BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABE00097.1 lsal0 glgP GIB00337CH01 "Glycogen phosphorylase"
         (807 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PHSG_BACSU RecName: Full=Glycogen phosphorylase;         EC=2.4....   734   0.0  
PHSG_SHIFL RecName: Full=Glycogen phosphorylase;         EC=2.4....   622   e-180
PHSG_ECOLI RecName: Full=Glycogen phosphorylase;         EC=2.4....   622   e-180
PHSG_PASMU RecName: Full=Glycogen phosphorylase;         EC=2.4....   615   e-178
PYG_DROME RecName: Full=Glycogen phosphorylase;         EC=2.4.1.1;   611   e-177
PHSG_SYNY3 RecName: Full=Glycogen phosphorylase;         EC=2.4....   611   e-177
PHSG_HAEIN RecName: Full=Glycogen phosphorylase;         EC=2.4....   609   e-176
PYGM_SHEEP RecName: Full=Glycogen phosphorylase, muscle form;   ...   607   e-175
PYGM_RABIT RecName: Full=Glycogen phosphorylase, muscle form;   ...   607   e-175
PYGM_BOVIN RecName: Full=Glycogen phosphorylase, muscle form;   ...   607   e-175
PYGM_HUMAN RecName: Full=Glycogen phosphorylase, muscle form;   ...   606   e-175
PYGL_BOVIN RecName: Full=Glycogen phosphorylase, liver form;    ...   605   e-175
PYGM_MOUSE RecName: Full=Glycogen phosphorylase, muscle form;   ...   604   e-175
PYGM_MACFA RecName: Full=Glycogen phosphorylase, muscle form;   ...   603   e-174
PYGL_SHEEP RecName: Full=Glycogen phosphorylase, liver form;    ...   603   e-174
PYGL_MOUSE RecName: Full=Glycogen phosphorylase, liver form;    ...   600   e-173
PYGL_RAT RecName: Full=Glycogen phosphorylase, liver form;      ...   600   e-173
PYGM_RAT RecName: Full=Glycogen phosphorylase, muscle form;     ...   596   e-172
PYGL_HUMAN RecName: Full=Glycogen phosphorylase, liver form;    ...   592   e-171
PYGB_PONAB RecName: Full=Glycogen phosphorylase, brain form;    ...   587   e-169
PYGB_HUMAN RecName: Full=Glycogen phosphorylase, brain form;    ...   586   e-169
PYGB_MOUSE RecName: Full=Glycogen phosphorylase, brain form;    ...   585   e-169
PYGB_BOVIN RecName: Full=Glycogen phosphorylase, brain form;    ...   583   e-168
PYGB_RAT RecName: Full=Glycogen phosphorylase, brain form;      ...   583   e-168
PYGB_SHEEP RecName: Full=Glycogen phosphorylase, brain form;    ...   582   e-168
PHS2_DICDI RecName: Full=Glycogen phosphorylase 2;         Short...   573   e-165
PHSG_CHLPN RecName: Full=Glycogen phosphorylase;         EC=2.4....   572   e-165
PHSG_CHLMU RecName: Full=Glycogen phosphorylase;         EC=2.4....   571   e-165
PHSG_CHLTR RecName: Full=Glycogen phosphorylase;         EC=2.4....   555   e-160
PHS1_DICDI RecName: Full=Glycogen phosphorylase 1;         Short...   548   e-158
PHSG_YEAST RecName: Full=Glycogen phosphorylase;         EC=2.4....   541   e-155
PHSM_ECOLI RecName: Full=Maltodextrin phosphorylase;         EC=...   537   e-154
PHSH_ARATH RecName: Full=Alpha-glucan phosphorylase, H isozyme; ...   533   e-153
PHSM_STRPN RecName: Full=Maltodextrin phosphorylase;         EC=...   532   e-153
PHSH_VICFA RecName: Full=Alpha-glucan phosphorylase, H isozyme; ...   525   e-151
PHSH_SOLTU RecName: Full=Alpha-glucan phosphorylase, H isozyme; ...   520   e-149
PHSH_WHEAT RecName: Full=Alpha-glucan phosphorylase, H isozyme; ...   492   e-141
PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozym...   328   1e-91
PHSL1_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-1 iso...   321   2e-89
PHSL_IPOBA RecName: Full=Alpha-1,4 glucan phosphorylase L isozym...   318   1e-88
PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2 iso...   315   1e-87
PHSG_AQUAE RecName: Full=Glycogen phosphorylase;         EC=2.4....    78   2e-16
PHSG_MYCTU RecName: Full=Glycogen phosphorylase;         EC=2.4....    67   7e-13
PHSG_MYCBO RecName: Full=Glycogen phosphorylase;         EC=2.4....    65   2e-12
Y1631_METJA RecName: Full=Uncharacterized protein MJ1631;              40   7e-05
Y078_NANEQ RecName: Full=UPF0027 protein NEQ078;                       39   2e-04

>PHSG_BACSU RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 798

 Score =  734 bits (1895), Expect = 0.0
 Identities = 372/785 (47%), Positives = 517/785 (65%), Gaps = 4/785 (0%)

Query: 15  RLDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGR 74
           RL+       KD+   + Y TL ++VR   S  W +T +K   +  KQ YY SIEFL G+
Sbjct: 15  RLEMTCGKSFKDSAKLDQYKTLGNMVREYISADWIETNEKSRSNSGKQTYYLSIEFLLGQ 74

Query: 75  LLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLP 134
           LL  NL+N+G  + V   LK++ I+L+EI ++E D              F+DSLAS  LP
Sbjct: 75  LLEQNLMNLGVRDVVEAGLKEIGINLEEILQIENDXXXXXXXXXXXXXCFLDSLASLNLP 134

Query: 135 GNGNGIRYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGN 194
           G+G GIRY++GLF+QK +DG+Q+ELP +WL +GN WE+R   ++V V   G+V++ ++  
Sbjct: 135 GHGMGIRYKHGLFEQKIVDGHQVELPEQWLKNGNVWEVRNADQAVDVPFWGEVHMTEKSG 194

Query: 195 YLEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREVEDLV 254
            L   +E A ++ AVPYD  I+GY+ GTVNT+RLW+AE P +       +  +RE E + 
Sbjct: 195 RLHFRHEQATIVTAVPYDIPIIGYETGTVNTLRLWNAE-PYAHYHGGNILSYKRETEAVS 253

Query: 255 SVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAM 314
             LYPDD+ + G+ILRLKQ+YF V A ++SIV +++K +KS++ + + + IHINDTHPA+
Sbjct: 254 EFLYPDDTHDEGKILRLKQQYFLVCASLKSIVNNYRKTHKSLSGLHKKVSIHINDTHPAL 313

Query: 315 SVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQ 374
           +V ELMRIL+DEE+MSW++AW  TV  +SYTNHT ++EALEKWP+H+ + + PR+  II+
Sbjct: 314 AVPELMRILLDEENMSWEEAWHITVHTISYTNHTTLSEALEKWPIHLFKPLLPRMYMIIE 373

Query: 375 EIDRRFVEEKQGKYARDM--IERTRIIKDNQVRMANLSIIGSHSTNGVAKLHTELLKDDV 432
           EI+ RF      KY  D   IE   I     V+MA+L+I+GS+S NGVAK+H+++LK+  
Sbjct: 374 EINERFCRAVWEKYPGDWKRIENMAITAHGVVKMAHLAIVGSYSVNGVAKIHSDILKERE 433

Query: 433 LHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQND 492
           + DF++++P RFNNKTNGI  RRWL  ANP LS ++ +AIG EW + P  L +L  +  D
Sbjct: 434 MRDFHLLFPNRFNNKTNGIAHRRWLLKANPGLSAIITEAIGDEWVKQPESLIRLEPYATD 493

Query: 493 NKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLY 552
              + Q  N K K K+ LA  I    G+ V+ ++IFDVQ+KRLHAYKRQLL ++HI+ LY
Sbjct: 494 PAFIEQFQNNKSKKKQELADLIFCTAGVVVNPESIFDVQVKRLHAYKRQLLNVLHIMYLY 553

Query: 553 LDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLE 612
             +K+    S + P+ FIFG                I+ VA  VN DP +   +KVVFLE
Sbjct: 554 NRLKEDSGFSIY-PQTFIFGAKASPSYYYAKKIIKLIHSVAEKVNYDPAVKQLIKVVFLE 612

Query: 613 DYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGED 672
           +YRVS+AE+I PA+++SEQIS ASKEASGT NMK M+NGALT+ T DGANIEI + VG D
Sbjct: 613 NYRVSMAERIFPASDVSEQISTASKEASGTGNMKFMMNGALTIGTHDGANIEILERVGPD 672

Query: 673 NIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLT 732
            I+ FGL  DEV  Y  NG Y S +YY +   IR+V +  ++G       E + IFDSL 
Sbjct: 673 CIYTFGLKADEVLSYQENGGYRSREYYQHDRRIRQVADQLINGFFEGEADEFESIFDSLL 732

Query: 733 KYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIW 792
            +NDEYFVL+DF SY + QE +   Y  +R W++ S+VNIA+ G FSSD TI+ YA+DIW
Sbjct: 733 PHNDEYFVLKDFSSYADAQERIQADYRERRKWSEHSIVNIAHSGYFSSDRTIREYAKDIW 792

Query: 793 NISPL 797
            I P+
Sbjct: 793 GIKPM 797


>PHSG_SHIFL RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 815

 Score =  622 bits (1605), Expect = e-180
 Identities = 334/772 (43%), Positives = 475/772 (61%), Gaps = 19/772 (2%)

Query: 40  VRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETVRDALKDLDID 99
           VR      W ++ +  +    +Q+YY S+EFL GR L + +L++G  E V+ AL+ +   
Sbjct: 49  VRDRLVERWLRSNRAQLSQETRQVYYLSMEFLIGRTLSNAMLSLGIYEDVQGALEAMGXX 108

Query: 100 LDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFIDGYQIEL 159
                                A+ F+DSLA+ GLPG G GIRY YG+FKQ  ++G Q E 
Sbjct: 109 XXXXXXXXXXPXXXXXXXXXXAACFLDSLATLGLPGRGYGIRYDYGMFKQNIVNGSQKES 168

Query: 160 PNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYK 219
           P+ WL+ GNPWE +R +    VR GG++    +    +  + + + I  V YD  I GY 
Sbjct: 169 PDYWLEYGNPWEFKRHNTRYKVRFGGRIQQEGK----KTRWIETEEILGVAYDQIIPGYD 224

Query: 220 NGTVNTMRLWDAEIPS-------SEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLK 272
               NT+RLW A+  S       ++   +  +E +   E++  VLYPDDS  SGR LRL+
Sbjct: 225 TDATNTLRLWSAQASSEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRLR 284

Query: 273 QEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWD 332
           QEYF VS+ IQ I+    + +K+ + + + I IH+NDTHP +S+ E+MR+L+DE   SWD
Sbjct: 285 QEYFLVSSTIQDILSRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSWD 344

Query: 333 DAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYAR-- 390
           DA++    V SYTNHT+M+EALE WPV ++ ++ PR LQII EI+  F++  Q +Y    
Sbjct: 345 DAFEVCCQVFSYTNHTLMSEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPNDT 404

Query: 391 DMIERTRIIKDN---QVRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNK 447
           D++ R  II ++   +VRMA L+++ SH  NGV++LH+ L+   +  DF  ++P RF N 
Sbjct: 405 DLLGRASIIDESNGRRVRMAWLAVVVSHKVNGVSELHSNLMVQSLFADFAKIFPGRFTNV 464

Query: 448 TNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQNDNKVLNQIANAKLKNK 507
           TNG+T RRWL +ANP LS VLD+ +G  WR D + L +L +H +   V + +  AKL+NK
Sbjct: 465 TNGVTPRRWLAVANPSLSAVLDEHLGRNWRTDLSLLNELQQHCDFPMVNHAVHQAKLENK 524

Query: 508 ERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVASDFQPR 567
           +RLA++I ++  + V+  A+FDVQIKR+H YKRQL+ ++H++  Y  IK    A  + PR
Sbjct: 525 KRLAEYIAQQLNVVVNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPDAK-WVPR 583

