMAVGMCLGAICFM 198


>Y2116_STRA3 RecName: Full=Putative sugar uptake protein gbs2116;
          Length = 288

 Score = 82.0 bits (201), Expect = 6e-18
 Identities = 56/199 (28%), Positives = 87/199 (43%), Gaps = 8/199 (4%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           ++IALIP   WG    +++K GG P  Q               +    P +TAS +I+  
Sbjct: 4   LLIALIPMFAWGSIGFVSNKIGGRPNQQTFGMTLGALLFAIIVWLFKQPEMTASLWIFGI 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXX 122
           + G  W++GQ GQF +MK   MGV+   P+S+G QLVG SL+G L    W+         
Sbjct: 64  LGGILWSVGQNGQFQAMK--YMGVSVANPLSSGAQLVGGSLVGALVFHEWTKPIQFILGL 121

Query: 123 XXXXXXXXXXXXXXXXDDNKSESAS----VKDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                           D ++   A+     K    +  +T+GY  Y+   N   +     
Sbjct: 122 TALTLLVIGFYFSSKRDVSEQALATHQEFSKGFATIAYSTVGYISYAVLFN--NIMKFDA 179

Query: 179 TALYLPEMLGILCGALIFV 197
            A+ LP  +G+  GA+ F+
Sbjct: 180 MAVILPMAVGMCLGAICFM 198


>YSUP_LACDL RecName: Full=Putative sugar uptake protein;Flags:
           Fragment;
          Length = 176

 Score = 78.2 bits (191), Expect = 8e-17
 Identities = 58/128 (45%), Positives = 82/128 (64%), Gaps = 3/128 (2%)

Query: 140 DNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYLPEMLGILCGALIFVFA 199
           D  ++  + KD+LFL++TT GY  Y + P           +++LP+ LGIL G++I++  
Sbjct: 35  DGFTQKTTNKDILFLVLTTXGYLAYXAXPKTITA---DAESMFLPQTLGILLGSVIYLAF 91

Query: 200 TRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSSAFIYTQLSVVISTLGGMLFL 259
           +   +A   + S+                    Q NG ++AFIY QLSV+IST+GGM  L
Sbjct: 92  SGNKAAFKEKASYLDLXXXXXXXXXXXXXXXXXQVNGVTNAFIYGQLSVIISTIGGMTLL 151

Query: 260 HERKTSRE 267
            ERK  +E
Sbjct: 152 GERKQGKE 159


>Y2243_STRP8 RecName: Full=Putative sugar uptake protein
           spyM18_2243;
          Length = 287

 Score = 75.5 bits (184), Expect = 5e-16
 Identities = 63/269 (23%), Positives = 103/269 (38%), Gaps = 12/269 (4%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           I  ALIP   WG    +++K GG P+ Q               + I+ P +T   +++  
Sbjct: 4   IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGI 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXX 122
           + G  W+IGQ GQF +M  + MGV+   P                    W+         
Sbjct: 64  LGGFIWSIGQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGS 121

Query: 123 XXXXXXXXXXXXXXXXDDNKSESASV----KDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                           DD  ++   +    K    L  +TIGY +Y+   N   +     
Sbjct: 122 LALLLLIVGFYFSSKQDDANAQVNHLHNFSKGFRALTYSTIGYVMYAVLFN--NIMKFEV 179

Query: 179 TALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTS 238
            ++ LP  +G++ GA+ F+           + S                   +A + G +
Sbjct: 180 LSVILPMAVGMVLGAITFMSFKISIDQYVIKNS----VVGLLWGIGNIFMLLAASKAGLA 235

Query: 239 SAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            AF ++QL  +IS +GG+LFL E KT +E
Sbjct: 236 IAFSFSQLGAIISIVGGILFLGETKTKKE 264


>Y2205_STRP1 RecName: Full=Putative sugar uptake protein
           SPy_2205/M5005_Spy1856;
          Length = 287