Query: 568 VFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAAN 627
           V IFG                IN+VA ++NNDP+IGDKLKVVF+ +Y VSLA+ IIPAA+
Sbjct: 584 VNIFGGKAASAYYMAKHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAAD 643

Query: 628 ISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDY 687
           +SEQISLA  EASGTSNMK  LNGALT+ TLDGAN+E+ D+VG DNIFIFG T +EV + 
Sbjct: 644 LSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEEL 703

Query: 688 YNNGNYHSYDYYNNHEEIRRVLNAFVDGTI-PNCQAEGQEIFDSLTKYNDEYFVLRDFES 746
              G Y   +YY   EE+ +VL     G   P      +++ DSL  + D Y VL D+ S
Sbjct: 704 RRQG-YKPREYYEKDEELHQVLTQIGSGVFSPEDPGRYRDLVDSLINFGDHYQVLADYRS 762

Query: 747 YVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLK 798
           YV+ Q+ VD  Y  +  W   +++NIA  G FSSD TIK YA+ IW+I P++
Sbjct: 763 YVDCQDKVDELYELQEEWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDPVR 814


>PHSG_ECOLI RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 815

 Score =  622 bits (1605), Expect = e-180
 Identities = 334/772 (43%), Positives = 475/772 (61%), Gaps = 19/772 (2%)

Query: 40  VRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETVRDALKDLDID 99
           VR      W ++ +  +    +Q+YY S+EFL GR L + +L++G  E V+ AL+ +   
Sbjct: 49  VRDRLVERWLRSNRAQLSQETRQVYYLSMEFLIGRTLSNAMLSLGIYEDVQGALEAMGXX 108

Query: 100 LDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFIDGYQIEL 159
                                A+ F+DSLA+ GLPG G GIRY YG+FKQ  ++G Q E 
Sbjct: 109 XXXXXXXXXXPXXXXXXXXXXAACFLDSLATLGLPGRGYGIRYDYGMFKQNIVNGSQKES 168

Query: 160 PNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYK 219
           P+ WL+ GNPWE +R +    VR GG++    +    +  + + + I  V YD  I GY 
Sbjct: 169 PDYWLEYGNPWEFKRHNTRYKVRFGGRIQQEGK----KTRWIETEEILGVAYDQIIPGYD 224

Query: 220 NGTVNTMRLWDAEIPS-------SEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLK 272
               NT+RLW A+  S       ++   +  +E +   E++  VLYPDDS  SGR LRL+
Sbjct: 225 TDATNTLRLWSAQASSEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRLR 284

Query: 273 QEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWD 332
           QEYF VS+ IQ I+    + +K+ + + + I IH+NDTHP +S+ E+MR+L+DE   SWD
Sbjct: 285 QEYFLVSSTIQDILSRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSWD 344

Query: 333 DAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYAR-- 390
           DA++    V SYTNHT+M+EALE WPV ++ ++ PR LQII EI+  F++  Q +Y    
Sbjct: 345 DAFEVCCQVFSYTNHTLMSEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPNDT 404

Query: 391 DMIERTRIIKDN---QVRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNK 447
           D++ R  II ++   +VRMA L+++ SH  NGV++LH+ L+   +  DF  ++P RF N 
Sbjct: 405 DLLGRASIIDESNGRRVRMAWLAVVVSHKVNGVSELHSNLMVQSLFADFAKIFPGRFTNV 464

Query: 448 TNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQNDNKVLNQIANAKLKNK 507
           TNG+T RRWL +ANP LS VLD+ +G  WR D + L +L +H +   V + +  AKL+NK
Sbjct: 465 TNGVTPRRWLAVANPSLSAVLDEHLGRNWRTDLSLLNELQQHCDFPMVNHAVHQAKLENK 524

Query: 508 ERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVASDFQPR 567
           +RLA++I ++  + V+  A+FDVQIKR+H YKRQL+ ++H++  Y  IK    A  + PR
Sbjct: 525 KRLAEYIAQQLNVVVNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPDAK-WVPR 583

Query: 568 VFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAAN 627
           V IFG                IN+VA ++NNDP+IGDKLKVVF+ +Y VSLA+ IIPAA+
Sbjct: 584 VNIFGGKAASAYYMAKHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAAD 643

Query: 628 ISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDY 687
           +SEQISLA  EASGTSNMK  LNGALT+ TLDGAN+E+ D+VG DNIFIFG T +EV + 
Sbjct: 644 LSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEEL 703

Query: 688 YNNGNYHSYDYYNNHEEIRRVLNAFVDGTI-PNCQAEGQEIFDSLTKYNDEYFVLRDFES 746
              G Y   +YY   EE+ +VL     G   P      +++ DSL  + D Y VL D+ S
Sbjct: 704 RRQG-YKPREYYEKDEELHQVLTQIGSGVFSPEDPGRYRDLVDSLINFGDHYQVLADYRS 762

Query: 747 YVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLK 798
           YV+ Q+ VD  Y  +  W   +++NIA  G FSSD TIK YA+ IW+I P++
Sbjct: 763 YVDCQDKVDELYELQEEWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDPVR 814


>PHSG_PASMU RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 818

 Score =  615 bits (1587), Expect = e-178
 Identities = 346/786 (44%), Positives = 484/786 (61%), Gaps = 18/786 (2%)

Query: 25  KDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMG 84
           K+A+ ++        VR   +  W  T ++   +  +++YY S+EFL GR L + +L  G
Sbjct: 39  KEASQRDWLNATLYAVRDFVTEGWITTARQSRSEETRRVYYLSMEFLIGRTLSNAMLAEG 98

Query: 85  WLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRY 144
             +  + AL +L+++L+++ E E D           A+ FMDS+A+  LPG G GIRY Y
Sbjct: 99  VYDVAKQALSELNVNLEDVLEKEVDPXXXXXXXXXXAACFMDSIATLALPGVGYGIRYEY 158

Query: 145 GLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQ 204
           G+FKQ+  DG+Q+E P+ WLD G  WE  R SK  TVR GG ++   +    + ++   +
Sbjct: 159 GMFKQEIEDGHQVEKPDAWLDKGAAWEFIRPSKRHTVRFGGGIHFEGK----KCIWTSKE 214

Query: 205 LIKAVPYDTAIVGYKNGTVNTMRLWDA------EIPSSEEAKYRTIEQRREVEDLVS-VL 257
            ++A+ YD  I GY N +  T+RLW A      ++    +  Y    Q R +   +S VL
Sbjct: 215 EVEALAYDQMIPGYANDSAATLRLWSAYAGDRFDLADFNKGDYFAAVQDRTLSKNISRVL 274

Query: 258 YPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVA 317
           YPDDS  SGR LRL+QEYF VSA +Q I+   K+ + +M    + + IH+NDTHPA+++ 
Sbjct: 275 YPDDSTWSGRELRLRQEYFLVSASLQDIIYRHKRIHNTMENFADKVAIHLNDTHPALAIP 334

Query: 318 ELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEID 377
           ELM IL+D+E   W  AW  T  V SYT HT+M+EALE WPV +M  + PR LQ+I EI+
Sbjct: 335 ELMVILIDQEGYEWKKAWDITRRVFSYTCHTLMSEALETWPVEMMAHILPRHLQMIFEIN 394

Query: 378 RRFVEEKQGKYARD--MIERTRIIKDN---QVRMANLSIIGSHSTNGVAKLHTELLKDDV 432
             F+E  +   + D   I R  +I++    +VRM  LS++GS+  NGVA +H+EL+    
Sbjct: 395 DYFLEYVRTYVSTDAEFIRRVSLIEEGDHRKVRMGWLSVVGSNKVNGVAAIHSELMVTST 454

Query: 433 LHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQND 492
             DF  +YPERF N TNGIT RRW+ +ANPELS + D+ IG EWR+D ++L  L     D
Sbjct: 455 FADFARIYPERFTNVTNGITPRRWIGVANPELSALFDRYIGKEWRRDLSQLTLLKDKVQD 514

Query: 493 NKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLY 552
            ++   IA  K  NK +LA +I+ E G++V  +A+FDVQ+KR+H YKRQ+L ++HI+  Y
Sbjct: 515 PELKKSIAQIKYNNKVKLANYIKNELGVEVDPNALFDVQVKRIHEYKRQILNVLHIIARY 574

Query: 553 LDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLE 612
             + +     D+ PRVFI                  IN+VAN++N+D  +  +LKVVF+ 
Sbjct: 575 NAMLENP-EKDWVPRVFILXXXXXXXXXXXXQTINLINDVANIINHDERLQGRLKVVFIP 633

Query: 613 DYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGED 672
           +Y VSLAE IIPAA+ISEQISLA  EASGTSNMK  LNGALT+ TLDGAN+EI D VG+D
Sbjct: 634 NYSVSLAELIIPAADISEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEILDNVGQD 693

Query: 673 NIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLT 732
           +IFIFG T ++V     +G Y  +DYY N EE+R+V++  + G      A          
Sbjct: 694 HIFIFGNTVEQVESLRRHG-YRPFDYYQNDEELRKVVDQIISGRFSPTDANRYHQLLQSL 752

Query: 733 KYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIW 792
           +Y+D Y    DF SYV++Q+ VD  Y ++  W   +L NI     FSSD TI  YAE IW
Sbjct: 753 QYHDYYQAFADFRSYVDMQQNVDAKYQDQNAWIDSTLQNIVNMSYFSSDRTILEYAEKIW 812

Query: 793 NISPLK 798
            I P+K
Sbjct: 813 KIKPVK 818


>PYG_DROME RecName: Full=Glycogen phosphorylase;         EC=2.4.1.1;
          Length = 844

 Score =  611 bits (1576), Expect = e-177
 Identities = 327/797 (41%), Positives = 477/797 (59%), Gaps = 31/797 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   +T ++ Y  L++ V+ +    W +T + Y E   K++YY S+E+  GR L + +
Sbjct: 41  VKDRNVSTLRDYYFALANTVKDNMVGRWIRTQQHYYEKDPKRVYYLSLEYYMGRSLTNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+  L +D++ + E+E+D              F+DS+A+ GL   G GI
Sbjct: 101 INLGIQSECEEAMYQLGLDIENLEEMEEDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY YG+F QK  +G Q+E P++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEYGIFAQKIKNGEQVEEPDDWLRYGNPWEKARPEFMLPVNFYGRVIDTPEGKK----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKY-------RTIEQRREVEDL 253
            D Q + A+PYD  I GY N  VNT+RLW A+ P     K+       + +  R   E++
Sbjct: 217 VDTQRVFAMPYDNPIPGYNNNHVNTLRLWSAKSPIDFNLKFFNDGDYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF  +A +Q I+R +K            + +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFMCAATLQDIIRRYKASKFGSREAVRNTFDHFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRILVDEEH++W+ AW  TV   +YTNHT++ EALE+WPV +++ +
Sbjct: 337 QLNDTHPSLAIPELMRILVDEEHLTWEKAWDITVRSCAYTNHTVLPEALERWPVSLLESI 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR LQII  I+   +E  + K+  D+  + R  +++++   ++ MA+LSI+GSH+ NGV
Sbjct: 397 LPRHLQIIYHINFLHMENVKKKFPDDLDRMRRMSMVEEDGEKRINMAHLSIVGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A +H+++LKD + HDFY M P++F NKTNGIT RRWL + NP LS ++ + IG EW    
Sbjct: 457 AAIHSQILKDSLFHDFYEMEPQKFQNKTNGITPRRWLLLCNPGLSDLIAEKIGDEWPVHL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L  L K   D      +A  K +NK +LA  +EK+ G+K++  ++FD+Q+KR+H YKR
Sbjct: 517 DQLVALKKWAKDPNFQRNVARVKQENKLKLAAILEKDYGVKINPSSMFDIQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +HI+ LY  IK+   A +F PR  + G                I  V N+VNNDP
Sbjct: 577 QLLNCLHIITLYNRIKKDPTA-NFTPRTIMIGGKAAPGYYVAKQIIKLICAVGNVVNNDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GDKLKV+FLE+YRV+LAEKI+PAA++SEQIS A  EASGT NMK  LNGALT+ TLDG
Sbjct: 636 IVGDKLKVIFLENYRVTLAEKIMPAADLSEQISTAGTEASGTGNMKFQLNGALTIGTLDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTI-PN 719
           AN+E+ + +G DNIFIFG+T DEV      G Y++YDYYN + E+++V++    G   P 
Sbjct: 696 ANVEMAEEMGLDNIFIFGMTVDEVEALKKKG-YNAYDYYNANPEVKQVIDQIQGGFFSPG 754

Query: 720 CQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFS 779
              E + I D +                   Q++V +TY N+  W +MS+ NIA  G FS
Sbjct: 755 NPNEFKNIAD-IXXXXXXXXXXXXXXXXXXXQDLVSKTYQNQAKWLEMSINNIASSGKFS 813

Query: 780 SDDTIKRYAEDIWNISP 796
           SD TI  YA +IW + P
Sbjct: 814 SDRTIAEYAREIWGVEP 830


>PHSG_SYNY3 RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 849

 Score =  611 bits (1576), Expect = e-177
 Identities = 321/786 (40%), Positives = 475/786 (60%), Gaps = 19/786 (2%)

Query: 27  ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWL 86
           AT  + Y+ L+  +R    + W  T++ Y+    + + Y S E+L G  L +NL+N+G  
Sbjct: 48  ATKNDCYMALAYTIRDRLLQRWLNTFQTYLNCDNRVVCYLSAEYLLGPHLGNNLINLGLW 107

Query: 87  ETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGL 146
           E V+ A+++  +                      A+ FMDSLA+  +P  G GIRY +G+
Sbjct: 108 EPVQQAVEESGLSXXXXXXXXXXPXXXXXXXXXXAACFMDSLATLEIPAIGYGIRYEFGI 167

Query: 147 FKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKV--YLVDRGNYLEPVYEDAQ 204
           F Q+  DG+Q+E+ ++WL  GNPWEI R   +V V+LGG    Y  D+GNY    +    
Sbjct: 168 FDQEIKDGWQVEITDKWLQLGNPWEIARPESAVLVKLGGHTEPYTDDQGNY-RVRWIAGS 226

Query: 205 LIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDLVSVL 257
           L+K +PYDT I+GYK  T N +RLW +E   S + +       Y  ++ +   E+L  VL
Sbjct: 227 LVKGIPYDTPILGYKVSTANNLRLWKSEAAESFDFQRFNVGDYYGAVQDKMSSENLTKVL 286

Query: 258 YPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVA 317
           YP+D +  G+ LRL Q+YFFVS  +Q ++R     N ++    E+  + +NDTHP+++VA
Sbjct: 287 YPNDEQIQGKELRLAQQYFFVSCSLQDMIRIHLSDNPTLENFHEHFAVQMNDTHPSIAVA 346

Query: 318 ELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEID 377
           ELMR+LVDE H  W  AW  T A   +TNHT++ EALEKW + +  ++ PR L+II EI+
Sbjct: 347 ELMRLLVDEHHYEWQRAWAITEATFGFTNHTLLPEALEKWSLPLFGEMLPRHLEIIYEIN 406

Query: 378 RRFVEEKQGKYAR--DMIERTRIIK---DNQVRMANLSIIGSHSTNGVAKLHTELLKDDV 432
           +RF+++ + KY    D + R  II    +  VRMA L+ +GSH+ NGVA LH++L+K+ +
Sbjct: 407 QRFLDQVRMKYPNDGDRLARLSIIDEAGEKSVRMAYLATVGSHAINGVAALHSQLVKETI 466

Query: 433 LHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQND 492
           L DFY ++PE+F+NKTNG+T RRW+ ++NP LS ++   IG  W ++  +L++L    + 
Sbjct: 467 LKDFYELWPEKFSNKTNGVTPRRWMVLSNPRLSNLISSRIGDGWIKNLDELKQLEPFADL 526

Query: 493 NKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLY 552
                     K + K+ LA++I   T + V+ D++FDVQ+KR+H YKRQ L ++H++ LY
Sbjct: 527 AGFRQDWCKVKREVKQDLARYIHTRTDLVVNPDSLFDVQVKRIHEYKRQHLNILHVIHLY 586

Query: 553 LDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLE 612
           L IK      D  PR FI+G                IN VA++VNNDP IGD+LKV+FL 
Sbjct: 587 LQIKNNP-NLDVTPRTFIYGGKAAPGYFTAKLIIKLINSVADVVNNDPTIGDRLKVIFLP 645

Query: 613 DYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGED 672
           DY V   +++ PAA++SEQIS A KEASGT NMK  +NGALT+ TLDGANIEI++ VG +
Sbjct: 646 DYNVKFGQRVYPAADLSEQISTAGKEASGTGNMKFSMNGALTIGTLDGANIEIREEVGAE 705

Query: 673 NIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQ-AEGQEIFDSL 731
           N F+FGLT  EV      G Y  ++YYNN+  ++ V++    G   +   A  + + DSL
Sbjct: 706 NFFLFGLTTPEVEKTLAEG-YQPWEYYNNNANLKAVVDLINSGFFSHGDTALFRPLMDSL 764

Query: 732 TKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDI 791
               D Y V  DF++YV+ Q  V   Y ++ +W +M+++N+A  G FSSD TI+ YAEDI
Sbjct: 765 LG-QDPYLVFADFQAYVDCQNQVGEAYKDQENWARMAILNVARMGKFSSDRTIREYAEDI 823

Query: 792 WNISPL 797
           W I P+
Sbjct: 824 WAIKPV 829


>PHSG_HAEIN RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 821

 Score =  609 bits (1570), Expect = e-176
 Identities = 333/772 (43%), Positives = 476/772 (61%), Gaps = 20/772 (2%)

Query: 40  VRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETVRDALKDLDID 99
           VR   +  W  T ++   +  +++YY S+EFL GR L + ++  G     ++AL      
Sbjct: 54  VRDLVTEGWITTARQTRAEDSRRVYYLSMEFLIGRTLSNAMIAEGIYGLAQEALSXXXXX 113

Query: 100 LDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFIDGYQIEL 159
                    D           A+ FMDS+A+ GLPG G GIRY YG+F+QK  +G Q+E 
Sbjct: 114 XXXXXXXXXDPXXXXXXXXXXAACFMDSIATLGLPGMGYGIRYEYGMFRQKIENGQQVER 173

Query: 160 PNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYK 219
           P+ WL+ G PWE  R SK  TV  GG ++   +    + +++D + + A+ YD  I GY+
Sbjct: 174 PDAWLEKGAPWEFIRPSKRFTVEFGGNIHFEGK----KCIWQDTEKVTALAYDQMIPGYQ 229

Query: 220 NGTVNTMRLWDAEIPS-------SEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLK 272
           N +  T+RLW A           +       +E+    ++L  VLYPDDS  +GR LRL+
Sbjct: 230 NNSAATLRLWSAHAGEVFNLADFNRGEHLAALEEHSANKNLSRVLYPDDSTWNGRELRLR 289

Query: 273 QEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWD 332
           QEYF VSA +Q I+R  K+ + S+  + + + IH+NDTHPA+++ ELMRILVD+E   W 
Sbjct: 290 QEYFLVSASLQDILRRHKRTHNSLENLADKVAIHLNDTHPALAIPELMRILVDDEGFEWK 349

Query: 333 DAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYA--R 390
            AW+ T  + SYT HT+M+EALE WPV +M ++ PR LQ+I EI+  F+E  +       
Sbjct: 350 KAWEMTRNIFSYTCHTLMSEALETWPVEMMAKILPRHLQMIFEINDHFLEYVRTYVTTDN 409

Query: 391 DMIERTRIIKDN---QVRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNK 447
           D I R  +I++    +VRM  LS++GSH  NGVA++H++L+      DF  ++PERF N 
Sbjct: 410 DFIRRVSLIEEGYQRKVRMGWLSVVGSHKINGVAEIHSDLMVTSTFADFARIFPERFTNV 469

Query: 448 TNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQNDNKVLNQIANAKLKNK 507
           TNGIT RRWL +ANP+L+ + DK IG+EWR D ++++KL     +      +A+ K  NK
Sbjct: 470 TNGITPRRWLAVANPQLAALFDKYIGSEWRCDLSQIEKLKPFAQEKAFKEAVADIKFANK 529

Query: 508 ERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVASDFQPR 567
            +LA++++ E G+++   A+FDVQ+KR+H YKRQ+L ++HI+  Y ++       D+QPR
Sbjct: 530 VKLAEYVKSELGVELDPHALFDVQVKRIHEYKRQMLNVLHIIARYNEMLTNP-EKDWQPR 588

Query: 568 VFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAAN 627
           VFI                  IN+VAN++NND  +  +LKVVF+ +Y VSLA+ IIPAA+
Sbjct: 589 VFILXXXXXXXXXXXXQTIHLINDVANVINNDERLKGRLKVVFIPNYSVSLAQLIIPAAD 648

Query: 628 ISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDY 687
           ISEQISLA  EASGTSNMK  LNGALT+ TLDGAN+EI + VGEDNIFIFG T ++V   
Sbjct: 649 ISEQISLAGTEASGTSNMKFALNGALTLGTLDGANVEILENVGEDNIFIFGNTVEQVEQL 708

Query: 688 YNNGNYHSYDYYNNHEEIRRVLNAFVDGTI-PNCQAEGQEIFDSLTKYNDEYFVLRDFES 746
              G Y S++YY N  ++R V++  ++G   P       ++   L +Y+D Y    DF S
Sbjct: 709 RREG-YRSFEYYQNDAQLRTVVDQIIEGKFSPEDPQRYHQLLQGL-QYHDYYQAFADFRS 766

Query: 747 YVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLK 798
           YV  Q+ VD  Y  +  W + ++ NI   G FSSD TIK YAE IW + P++
Sbjct: 767 YVETQKAVDEKYKQRDQWIESTIQNIVNMGFFSSDRTIKEYAERIWKVEPVQ 818


>PYGM_SHEEP RecName: Full=Glycogen phosphorylase, muscle form;      
             EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 842

 Score =  607 bits (1565), Expect = e-175
 Identities = 315/798 (39%), Positives = 478/798 (59%), Gaps = 29/798 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAYTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYIGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  ++WL  GNPWE  R   ++ V   G+V    +G      +
Sbjct: 161 RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P+    K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCLDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRILVD+E + W+ AW+ TV   +YTNHT++ EALE+WPVH+++ +
Sbjct: 337 QLNDTHPSLAIPELMRILVDQERLEWEKAWEVTVKTCAYTNHTVLPEALERWPVHLIETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++V+ + IG E+  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVMCNPGLAEVIAERIGEEYIADL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL + +D   +  +A  K +NK + + ++EKE  + ++ +++FD+Q+KR+H YKR
Sbjct: 517 DQLRKLLSYVDDESFIRDVAKVKQENKLKFSAYLEKEYKVHINPNSLFDIQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H++ LY  IK+ +    F PR  + G                I  + ++VN+DP
Sbjct: 577 QLLNCLHVITLYNRIKK-EPNKFFVPRTVMIGGKAAPGYHMAKMIIRLITAIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSLAEK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N FIFG+  ++V +  +   Y++ +YY+   E+R +++    G     
Sbjct: 696 ANVEMAEEAGEENFFIFGMRVEDV-ERLDQKGYNAQEYYDRIPELRHIIDQLSSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  ++D + V  D+E YV  QE V   Y N R W +M + NIA  G FSS
Sbjct: 755 QPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIRNIATSGKFSS 814

Query: 781 DDTIKRYAEDIWNISPLK 798
           D TI +YA +IW + P +
Sbjct: 815 DRTIAQYAREIWGVEPTR 832


>PYGM_RABIT RecName: Full=Glycogen phosphorylase, muscle form;      
             EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 843