 Score = 75.5 bits (184), Expect = 5e-16
 Identities = 63/269 (23%), Positives = 103/269 (38%), Gaps = 12/269 (4%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           I  ALIP   WG    +++K GG P+ Q               + I+ P +T   +++  
Sbjct: 4   IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGI 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXX 122
           + G  W+IGQ GQF +M  + MGV+   P                    W+         
Sbjct: 64  LGGFIWSIGQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGS 121

Query: 123 XXXXXXXXXXXXXXXXDDNKSESASV----KDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                           DD  ++   +    K    L  +TIGY +Y+   N   +     
Sbjct: 122 LALLLLIVGFYFSSKQDDANAQVNHLHNFSKGFRALTYSTIGYVMYAVLFN--NIMKFEV 179

Query: 179 TALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTS 238
            ++ LP  +G++ GA+ F+           + S                   +A + G +
Sbjct: 180 LSVILPMAVGMVLGAITFMSFKISIDQYVIKNS----VVGLLWGIGNIFMLLAASKAGLA 235

Query: 239 SAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            AF ++QL  +IS +GG+LFL E KT +E
Sbjct: 236 IAFSFSQLGAIISIVGGILFLGETKTKKE 264


>Y1874_STRP6 RecName: Full=Putative sugar uptake protein M6_Spy1874;
          Length = 287

 Score = 75.5 bits (184), Expect = 5e-16
 Identities = 63/269 (23%), Positives = 103/269 (38%), Gaps = 12/269 (4%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           I  ALIP   WG    +++K GG P+ Q               + I+ P +T   +++  
Sbjct: 4   IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGI 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXX 122
           + G  W+IGQ GQF +M  + MGV+   P                    W+         
Sbjct: 64  LGGFIWSIGQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGS 121

Query: 123 XXXXXXXXXXXXXXXXDDNKSESASV----KDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                           DD  ++   +    K    L  +TIGY +Y+   N   +     
Sbjct: 122 LALLLLIIGFYFSSKQDDANAQVNHLHNFSKGFRALTYSTIGYVMYAVLFN--NIMKFEV 179

Query: 179 TALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTS 238
            ++ LP  +G++ GA+ F+           + S                   +A + G +
Sbjct: 180 LSVILPMAVGMVLGAITFMSFKISIDQYVIKNS----VVGLLWGIGNIFMLLAASKAGLA 235

Query: 239 SAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            AF ++QL  +IS +GG+LFL E KT +E
Sbjct: 236 IAFSFSQLGAIISIVGGILFLGETKTKKE 264


>Y1856_STRP3 RecName: Full=Putative sugar uptake protein
           SpyM3_1856/SPs1852;
          Length = 287

 Score = 75.5 bits (184), Expect = 5e-16
 Identities = 63/269 (23%), Positives = 103/269 (38%), Gaps = 12/269 (4%)

Query: 3   IIIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAF 62
           I  ALIP   WG    +++K GG P+ Q               + I+ P +T   +++  
Sbjct: 4   IFYALIPMFTWGSIGFVSNKIGGKPSQQTLGMTFGALLFSLAVWLIVRPEMTLQLWLFGI 63

Query: 63  MAGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXX 122
           + G  W+IGQ GQF +M  + MGV+   P                    W+         
Sbjct: 64  LGGFIWSIGQTGQFHAM--QYMGVSVANPXXXXXXXXXXXXXXXXXFHEWTRPMQFVVGS 121

Query: 123 XXXXXXXXXXXXXXXXDDNKSESASV----KDVLFLLVTTIGYWIYSSFPNLPAVRHVSP 178
                           DD  ++   +    K    L  +TIGY +Y+   N   +     
Sbjct: 122 LALLLLIVGFYFSSKQDDANAQVNHLHNFSKGFRALTYSTIGYVMYAVLFN--NIMKFEV 179

Query: 179 TALYLPEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTS 238
            ++ LP  +G++ GA+ F+           + S                   +A + G +
Sbjct: 180 LSVILPMAVGMVLGAITFMSFKISIDQYVIKNS----VVGLLWGIGNIFMLLAASKAGLA 235

Query: 239 SAFIYTQLSVVISTLGGMLFLHERKTSRE 267
            AF ++QL  +IS +GG+LFL E KT +E
Sbjct: 236 IAFSFSQLGAIISIVGGILFLGETKTKKE 264