 Score =  607 bits (1565), Expect = e-175
 Identities = 317/797 (39%), Positives = 476/797 (59%), Gaps = 31/797 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  ++WL  GNPWE  R   ++ V   G+V    +G      +
Sbjct: 161 RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P+    K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMR+LVD E + WD AW+ TV   +YTNHT++ EALE+WPVH+++ +
Sbjct: 337 QLNDTHPSLAIPELMRVLVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLLETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++++ + IG E+  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYISDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL + +D   +  +A  K +NK + A ++E+E  + ++ +++FDVQ+KR+H YKR
Sbjct: 517 DQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDVQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDF-QPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNND 599
           QLL  +H++ LY  IK  K  + F  PR  + G                I  + ++VN+D
Sbjct: 577 QLLNCLHVITLYNRIK--KEPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHD 634

Query: 600 PEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLD 659
           P +GD+L+V+FLE+YRVSLAEK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+D
Sbjct: 635 PVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMD 694

Query: 660 GANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPN 719
           GAN+E+ +  GE+N FIFG+  ++V D  +   Y++ +YY+   E+R+++     G    
Sbjct: 695 GANVEMAEEAGEENFFIFGMRVEDV-DRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSP 753

Query: 720 CQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFS 779
            Q +  +   ++  ++D + V  D+E YV  QE V   Y N R W +M + NIA  G FS
Sbjct: 754 KQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYKNPREWTRMVIRNIATSGKFS 813

Query: 780 SDDTIKRYAEDIWNISP 796
           SD TI +YA +IW + P
Sbjct: 814 SDRTIAQYAREIWGVEP 830


>PYGM_BOVIN RecName: Full=Glycogen phosphorylase, muscle form;      
             EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 842

 Score =  607 bits (1564), Expect = e-175
 Identities = 314/798 (39%), Positives = 478/798 (59%), Gaps = 29/798 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAYTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYIGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  ++WL  GNPWE  R   ++ V   G+V    +G      +
Sbjct: 161 RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P+    K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCLDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRILVD+E + W+ AW+ TV   +YTNHT++ EALE+WPVH+++ +
Sbjct: 337 QLNDTHPSLAIPELMRILVDQERLEWEKAWEVTVKTCAYTNHTVLPEALERWPVHLIETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++++ + IG E+  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVMCNPGLAEIIAERIGEEYIADL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL + +D   +  +A  K +NK + + ++EKE  + ++ +++FD+Q+KR+H YKR
Sbjct: 517 DQLRKLLSYVDDESFIRDVAKVKQENKLKFSAYLEKEYKVHINPNSLFDIQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H++ LY  IK+ +    F PR  + G                I  + ++VN+DP
Sbjct: 577 QLLNCLHVITLYNRIKK-EPNKFFVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSLAEK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N FIFG+  ++V +  +   Y++ +YY+   E+R V++    G     
Sbjct: 696 ANVEMAEEAGEENFFIFGMRVEDV-ERLDQKGYNAQEYYDRIPELRHVIDQLSSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  ++D + V  D+E Y+  QE V   Y N R W +M + NIA  G FSS
Sbjct: 755 QPDLFKDIVNMLMHHDRFKVFADYEEYIKCQERVSALYKNPREWTRMVIRNIATSGKFSS 814

Query: 781 DDTIKRYAEDIWNISPLK 798
           D TI +YA +IW + P +
Sbjct: 815 DRTIAQYAREIWGVEPTR 832


>PYGM_HUMAN RecName: Full=Glycogen phosphorylase, muscle form;      
             EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 842

 Score =  606 bits (1562), Expect = e-175
 Identities = 316/796 (39%), Positives = 473/796 (59%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  ++WL  GNPWE  R   ++ V   G V    +G      +
Sbjct: 161 RYEFGIFNQKISGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGHVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P+    K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRILVD E M WD AW  TV   +YTNHT++ EALE+WPVH+++ +
Sbjct: 337 QLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++V+ + IG ++  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL   +D   +  +A  K +NK + A ++E+E  + ++ +++FD+Q+KR+H YKR
Sbjct: 517 DQLRKLLSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H++ LY  IK+ +    F PR  + G                +  + ++VN+DP
Sbjct: 577 QLLNCLHVITLYNRIKR-EPNKFFVPRTVMIGGKAAPGYHMAKMIIRLVTAIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSLAEK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 AVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N FIFG+  ++V D  +   Y++ +YY+   E+R+V+     G     
Sbjct: 696 ANVEMAEEAGEENFFIFGMRVEDV-DKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  ++D + V  D+E Y+  QE V   Y N R W +M + NIA  G FSS
Sbjct: 755 QPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI +YA +IW + P
Sbjct: 815 DRTIAQYAREIWGVEP 830


>PYGL_BOVIN RecName: Full=Glycogen phosphorylase, liver form;       
            EC=2.4.1.1;
          Length = 851

 Score =  605 bits (1559), Expect = e-175
 Identities = 322/796 (40%), Positives = 479/796 (60%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ +  L+  VR      W +T + Y E   K++YY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQYYYEKCPKRVYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+  L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 INLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY YG+F QK  DG+QIE  ++WL  GNPWE  R    + V   G+V   + G      +
Sbjct: 161 RYEYGIFNQKIRDGWQIEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTEAGTK----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY N TVNTMRLW A  P+    +        + +  R   E++
Sbjct: 217 TDTQVVLALPYDTPVPGYLNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFK--KYNKS------MNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q ++R FK  K++ S       +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDVIRRFKASKFDSSNSTKTAFDAFPDQVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRI VD E + W  AW+ T    +YTNHT++ EALE+WPV +++++
Sbjct: 337 QLNDTHPSLAIPELMRIFVDIEKLPWSKAWEITQKTFAYTNHTVLPEALERWPVELVEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR LQII EI+++ +++    + +D+  + R  +I++    ++ MA+L I+GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQKHLDKIAALFPKDVDRLRRMSLIEEEGGKRINMAHLCIVGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           AK+H++++K  V  DF  + P++F NKTNGIT RRWL + NP L++++ + IG ++ +D 
Sbjct: 457 AKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L KL     D+  L +I+N K +NK + ++F+EKE  +K++  ++FDVQ+KR+H YKR
Sbjct: 517 SQLTKLNSFLGDDIFLREISNVKQENKLKFSQFLEKEYKVKINPSSMFDVQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H+V +Y  IK+      F PR  I G                I  VA +VNNDP
Sbjct: 577 QLLNCLHVVTMYNRIKKDP-KKLFVPRTVIIGGKAAPGYYMAKLIIKLITSVAEVVNNDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +G KLK++FLE+YRVSLAEK+IPA ++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGSKLKLIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N+FIFG+  ++V      G Y + +YY    E++  ++    G     
Sbjct: 696 ANVEMAEEAGEENLFIFGMRIEDVAALDKKG-YEAKEYYEALPELKLAIDQIDKGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  Y+D + V  D+E+YV  QE V + Y N + WN M L NIA  G FSS
Sbjct: 755 QPDLFKDLVNMLFYHDRFKVFADYEAYVKCQEKVSQLYMNPKAWNIMVLKNIAASGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TIK YA DIWN+ P
Sbjct: 815 DRTIKEYARDIWNMEP 830


>PYGM_MOUSE RecName: Full=Glycogen phosphorylase, muscle form;      
             EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 842

 Score =  604 bits (1557), Expect = e-175
 Identities = 314/796 (39%), Positives = 474/796 (59%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  ++WL  GNPWE  R   ++ V   G+V    +G      +
Sbjct: 161 RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P+    K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGSRDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRILVD E + WD AW  TV   +YTNHT++ EALE+WPVH+M+ +
Sbjct: 337 QLNDTHPSLAIPELMRILVDLERLDWDKAWDVTVKTCAYTNHTVLPEALERWPVHLMETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++V+ + IG ++  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDYISDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL + +D   +  +A  K +NK + + ++E+E  + ++ +++FDVQ+KR+H YKR
Sbjct: 517 DQLRKLLSYVDDEAFIRDVAKVKQENKLKFSAYLEREYKVHINPNSLFDVQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +HI+ LY  IK+ +      PR  + G                I  + ++VN+DP
Sbjct: 577 QLLNCLHIITLYNRIKR-EPNRFMVPRTIMIGGKAAPGYHMAKMIIKLITAIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSLAEK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 AVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N FIFG+  ++V +  +   Y++ +YY+   E+R+++     G     
Sbjct: 696 ANVEMAEEAGEENFFIFGMRVEDV-ERLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  ++D + V  D+E Y+  Q+ V   Y N R W +M + NIA  G FSS
Sbjct: 755 QPDLFKDIVNMLMHHDRFKVFADYEEYIKCQDKVSELYKNPREWTRMVIRNIATSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI +YA +IW + P
Sbjct: 815 DRTIAQYAREIWGVEP 830


>PYGM_MACFA RecName: Full=Glycogen phosphorylase, muscle form;      
             EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 842

 Score =  603 bits (1556), Expect = e-174
 Identities = 316/796 (39%), Positives = 472/796 (59%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  + WL  GNPWE  R   ++ V   G V    +G      +
Sbjct: 161 RYEFGIFNQKISGGWQMEEADVWLRYGNPWEKARPEFTLPVHFYGHVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P+    K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNDFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 PRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ ELMRILVD E M WD AW  TV   +YTNHT++ EALE+WPVH+++ +
Sbjct: 337 QLNDTHPSLAIPELMRILVDLERMDWDKAWDVTVRTCAYTNHTVLPEALERWPVHLLETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAATFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++V+ + IG ++  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEDFISDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL   +D   +  +A  K +NK + A ++E+E  + ++ +++FD+Q+KR+H YKR
Sbjct: 517 DQLRKLLSFVDDEAFIRDVAKVKQENKLKFAAYLEREYKVHINPNSLFDIQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H++ LY  IK+ +    F PR  + G                I  + ++VN+DP
Sbjct: 577 QLLNCLHVITLYNRIKR-EPNKFFVPRTVMIGGKAAPGHHMAKMIIRLITAIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSL+EK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 TVGDRLRVIFLENYRVSLSEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N FIFG+  ++V D  +   Y++ +YY+   E+R+V+     G     
Sbjct: 696 ANVEMAEEAGEENFFIFGMRVEDV-DKLDQRGYNAQEYYDRIPELRQVIEQLSSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  ++D + V  D+E Y+  QE V   Y N R W +M + NIA  G FSS
Sbjct: 755 QPDLFKDIVNMLMHHDRFKVFADYEDYIKCQEKVSALYKNPREWTRMVIRNIATSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI +YA +IW + P
Sbjct: 815 DRTIAQYAREIWGVEP 830


>PYGL_SHEEP RecName: Full=Glycogen phosphorylase, liver form;       
            EC=2.4.1.1;
          Length = 851

 Score =  603 bits (1554), Expect = e-174
 Identities = 323/796 (40%), Positives = 477/796 (59%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ +  L+  VR      W +T + Y E   K++YY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQYYYEKCPKRVYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+  L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 INLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY YG+F QK  DG+QIE  ++WL  GNPWE  R    + V   G+V   + G      +
Sbjct: 161 RYEYGIFNQKIRDGWQIEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTEAGTK----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY N TVNTMRLW A  P+    +        + +  R   E++
Sbjct: 217 IDTQVVLALPYDTPVPGYLNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFK--KYNKS------MNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q ++R FK  K++ S       +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDVIRRFKASKFDSSNSAETAFDAFPDQVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+++ ELMRI VD E + W  AW+ T    +YTNHT++ EALE+WPV +++ +
Sbjct: 337 QLNDTHPALAIPELMRIFVDIEKLPWSKAWEITQKTFAYTNHTVLPEALERWPVELVENL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI+++ +++    + +D+  + R  +I++  V+   MA+L I+GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQKHLDKIAALFPKDVDRLRRMSLIEEEGVKRINMAHLCIVGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           AK+H++++K  V  DF  + P++F NKTNGIT RRWL + NP L++++ + IG ++ +D 
Sbjct: 457 AKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L KL     D+  L +I+N K +NK + ++F+EKE  +K++  ++FDVQ+KR+H YKR
Sbjct: 517 SQLTKLNSFLGDDIFLREISNVKQENKLKFSQFLEKEYKVKINPSSMFDVQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H+V +Y  IK+      F PR  I G                I  VA +VNNDP
Sbjct: 577 QLLNCLHVVTMYNRIKKDP-KKLFVPRTVIIGGKAAPGYYMAKLIIKLITSVAEVVNNDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +G KLK++FLE+YRVSLAEK+IPA ++SEQIS A  EASGT NMK M NGALT+ T+DG
Sbjct: 636 MVGSKLKLIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMQNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N+FIFG+  ++V      G Y + +YY    E++  ++    G     
Sbjct: 696 ANVEMAEEAGEENLFIFGMRVEDVAALDKKG-YEAKEYYEALPELKLAIDQIDKGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  Y+D + V  D+E+YV  QE V + Y N + WN M L NIA  G FSS
Sbjct: 755 QPDLFKDLVNMLFYHDRFKVFADYEAYVKCQEKVSQLYMNPKAWNIMVLKNIAASGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TIK YA DIWN+ P
Sbjct: 815 DRTIKEYARDIWNMEP 830


>PYGL_MOUSE RecName: Full=Glycogen phosphorylase, liver form;       
            EC=2.4.1.1;
          Length = 850

 Score =  600 bits (1548), Expect = e-173
 Identities = 321/797 (40%), Positives = 478/797 (59%), Gaps = 31/797 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y +   K++YY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+  L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 INLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY YG+F QK  +G+Q+E  ++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEYGIFNQKIREGWQVEEADDWLRHGNPWEKARPEFVLPVHFYGRVEHTQTGTK----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY N TVNTMRLW A  P+    +        + +  R   E++
Sbjct: 217 VDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLQDFNVGDYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIG---------EYIG 304
             VLYP+D+   G+ LRLKQEYF V+A +Q ++R FK  +K  +K G         + + 
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDVIRRFKA-SKFGSKDGMGTVFDAFPDQVA 335

Query: 305 IHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQ 364
           I +NDTHPA+++ ELMRI VD E + W  AW+ T    +YTNHT++ EALE+WPV ++++
Sbjct: 336 IQLNDTHPALAIPELMRIFVDIEKLPWAKAWEITKKTFAYTNHTVLPEALERWPVELVEK 395

Query: 365 VQPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNG 419
           + PR L+II EI+++ ++     + +D+  + R  +I++    ++ MA+L I+G H+ NG
Sbjct: 396 LLPRHLEIIYEINQKHLDRIVALFPKDISRMRRMSLIEEEGGKRINMAHLCIVGCHAVNG 455

Query: 420 VAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQD 479
           VAK+H++++K  V  DF  + P++F NKTNGIT RRWL + NP L+ ++ + IG ++ +D
Sbjct: 456 VAKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKD 515

Query: 480 PTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYK 539
            ++L KL    +D+  L +IA  K +NK + ++F+EKE  +K++  ++FDV +KR+H YK
Sbjct: 516 LSQLTKLHSFVSDDIFLREIAKVKQENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYK 575

Query: 540 RQLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNND 599
           RQLL  +H++ +Y  IK+      F PR  I G                I  VA +VNND
Sbjct: 576 RQLLNCLHVITMYNRIKKDP-KKFFVPRTVIIGGKAAPGYHMAKMIIKLITSVAEVVNND 634

Query: 600 PEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLD 659
           P +G KLKV+FLE+YRVSLAEK+IPA ++SEQIS A  EASGT NMK MLNGALT+ T+D
Sbjct: 635 PMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMD 694

Query: 660 GANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPN 719
           GAN+E+ +  GE+N+FIFG+  D+V      G Y + +YY    E++ V++   +G    
Sbjct: 695 GANVEMAEEAGEENLFIFGMRVDDVAALDKKG-YEAKEYYEALPELKLVIDQIDNGFFSP 753

Query: 720 CQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFS 779
            Q +  +   ++  Y+D + V  D+E+YV  QE V + Y N++ WN M L NIA  G FS
Sbjct: 754 NQPDLFKDIINMLFYHDRFKVFADYEAYVKCQEKVSQLYMNQKAWNTMVLKNIAASGKFS 813

Query: 780 SDDTIKRYAEDIWNISP 796
           SD TIK YA+DIWN+ P
Sbjct: 814 SDRTIKEYAKDIWNMEP 830


>PYGL_RAT RecName: Full=Glycogen phosphorylase, liver form;       
           EC=2.4.1.1;
          Length = 850

 Score =  600 bits (1547), Expect = e-173
 Identities = 320/797 (40%), Positives = 477/797 (59%), Gaps = 31/797 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y +   K++YY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+  L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 INLGLQNACDEAIYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY YG+F QK  +G+Q+E  ++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEYGIFNQKIREGWQVEEADDWLRHGNPWEKARPEFMLPVHFYGRVEHTQAGTK----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY N TVNTMRLW A  P+    +        + +  R   E++
Sbjct: 217 VDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLQDFNVGDYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIG---------EYIG 304
             VLYP+D+   G+ LRLKQEYF V+A +Q ++R FK  +K  +K G         + + 
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDVIRRFKA-SKFGSKDGVGTVFDAFPDQVA 335

Query: 305 IHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQ 364
           I +NDTHPA+++ ELMRI VD E + W  AW+ T    +YTNHT++ EALE+WPV ++++
Sbjct: 336 IQLNDTHPALAIPELMRIFVDIEKLPWSKAWEITKKTFAYTNHTVLPEALERWPVDLVEK 395

Query: 365 VQPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNG 419
           + PR LQII EI+++ ++     + +D+  + R  +I++    ++ MA+L I+G H+ NG
Sbjct: 396 LLPRHLQIIYEINQKHLDRIVALFPKDIDRMRRMSLIEEEGGKRINMAHLCIVGCHAVNG 455

Query: 420 VAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQD 479
           VAK+H++++K  V  DF  + P++F NKTNGIT RRWL + NP L+ ++ + IG ++ +D
Sbjct: 456 VAKIHSDIVKTQVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKD 515

Query: 480 PTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYK 539
            ++L KL     D+  L +IA  K +NK + ++F+EKE  +K++  ++FDV +KR+H YK
Sbjct: 516 LSQLTKLHSFVGDDIFLREIAKVKQENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYK 575

Query: 540 RQLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNND 599
           RQLL  +H++ +Y  IK+      F PR  I G                +  VA +VNND
Sbjct: 576 RQLLNCLHVITMYNRIKKDP-KKFFVPRTVIIGGKAAPGYHMAKMIIKLVTSVAEVVNND 634

Query: 600 PEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLD 659
           P +G KLKV+FLE+YRVSLAEK+IPA ++SEQIS A  EASGT NMK MLNGALT+ T+D
Sbjct: 635 PMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMD 694

Query: 660 GANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPN 719
           GAN+E+ +  GE+N+FIFG+  D+V      G Y + +YY    E++ V++   +G    
Sbjct: 695 GANVEMAEEAGEENLFIFGMRVDDVAALDKKG-YEAKEYYEALPELKLVIDQIDNGFFSP 753

Query: 720 CQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFS 779
            Q +  +   ++  Y+D + V  D+E+YV  QE V + Y N++ WN M L NIA  G FS
Sbjct: 754 NQPDLFKDIINMLFYHDRFKVFADYEAYVKCQEKVSQLYMNQKAWNTMVLRNIAASGKFS 813

Query: 780 SDDTIKRYAEDIWNISP 796
           SD TI+ YA+DIWN+ P
Sbjct: 814 SDRTIREYAKDIWNMEP 830


>PYGM_RAT RecName: Full=Glycogen phosphorylase, muscle form;        
           EC=2.4.1.1;AltName: Full=Myophosphorylase;
          Length = 842

 Score =  596 bits (1536), Expect = e-172
 Identities = 312/796 (39%), Positives = 468/796 (58%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ Y  L+  VR      W +T + Y     K+IYY S+E   GR L + +
Sbjct: 41  VKDRNVATPRDYYFALAHTVRDHLVDRWIRTQQHYYAKDPKRIYYLSLELYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+       +A   L +D+        D              F+DS+A+ GL   G GI
Sbjct: 101 VNLALENACDEATYQLGLDMXXXXXXXXDXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK   G+Q+E  ++WL  GNPWE  R   ++ V   G+V    +G      +
Sbjct: 161 RYEFGIFNQKICGGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQG----AKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY+N  VNTMRLW A+ P     K        + +  R   E++
Sbjct: 217 VDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPPYFNLKDFNVGGYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D    G+ LRLKQEYF V+A +Q I+R FK            + +   + + I
Sbjct: 277 SRVLYPNDKFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTNFDAFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHP++++ EL+RILVD E + WD AW  TV   +YTNHT++ EALE+WPVH+M+ +
Sbjct: 337 QLNDTHPSLAIPELIRILVDLERLDWDKAWDVTVKTCAYTNHTVLPEALERWPVHLMETL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDNQVR---MANLSIIGSHSTNGV 420
            PR LQII EI++RF+      +  D+  + R  ++++  V+   MA+L I GSH+ NGV
Sbjct: 397 LPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVEEGAVKRINMAHLCIAGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+LK  +  DFY + P +F NKTNGIT RRWL + NP L++V+ + IG E+  D 
Sbjct: 457 ARIHSEILKKTIFKDFYELEPHKFQNKTNGITPRRWLVLCNPGLAEVIAERIGEEYISDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
            +L+KLL + +D   +  +A  K +NK + + ++E E  + ++ +++FDVQ+KR+H YKR
Sbjct: 517 DQLRKLLSYLDDQAFIRDVAKVKQENKLKFSAYLETEYKVHINPNSLFDVQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +HI+ LY  IK+ +      PR  + G                I  + ++VN+DP
Sbjct: 577 QLLNCLHIITLYNRIKR-EPNRFMVPRTIMIGGKAAPGYHMAKMIIKLITAIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+ +V+FLE+YRVSLAEK+IPAA++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 AVGDRFRVIFLENYRVSLAEKVIPAADLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GEDN FIFG+  ++V +  +   Y++ +YY+   E+R+++     G     
Sbjct: 696 ANVEMAEEAGEDNFFIFGMRVEDV-ERLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  ++D + V  D+E Y+  Q+ V   Y N R W +M + NIA  G FSS
Sbjct: 755 QPDLFKDIVNMVMHHDRFKVFADYEEYIKCQDKVSELYKNPREWTRMVIRNIATSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI +YA +IW + P
Sbjct: 815 DRTIAQYAREIWGLEP 830


>PYGL_HUMAN RecName: Full=Glycogen phosphorylase, liver form;       
            EC=2.4.1.1;
          Length = 847

 Score =  592 bits (1527), Expect = e-171
 Identities = 317/796 (39%), Positives = 474/796 (59%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   AT ++ Y  L+  VR      W +T + Y +   K++YY S+EF  GR L + +
Sbjct: 41  VKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+  L                           F+DS+A+ GL   G GI
Sbjct: 101 INLGLQNACDEAIYQLGXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY YG+F QK  DG+Q+E  ++WL  GNPWE  R    + V   GKV   + G      +
Sbjct: 161 RYEYGIFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTK----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GY N TVNTMRLW A  P+    +        + +  R   E++
Sbjct: 217 IDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFK--KYNKS------MNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK  K+  +       +   + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+++ ELMRI VD E + W  AW+ T    +YTNHT++ EALE+WPV +++++
Sbjct: 337 QLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L+II EI+++ ++     + +D+  + R  +I++    ++ MA+L I+GSH+ NGV
Sbjct: 397 LPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           AK+H++++K  V  DF  + P++F NKTNGIT RRWL + NP L++++ + IG ++ +D 
Sbjct: 457 AKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L KL     D+  L ++A  K +NK + ++F+E E  +K++  ++FDVQ+KR+H YKR
Sbjct: 517 SQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H++ +Y  IK+      F PR  I G                I  VA++VNNDP
Sbjct: 577 QLLNCLHVITMYNRIKKDP-KKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +G KLKV+FLE+YRVSLAEK+IPA ++SEQIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 MVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N+FIFG+  D+V      G Y + +YY    E++ V++   +G     
Sbjct: 696 ANVEMAEEAGEENLFIFGMRIDDVAALDKKG-YEAKEYYEALPELKLVIDQIDNGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           Q +  +   ++  Y+D + V  D+E+YV  Q+ V + Y N + WN M L NIA  G FSS
Sbjct: 755 QPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TIK YA++IWN+ P
Sbjct: 815 DRTIKEYAQNIWNVEP 830