>Y444_LISIN RecName: Full=Putative sugar uptake protein lin0444;
          Length = 285

 Score = 67.8 bits (164), Expect = 1e-13
 Identities = 83/264 (31%), Positives = 132/264 (50%), Gaps = 5/264 (1%)

Query: 4   IIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAFM 63
           +IAL+P + WG  P+IA+     P  Q                    P IT  +FI +F+
Sbjct: 5   LIALLPVLGWGFMPIIANLRKSTPEEQLLGTXXXXXXXXXXXXXXXXPEITVLSFIVSFV 64

Query: 64  AGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXX 123
           +G  W+ GQ+ QF  +      V   MPIS G QLVG +L  +L    W           
Sbjct: 65  SGIFWSFGQLLQFKGIAAS--SVAKAMPISNGTQLVGATLFAVLVFQEWQXXXXXXXXXX 122

Query: 124 XXXXXXXXXXXXXXXDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYL 183
                                + SV   ++ +V    +++ + +     +  V+  ++ L
Sbjct: 123 XXXXXXXXXXMTGFQKRGNHITESVSFHVYGIVILSSFFL-TLYVVTNQLFDVTGFSIIL 181

Query: 184 PEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSSAFIY 243
           P+ +G+L  A+    A +  +A++ +                     +    G +++F  
Sbjct: 182 PQAIGMLTCAIGINLAKK--TAISRKNVTFNLMTGLSWSIANLGMFLATAVLGVATSFSI 239

Query: 244 TQLSVVISTLGGMLFLHERKTSRE 267
           +Q  V+++T+GG+L   ++K+  E
Sbjct: 240 SQACVIVATIGGILIFKQKKSPLE 263


>Y424_LISMO RecName: Full=Putative sugar uptake protein lmo0424;
          Length = 285

 Score = 67.8 bits (164), Expect = 1e-13
 Identities = 83/264 (31%), Positives = 132/264 (50%), Gaps = 5/264 (1%)

Query: 4   IIALIPAVCWGIFPLIASKTGGGPANQXXXXXXXXXXXXXXXFAIMHPTITASAFIWAFM 63
           +IAL+P + WG  P+IA+     P  Q                    P IT  +FI +F+
Sbjct: 5   LIALLPVLGWGFMPIIANLRKSTPEEQLLGTXXXXXXXXXXXXXXXXPEITVLSFIVSFI 64

Query: 64  AGACWTIGQIGQFISMKPERMGVTTTMPISAGFQLVGNSLIGMLFLGNWSGTTAKXXXXX 123
           +G  W+ GQ+ QF  +      V   MPIS G QLVG +L  +L    W           
Sbjct: 65  SGIFWSFGQLLQFKGIAAS--SVAKAMPISNGTQLVGATLFAVLVFREWQXXXXXXXXXX 122

Query: 124 XXXXXXXXXXXXXXXDDNKSESASVKDVLFLLVTTIGYWIYSSFPNLPAVRHVSPTALYL 183
                                + SV   ++ +V    +++ + +     +  V+  ++ L
Sbjct: 123 XXXXXXXXXXMTGFQKRGNHITESVSFHVYGIVILSSFFL-TLYVVTNQLFDVTGFSIIL 181

Query: 184 PEMLGILCGALIFVFATRETSALTARESWXXXXXXXXXXXXXXXXXFSAQENGTSSAFIY 243
           P+ +G+L  A+    A +  +A++ +                     +    G +++F  
Sbjct: 182 PQAIGMLTCAIGINLAKK--TAISRKNVTFNLMTGLSWSIANLGMFLATAVLGVATSFSI 239

Query: 244 TQLSVVISTLGGMLFLHERKTSRE 267
           +Q  V+++T+GG+L   ++K+  E
Sbjct: 240 SQACVIVATIGGILIFKQKKSPLE 263


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.318    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,525,842,182
Number of extensions: 386793419
Number of successful extensions: 1075983
Number of sequences better than 1.0e-03: 19277
Number of HSP's gapped: 1058379
Number of HSP's successfully gapped: 25486
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)