>PYGB_PONAB RecName: Full=Glycogen phosphorylase, brain form;       
            EC=2.4.1.1;
          Length = 843

 Score =  587 bits (1512), Expect = e-169
 Identities = 313/800 (39%), Positives = 469/800 (58%), Gaps = 37/800 (4%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++    L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYLFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+                              F+DS+A+ GL   G GI
Sbjct: 101 VNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK ++G+Q+E  ++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDG----VKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GYKN TVNTMRLW A+ P+  + +          +  R   E++
Sbjct: 217 LDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK                  + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+S+ ELMRILVD E + WD AW+ T    +YTNHT++ EALE+WPV + +++
Sbjct: 337 QLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L+II  I++R ++     +  D+  + R  +I++    ++ MA+L +IGSH+ NGV
Sbjct: 397 LPRHLEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E++K  V  DFY + PE+F NKTNGIT RRWL + NP L+  + + IG E+  D 
Sbjct: 457 ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L+KLL   ND   +  +A  K +NK + + F+EKE  +K++  ++FDV +KR+H YKR
Sbjct: 517 SQLKKLLPLVNDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H+V LY  IK+   A  F PR  + G                +  + ++VN+DP
Sbjct: 577 QLLNCLHVVTLYNRIKRDP-AKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+LKV+FLE+YRVSLAEK+IPAA++S+QIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGAEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTI--- 717
           AN+E+ +  G +N+FIFGL  ++V +  +   Y++ +YY++  E+++ ++    G     
Sbjct: 696 ANVEMAEEAGAENLFIFGLQVEDV-EALDRKGYNAREYYDHLPELKQAVDQISSGFFSPK 754

Query: 718 -PNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGG 776
            PNC  +      ++  ++D + V  D+E+Y+  Q  VD+ Y N + W +  + NIA  G
Sbjct: 755 EPNCFKD----IVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSG 810

Query: 777 MFSSDDTIKRYAEDIWNISP 796
            FSSD TI  YA +IW + P
Sbjct: 811 KFSSDRTITEYAREIWGVEP 830


>PYGB_HUMAN RecName: Full=Glycogen phosphorylase, brain form;       
            EC=2.4.1.1;
          Length = 843

 Score =  586 bits (1510), Expect = e-169
 Identities = 309/796 (38%), Positives = 469/796 (58%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ +  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+                              F+DS+A+ GL   G GI
Sbjct: 101 VNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK ++G+Q+E  ++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDG----VKW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GYKN TVNTMRLW A+ P+  + +          +  R   E++
Sbjct: 217 LDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLQDFNVGDYIEAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK                  + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+S+ ELMRILVD E + WD AW+ T    +YTNHT++ EALE+WPV + +++
Sbjct: 337 QLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L+II  I++R ++     +  D+  + R  +I++    ++ MA+L +IGSH+ NGV
Sbjct: 397 LPRHLEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E++K  V  DFY + PE+F NKTNGIT RRWL + NP L+  + + IG E+  D 
Sbjct: 457 ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLADTIVEKIGEEFLTDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L+KLL   +D   +  +A  K +NK + + F+EKE  +K++  ++FDV +KR+H YKR
Sbjct: 517 SQLKKLLPLVSDEVFIRDVAKVKQENKLKFSAFLEKEYKVKINPSSMFDVHVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H+V LY  IK+   A  F PR  + G                +  + ++VN+DP
Sbjct: 577 QLLNCLHVVTLYNRIKRDP-AKAFVPRTVMIGGKAAPGYHMAKLIIKLVTSIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+LKV+FLE+YRVSLAEK+IPAA++S+QIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  G +N+FIFGL  ++V +  +   Y++ +YY++  E+++ ++    G     
Sbjct: 696 ANVEMAEEAGAENLFIFGLRVEDV-EALDRKGYNAREYYDHLPELKQAVDQISSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           + +  +   ++  ++D + V  D+E+Y+  Q  VD+ Y N + W +  + NIA  G FSS
Sbjct: 755 EPDCFKDIVNMLMHHDRFKVFADYEAYMQCQAQVDQLYRNPKEWTKKVIRNIACSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI  YA +IW + P
Sbjct: 815 DRTITEYAREIWGVEP 830


>PYGB_MOUSE RecName: Full=Glycogen phosphorylase, brain form;       
            EC=2.4.1.1;
          Length = 843

 Score =  585 bits (1509), Expect = e-169
 Identities = 309/796 (38%), Positives = 467/796 (58%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ +  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A                               F+DS+A+ GL   G GI
Sbjct: 101 VNLGLQTACDEATYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK ++G+Q+E  ++WL  GNPWE  R    + V   G+V     G     ++
Sbjct: 161 RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDG----VLW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GYKN TVNTMRLW A+ P+  + K          +  R   E++
Sbjct: 217 LDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLKDFNVGDYIEAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK                  + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSRFGCRDPVRTCFETFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+S+ ELMRILVD E + WD AW+ T    +YTNHT++ EALE+WPV + +++
Sbjct: 337 QLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L+II  I++R ++     +  D+  + R  +I++    ++ MA+L +IGSH+ NGV
Sbjct: 397 LPRHLEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E++K  V  DFY + PE+F NKTNGIT RRWL + NP L++++ + IG  +  D 
Sbjct: 457 ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAEIIVERIGEGFLTDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L+KLL   +D   +  +A  K +NK + +  +EKE  +K++  ++FDV +KR+H YKR
Sbjct: 517 SQLKKLLSLVDDEAFIRDVAKVKQENKLKFSAQLEKEYKVKINPASMFDVHVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +HI+ LY  IK+   A  F PR  + G                +  + ++VN+DP
Sbjct: 577 QLLNCLHIITLYNRIKKDP-AKAFVPRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSLAEK+IPAA++S+QIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGDRLRVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N+FIFG+  ++V +  +   Y++ ++Y    E+R+ ++    G     
Sbjct: 696 ANVEMAEEAGEENLFIFGMRVEDV-EALDQKGYNAREFYERLPELRQAVDQISSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
             +  +   ++  Y+D + V  D+E+Y+  Q  VDR Y N + W +  + NIA  G FSS
Sbjct: 755 DPDCFKDVVNMLMYHDRFKVFADYEAYIQCQAQVDRLYRNSKEWTKKVIRNIACSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI  YA +IW + P
Sbjct: 815 DRTITEYAREIWGVEP 830


>PYGB_BOVIN RecName: Full=Glycogen phosphorylase, brain form;       
            EC=2.4.1.1;
          Length = 843

 Score =  583 bits (1503), Expect = e-168
 Identities = 311/792 (39%), Positives = 467/792 (58%), Gaps = 29/792 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   AT ++ YL L+  VR      W +T ++Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATRRDYYLALAHTVRDHLVGRWIRTQQRYYERDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+                              F+DS+A+ GL   G GI
Sbjct: 101 VNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK ++G+Q+E  ++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHSPEGVR----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GYKN TVNTMRLW A+ P+  +            +  R   E++
Sbjct: 217 LDTQVVLAMPYDTPVPGYKNDTVNTMRLWSAKAPNDFKLHDFNVGGYIEAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            S     + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTSFETFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+++ ELMRILVD E + WD AW+ T    +YTNHT++ EALE+WPV + +++
Sbjct: 337 QLNDTHPALAIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L II  I++R ++     +  D+  + R  +I++    ++ MA+L +IGSH+ NGV
Sbjct: 397 LPRHLDIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+++  V  DFY + PE+F NKTNGIT RRWL + NP L++ + + IG  +  D 
Sbjct: 457 ARIHSEIVRQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAETIVERIGEGFLTDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L+KLL    D  ++  +A  K +NK + + F+EK+ G+KV+  ++FDV +KR+H YKR
Sbjct: 517 SQLKKLLPLVGDEALIRDVAQVKQENKVKFSAFLEKQYGVKVNPSSMFDVHVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H+V LY  IK+    + F PR  + G                +  + N+VN+DP
Sbjct: 577 QLLNCLHVVTLYNRIKKDPTQA-FVPRTVMIGGKAAPGYHMAKKIIKLVTSIGNIVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+LKV+FLE+YRVSLAEK+IPAA++S+QIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 IVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  G +N+FIFGL  ++V +  +   Y++++YY+   E+R+ ++    G     
Sbjct: 696 ANVEMAEEAGAENLFIFGLRVEDV-EALDRKGYNAHEYYDRLPELRQAVDQINGGFFSPR 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           + +  +   ++   +D + V  D+E+YV  Q  VD+ Y N + W +  + NIA  G FSS
Sbjct: 755 EPDCFKDVVNMLLNHDRFKVFADYEAYVACQARVDQLYRNPKEWTKKVIRNIACSGKFSS 814

Query: 781 DDTIKRYAEDIW 792
           D TI  YA DIW
Sbjct: 815 DRTITEYAHDIW 826


>PYGB_RAT RecName: Full=Glycogen phosphorylase, brain form;       
           EC=2.4.1.1;Flags: Fragment;
          Length = 838

 Score =  583 bits (1502), Expect = e-168
 Identities = 307/796 (38%), Positives = 466/796 (58%), Gaps = 29/796 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   ATP++ +  L+  VR      W +T + Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATPRDYFFALAHTVRDHLVGRWIRTQQHYYERDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A                               F+DS+A+ GL   G GI
Sbjct: 101 VNLGLQTACDEATYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK ++G+Q+E  ++WL  GNPWE  R    + V   G+V     G     ++
Sbjct: 161 RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPNG----VLW 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GYKN TVNTMRLW A+ P+  + K          +  R   E++
Sbjct: 217 LDTQVVLAMPYDTPVPGYKNNTVNTMRLWSAKAPNDFKLKDFNVGDYIEAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK                  + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTCFETFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+S+ ELMRILVD E + WD AW+ T    +YTNHT++ EALE+WPV + +++
Sbjct: 337 QLNDTHPALSIPELMRILVDVEKVDWDKAWEITKKTCAYTNHTVLPEALERWPVSMFEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L+II  I++R ++     +  D+  + R  +I++    ++ MA+L +IGSH+ NGV
Sbjct: 397 LPRHLEIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E++K  V  DFY + PE+F NKTNGIT RRWL + NP L++++ + IG  +  D 
Sbjct: 457 ARIHSEIVKQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAEIIVERIGEGFLTDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L+KLL   +D   +  +A  K +NK + +  +EKE  +K++  ++FDV +KR+H YKR
Sbjct: 517 SQLKKLLSLVDDEAFIRDVAKVKQENKLKFSAQLEKEYKVKINPCSMFDVHVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +HI+ LY  IK+    + F PR  + G                +  + ++VN+DP
Sbjct: 577 QLLNCLHIITLYNRIKKDPTKT-FVPRTVMIGGKAAPGYHMAKMIIKLVTSIGDVVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+L+V+FLE+YRVSLAEK+IPAA++S+QIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 VVGDRLRVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  GE+N+FIFG+  ++V +  +   Y++ ++Y    E+R+ ++    G     
Sbjct: 696 ANVEMAEEAGEENLFIFGMRVEDV-EALDQKGYNAQEFYERLPELRQAVDQISSGFFSPK 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
             +  +   ++  Y+D + V  D+E+Y+  Q  VD  Y N + W +  + NIA  G FSS
Sbjct: 755 DPDCFKDVVNMLMYHDRFKVFADYEAYIQCQAQVDHLYRNPKDWTKKVIRNIACSGKFSS 814

Query: 781 DDTIKRYAEDIWNISP 796
           D TI  YA +IW + P
Sbjct: 815 DRTITEYAREIWGVEP 830


>PYGB_SHEEP RecName: Full=Glycogen phosphorylase, brain form;       
            EC=2.4.1.1;
          Length = 843

 Score =  582 bits (1499), Expect = e-168
 Identities = 309/792 (39%), Positives = 468/792 (59%), Gaps = 29/792 (3%)

Query: 24  VKD---ATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNL 80
           VKD   AT ++ YL L+  VR      W +T ++Y E   K+IYY S+EF  GR L + +
Sbjct: 41  VKDRNVATRRDYYLALAHTVRDHLVGRWIRTQQRYYERDPKRIYYLSLEFYMGRTLQNTM 100

Query: 81  LNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGI 140
           +N+G      +A+                              F+DS+A+ GL   G GI
Sbjct: 101 VNLGLQNACDEAIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXCFLDSMATLGLAAYGYGI 160

Query: 141 RYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVY 200
           RY +G+F QK ++G+Q+E  ++WL  GNPWE  R    + V   G+V     G      +
Sbjct: 161 RYEFGIFNQKIVNGWQVEEADDWLRYGNPWEKARPEYMLPVHFYGRVEHSPEGVR----W 216

Query: 201 EDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAK-------YRTIEQRREVEDL 253
            D Q++ A+PYDT + GYKN TVNTMRLW A+ P+  +            +  R   E++
Sbjct: 217 LDTQVVLAMPYDTPVPGYKNDTVNTMRLWSAKAPNDFKLHDFNVGGYIEAVLDRNLAENI 276

Query: 254 VSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKK--------YNKSMNKIGEYIGI 305
             VLYP+D+   G+ LRLKQEYF V+A +Q I+R FK            S     + + I
Sbjct: 277 SRVLYPNDNFFEGKELRLKQEYFVVAATLQDIIRRFKSSKFGCRDPVRTSFETFPDKVAI 336

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
            +NDTHPA+++ ELMRILVD E + W  AW+ T    +YTNHT++ EALE+WPV + +++
Sbjct: 337 QLNDTHPALAIPELMRILVDVEKVDWGKAWEITKKTCAYTNHTVLPEALERWPVSMFEKL 396

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDM--IERTRIIKDN---QVRMANLSIIGSHSTNGV 420
            PR L II  I++R ++     +  D+  + R  +I++    ++ MA+L +IGSH+ NGV
Sbjct: 397 LPRHLDIIYAINQRHLDHVAALFPGDVDRLRRMSVIEEGDCKRINMAHLCVIGSHAVNGV 456

Query: 421 AKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDP 480
           A++H+E+++  V  DFY + PE+F NKTNGIT RRWL + NP L++ + + IG ++  D 
Sbjct: 457 ARIHSEIVRQSVFKDFYELEPEKFQNKTNGITPRRWLLLCNPGLAETIVERIGEDFLTDL 516

Query: 481 TKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKR 540
           ++L+KLL    D  ++  +A  K +NK + + F+EK+ G+KV+  ++FDV +KR+H YKR
Sbjct: 517 SQLKKLLPLVGDEALIRDVAQVKQENKVKFSAFLEKQYGVKVNPSSMFDVHVKRIHEYKR 576

Query: 541 QLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDP 600
           QLL  +H+V LY  IK+    + F PR  + G                +  + ++VN+DP
Sbjct: 577 QLLNCLHVVTLYNRIKKDPTQA-FVPRTVMIGGKAAPGYHMAKKIIKLVTSIGDIVNHDP 635

Query: 601 EIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +GD+LKV+FLE+YRVSLAEK+IPAA++S+QIS A  EASGT NMK MLNGALT+ T+DG
Sbjct: 636 IVGDRLKVIFLENYRVSLAEKVIPAADLSQQISTAGTEASGTGNMKFMLNGALTIGTMDG 695

Query: 661 ANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNC 720
           AN+E+ +  G +N+FIFGL  ++V +  +   Y++++YYN+  E+++ ++    G     
Sbjct: 696 ANVEMAEEAGAENLFIFGLRVEDV-EALDRKGYNAHEYYNHLPELQQAVDQINSGFFSPR 754

Query: 721 QAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSS 780
           + +  +   ++   +D + V  D+E+YV  Q  VD+ Y N + W +  + NIA  G FSS
Sbjct: 755 EPDCFKDVVNMLLNHDRFKVFADYEAYVACQAQVDQLYRNPKEWTKKVIRNIACSGKFSS 814

Query: 781 DDTIKRYAEDIW 792
           D TI  YA DIW
Sbjct: 815 DRTITEYARDIW 826


>PHS2_DICDI RecName: Full=Glycogen phosphorylase 2;       
           Short=GP2;         EC=2.4.1.1;
          Length = 993

 Score =  573 bits (1476), Expect = e-165
 Identities = 321/789 (40%), Positives = 470/789 (59%), Gaps = 25/789 (3%)

Query: 26  DATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGW 85
           + T    +  LS   R      W+ T   + +   KQ+ Y S+EFL GR L ++L  +G 
Sbjct: 132 ECTDFSSFQALSYCTRDRLIERWKDTKLFFKQKNVKQVNYMSLEFLLGRSLQNSLSALGL 191

Query: 86  LETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYG 145
           +    DAL DL   L+++ + E+D              FMDSLA+   PG G G+RY++G
Sbjct: 192 VGKYSDALMDLGFKLEDLYDEERDXXXXXXXXXXXXXCFMDSLATCNFPGYGYGLRYKFG 251

Query: 146 LFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPV-YEDAQ 204
           +F Q  +DG Q+ELP+ WL+ G+PWEI R   S  +   GKV  V+  N  + + ++  +
Sbjct: 252 MFYQTLVDGEQVELPDYWLNYGSPWEIERLDVSYPINFYGKVSEVEDENGKKVMKWDQGE 311

Query: 205 LIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSE-------EAKYR-TIEQRREVEDLVSV 256
            + AV YD  I G+K      +RLW ++ PS E          Y   IE++ + E++ +V
Sbjct: 312 QMLAVAYDYPIPGFKTYNTVAIRLWSSK-PSDEFNLDSFNRGDYLGAIEEKEKSENITNV 370

Query: 257 LYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSV 316
           LYP+D+   G+ LRLKQ+Y FVSA IQ I+  FK+  K  ++   +  I +NDTHP + +
Sbjct: 371 LYPNDNTMQGKELRLKQQYLFVSATIQDIISQFKETGKPFSEFHNFHAIQLNDTHPTLGI 430

Query: 317 AELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEI 376
            ELMRIL+DEE  SWD+AW  T    SYTNHT++ EALEKW V +++ V PR + II EI
Sbjct: 431 PELMRILIDEEKKSWDEAWDITTKTFSYTNHTVLPEALEKWSVSMVENVLPRHIMIIYEI 490

Query: 377 DRRFVEEKQGKYARDMIER--TRIIKDNQ---VRMANLSIIGSHSTNGVAKLHTELLKDD 431
           + RF++    K+  DM +R    II ++    +RMA L+I+GSH+ NGVA LH+EL+K D
Sbjct: 491 NERFLKLVDQKWPGDMSKRRALSIIDESDGKFIRMAFLAIVGSHTINGVAYLHSELVKHD 550

Query: 432 VLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTE-WRQDPTKLQKLLKHQ 490
           V   FY ++P +F NKTNG+T RRW+Q +NP+L++++ +++ ++ W  +   ++ L+   
Sbjct: 551 VFPLFYEIWPNKFQNKTNGVTPRRWIQQSNPQLAELITRSLNSDRWLVNLDIIKDLVHLA 610

Query: 491 NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVK 550
           +++    +    K  NK RLAK+IEK   I+V+ D +FDVQ+KR H YKRQLL ++ ++ 
Sbjct: 611 DNSSFQKEWMEIKRNNKIRLAKYIEKRCDIQVNVDVLFDVQVKRFHEYKRQLLNVLSVIN 670

Query: 551 LYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVF 610
            YLDIK+GK  +   PRV IFG                IN VA++VNNDP++GD LKVVF
Sbjct: 671 RYLDIKEGKKVA---PRVVIFGGKAAPGYYMAKLIIKLINSVADVVNNDPKVGDLLKVVF 727

Query: 611 LEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVG 670
           + +Y VS AE IIPA++IS+ IS A  EASGTSNMK  +NG L + TLDGANIEI+D +G
Sbjct: 728 IPNYCVSNAEIIIPASDISQHISTAGTEASGTSNMKFSMNGGLIIGTLDGANIEIRDAIG 787

Query: 671 EDNIFIFGLTKDEVYDYYNNGNYHSYD-YYNNHEEIRRVLNAFVDGTIPNCQAEGQEIFD 729
            +N++IFG   +EV    N      +D  +       RVL A  + T      + Q+I +
Sbjct: 788 HENMYIFGARSEEV----NKVKKIIHDGKFTPDTRWARVLTAIKEDTF-GPHEQFQDIIN 842

Query: 730 SLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAE 789
           S++  ND Y +  DF SY++IQ  +D+ + ++  W + S++     G FSSD TIK YA+
Sbjct: 843 SVSGGNDHYILSYDFGSYLDIQNSIDQDFKDRAKWAKKSIMASVCCGKFSSDRTIKEYAQ 902

Query: 790 DIWNISPLK 798
            IW I   K
Sbjct: 903 QIWGIEEWK 911


>PHSG_CHLPN RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 824

 Score =  572 bits (1474), Expect = e-165
 Identities = 309/785 (39%), Positives = 459/785 (58%), Gaps = 19/785 (2%)

Query: 25  KDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMG 84
           + A+P++++  ++  V    ++ W KT   Y ++  K++YY S+EFL GR L SNLLN+G
Sbjct: 34  ESASPRDIFTAVAKTVMEWLAKGWLKTQNGYYKNDVKRVYYLSMEFLLGRSLKSNLLNLG 93

Query: 85  WLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRY 144
            L+ VR ALK L+ D D + E+E D              ++DS+A+  +P  G GIRY Y
Sbjct: 94  ILDLVRKALKTLNYDFDHLVEMESDXXXXXXXXXXXXXCYLDSMATLAVPAYGYGIRYDY 153

Query: 145 GLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKV--YLVDRGNYLEPVYED 202
           G+F Q+ ++GYQ E P+EWL  GNPWEI R      VR  G+V  Y   RG  +  +  D
Sbjct: 154 GIFDQRIVNGYQEEAPDEWLRYGNPWEICRGEYLYPVRFYGRVIHYTDSRGKQVADLV-D 212

Query: 203 AQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKY-------RTIEQRREVEDLVS 255
            Q + A+ YD  I GY N TVN++RLW A+ P   E  Y       + IE    +E++  
Sbjct: 213 TQEVLAMAYDIPIPGYGNDTVNSLRLWQAQSPRGFEFSYFNHGNYIQAIEDIALIENISR 272

Query: 256 VLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMS 315
           VLYP+DS   G+ LRLKQEYF VSA IQ I+R + K +  ++ + + + + +NDTHPA+ 
Sbjct: 273 VLYPNDSITEGQELRLKQEYFLVSATIQDIIRRYTKTHICLDNLADKVVVQLNDTHPALG 332

Query: 316 VAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQE 375
           +AE+M ILVD E + WD AW+ T  + +YTNHTI+ EALE+WP+ +  ++ PR L+II E
Sbjct: 333 IAEMMHILVDREELPWDKAWEMTTVIFNYTNHTILPEALERWPLDLFSKLLPRHLEIIYE 392

Query: 376 IDRRFVEEKQGKYAR--DMIERTRIIKD---NQVRMANLSIIGSHSTNGVAKLHTELLKD 430
           I+ R++E+   +Y +  D      I+++    ++ MANL+++GS   NGV+  H++L+KD
Sbjct: 393 INSRWLEKVGSRYPKNDDKRRSLSIVEEGYQKRINMANLAVVGSAKVNGVSSFHSQLIKD 452

Query: 431 DVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ 490
            +             N TNG+T RRW+ + NP LSK+L++ IG  +  D + L  +    
Sbjct: 453 TLXXXXXXXXXXXXINVTNGVTPRRWIALCNPRLSKLLNETIGDRYIIDLSHLSLIRSFA 512

Query: 491 NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVK 550
            D+   +     KLKNK+ L   I  E G  V  +++FD  IKR+H YKRQL+ ++ ++ 
Sbjct: 513 EDSGFRDHWKGVKLKNKQDLTSRIYNEVGEIVDPNSLFDCHIKRIHEYKRQLMNILRVIY 572

Query: 551 LYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVF 610
           +Y D+K+     D  P   IF                 IN VA++VN D  + DKLKV+F
Sbjct: 573 VYNDLKENP-NQDVVPTTVIFSGKAAPGYVMAKLIIKLINSVADVVNQDSRVNDKLKVLF 631

Query: 611 LEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVG 670
           L +YRVS+AE IIP  ++SEQIS A  EASGT NMK  LNGALT+ T+DGANIE+ +++G
Sbjct: 632 LPNYRVSMAEHIIPGTDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIG 691

Query: 671 EDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTI-PNCQAEGQEIFD 729
           ++N+FIFGL ++++        Y      + + +IR+VL+    G    N +   + I  
Sbjct: 692 KENMFIFGLLEEQIVQL--RREYCPQTICDKNPKIRQVLDLLEQGFFNSNDKDLFKPIVH 749

Query: 730 SLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAE 789
            L    D +FVL D ESY+   E V++ +     W ++S+ N A  G FSSD  I+ YA 
Sbjct: 750 RLLHEGDPFFVLADLESYIAAHENVNKLFKEPDSWTKISIYNTAGMGFFSSDRAIQDYAR 809

Query: 790 DIWNI 794
           DIW++
Sbjct: 810 DIWHV 814


>PHSG_CHLMU RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 813

 Score =  571 bits (1471), Expect = e-165
 Identities = 307/789 (38%), Positives = 465/789 (58%), Gaps = 26/789 (3%)

Query: 25  KDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMG 84
           + A+ ++++  ++  V    ++ W KT   Y ++  K++YY S+EF              
Sbjct: 30  QSASTRDIFTAVAKTVSEWMAKGWLKTQSSYYDNDVKRVYYISMEFXXXXXXXXXXXXXX 89

Query: 85  WLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRY 144
               V +AL DL  D D++ E+E D              F+DS+A+ G+P  G G+RY Y
Sbjct: 90  XXXXVNEALSDLGYDFDQLVEMEHDXXXXXXXXXXXXXCFLDSMATLGIPAYGYGLRYDY 149

Query: 145 GLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVY--LVDRGNYLEPVYED 202
           G+F Q+  +GYQ+E P+EWL  GNPWEI R      V   GKV   +  RG  +  +  D
Sbjct: 150 GIFDQQIENGYQVESPDEWLRYGNPWEICRGEYLYPVHFYGKVKHSMDSRGRDVAELV-D 208

Query: 203 AQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKY-------RTIEQRREVEDLVS 255
           +Q + A+ YD  + G+ N TVN++RLW A+     E  Y       R IE      ++  
Sbjct: 209 SQEVLAMAYDVPVPGFNNDTVNSLRLWQAQSRHGFEFSYFNHGNYIRAIEDIALASNITR 268

Query: 256 VLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMS 315
           VLYP+DS   G+ LRLKQEYF VSA IQ I+R + K + S++K+ E + + +NDTHPA+ 
Sbjct: 269 VLYPNDSISEGQELRLKQEYFLVSATIQDILRRYTKTHLSLDKLSEKVSVQLNDTHPALG 328

Query: 316 VAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQE 375
           +AE+M ILVD E + WD AW  T  + +YTNHTI+ EALE+W + +  +V PR L+II E
Sbjct: 329 IAEMMHILVDREELDWDVAWDTTTKIFNYTNHTILPEALERWSLDLFSKVLPRHLEIIYE 388

Query: 376 IDRRFVEEKQGKYARDMIER--TRIIKDNQ---VRMANLSIIGSHSTNGVAKLHTELLKD 430
           I+ R++++   KY  D  +R    II++     + MANL++IG+   NGV+  H++L+K+
Sbjct: 389 INARWLKKVSQKYPGDDDKRRALSIIEEGSSKFINMANLAVIGTSKVNGVSSFHSQLIKN 448

Query: 431 DVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQ 490
            +  DF   +P++F N TNGIT RRWL ++N  LS +L+++IGT++  + T L K++   
Sbjct: 449 TLFKDFVEFFPDKFINVTNGITPRRWLALSNKRLSALLNRSIGTDYLTNLTHLNKVISLA 508

Query: 491 NDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVK 550
            D+    +    K++NKE L+  I KE G+ V+  +IFD  IKR+H YKRQL+ ++ ++ 
Sbjct: 509 EDSGFREEWHKIKIQNKEDLSARIYKELGVSVNPQSIFDCHIKRIHEYKRQLMNILRVIY 568

Query: 551 LYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVF 610
            Y +I+ G  +++  P   IFG                IN VA++VNNDP+  D LKVVF
Sbjct: 569 FYNEIRNG--STEIVPTTVIFGGKAAPGYAMAKLIIKLINNVAHIVNNDPKAKDLLKVVF 626

Query: 611 LEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVG 670
             +YRVSLAE IIPA ++SEQIS A  EASGT NMK  LNGALT+ T+DGANIE+ +++G
Sbjct: 627 WPNYRVSLAEAIIPATDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIG 686

Query: 671 EDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIF-- 728
           ++++FIFGL ++E+    N   Y+     N + +I+ +L+  +   +P    E +++F  
Sbjct: 687 KEHMFIFGLLEEEISALRN--EYYPQGICNANPKIQEILDMVLQARLPE---EDKDLFKP 741

Query: 729 --DSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKR 786
             + L    D +FVL D ESY++    V R ++    W + S+ N+   G FSSD +I  
Sbjct: 742 IVNRLLNEGDPFFVLADLESYLDAHNRVARLFTQPEEWTKKSIYNVGGIGFFSSDRSITD 801

Query: 787 YAEDIWNIS 795
           YA +IWN+S
Sbjct: 802 YASNIWNVS 810


>PHSG_CHLTR RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 814

 Score =  555 bits (1431), Expect = e-160
 Identities = 300/788 (38%), Positives = 449/788 (56%), Gaps = 24/788 (3%)

Query: 25  KDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMG 84
           + A+ ++++  ++  V    ++ W KT   Y ++  K++YY S+EF              
Sbjct: 30  QSASTRDIFTAVAKTVLEWMAKGWLKTQSSYYDNDVKRVYYISMEFXXXXXXXXXXXXXX 89

Query: 85  WLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRY 144
               V++AL DL  D D++ E+E D              F+DS+A+  +P  G G+RY Y
Sbjct: 90  XXXXVKEALFDLGYDFDQLVEMEHDXXXXXXXXXXXXXCFLDSMATLEIPAYGYGLRYDY 149

Query: 145 GLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKV-YLVDRGNYLEPVYEDA 203
           G+F QK  +G+Q+E P+EWL  GNPWEI R      V   GKV + +D          D+
Sbjct: 150 GIFDQKIENGFQVESPDEWLRYGNPWEICRGEYLYPVHFYGKVKHSIDSRGRDVAELVDS 209

Query: 204 QLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKY-------RTIEQRREVEDLVSV 256
           Q + A+ YD  + G+ N  VN++RLW A+     E  Y       R IE      ++  V
Sbjct: 210 QEVLAMAYDVPVPGFNNDAVNSLRLWQAQSRHGFEFSYFNHGNYIRAIEDIALAGNITRV 269

Query: 257 LYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSV 316
           LYP+DS   G+ LRLKQEYF VSA IQ I+R + K + S++K+ E + + +NDTHPA+ +
Sbjct: 270 LYPNDSISEGQELRLKQEYFLVSATIQDILRRYTKTHLSLDKLSEKVSVQLNDTHPALGI 329

Query: 317 AELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEI 376
           AE+MR+LVD E + WD AW  T  + +YTNHTI+ EALE+W + +  +V PR L+II EI
Sbjct: 330 AEMMRLLVDREELDWDVAWDATTKIFNYTNHTILPEALERWSLDLFSKVLPRHLEIIYEI 389

Query: 377 DRRFVEEKQGKYARDMIER--TRIIKDNQ---VRMANLSIIGSHSTNGVAKLHTELLKDD 431
           + R++ +   KY  D  +R    II++     V MANL+++G++  NGV+  H++L+K  
Sbjct: 390 NARWLAKVSQKYPGDNDKRRALSIIEEGSSKFVNMANLAVVGTNKVNGVSTFHSQLIKST 449

Query: 432 VLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQN 491
           +  DF   +P++F N TNGIT RRWL            + IGTE+  + T L K++    
Sbjct: 450 LFKDFVEFFPDKFINVTNGITPRRWLAXXXXXXXXXXXRTIGTEYLTNLTHLHKVIPLAE 509

Query: 492 DNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKL 551
           D+    +  N K++NKE LA  I KE G+ V+  +IFD  IKR+H YKRQL+ ++ ++  
Sbjct: 510 DSGFREEWRNIKIQNKEELAARIYKELGVTVNPQSIFDCHIKRIHEYKRQLMNILRVIYF 569

Query: 552 YLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFL 611
           Y +I+ G  + +  P   IFG                IN VA +VNNDP++ D+LKV+F 
Sbjct: 570 YNEIRNG--SGEIVPTTVIFGGKAAPGYAMAKLIIKLINNVAAVVNNDPKVNDQLKVIFW 627

Query: 612 EDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGE 671
            +YRVSLAE IIPA ++SEQIS A  EASGT NMK  LNGALT+ T+DGANIE+ +++G+
Sbjct: 628 PNYRVSLAEAIIPATDLSEQISTAGMEASGTGNMKFALNGALTIGTMDGANIEMAEHIGK 687

Query: 672 DNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIF--- 728
           +++FIFGL ++E+ +      Y+     N +  I+ +L+            E +++F   
Sbjct: 688 EHMFIFGLLEEEISEL--RKEYYPQGICNANPTIQEILDMIAQAKF---SQEDKDLFKPI 742

Query: 729 -DSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRY 787
            + L    D +FVL D E+Y+N Q  V   +     W + S+ N+   G FSSD +I  Y
Sbjct: 743 VNRLLNEGDPFFVLADLEAYINTQNRVASLFKQPEEWTKKSIYNVGGIGFFSSDRSIAEY 802

Query: 788 AEDIWNIS 795
           A +IWN+S
Sbjct: 803 ASNIWNVS 810


>PHS1_DICDI RecName: Full=Glycogen phosphorylase 1;       
           Short=GP1;         EC=2.4.1.1;
          Length = 853

 Score =  548 bits (1412), Expect = e-158
 Identities = 301/776 (38%), Positives = 458/776 (59%), Gaps = 20/776 (2%)

Query: 40  VRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETVRDALKDLDID 99
           VR      W +T + Y E   K++YY S+EFL GR L + + NM   +   +AL +L  +
Sbjct: 76  VRDRLIERWNETQQYYTERDPKRVYYLSMEFLMGRSLQNAIYNMNLKDEYHNALLELGFE 135

Query: 100 LDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFIDGYQIEL 159
           ++++ E EKD              FMDSLA+   P  G G+RY YG+F+Q   DGYQ E+
Sbjct: 136 MEDLYEEEKDXXXXXXXXXXXXXCFMDSLATLKYPAWGYGLRYNYGMFEQGIYDGYQTEV 195

Query: 160 PNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYK 219
           P+ WL +GNPWEI R     TVR  G+V      +  +  ++  +L++A+ YDT + GY 
Sbjct: 196 PDYWLVAGNPWEIERLDVQYTVRFYGQVTEKKSSDGSKFEWDHGELVQAIAYDTPVPGYH 255

Query: 220 NGTVNTMRLWDA------EIPSSEEAKYRT-IEQRREVEDLVSVLYPDDSKESGRILRLK 272
               N +RLW +      ++ +     Y + +E ++  E++ SVLYP+D+  SG+ LRLK
Sbjct: 256 TTNTNNIRLWSSKPHKEFDLDAFNGGNYLSAVEAKQRSENITSVLYPNDNTYSGKELRLK 315

Query: 273 QEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWD 332
           Q+YFFV+A +  ++R FKK +++       + I +NDTHP + V EL R L+DEE + W+
Sbjct: 316 QQYFFVAATLCDVIRRFKKSHQNWQDFPNKVAIQLNDTHPTIGVVELFRKLIDEEGLQWE 375

Query: 333 DAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDM 392
           +AW       +YTNHTI+ EALE WPV +++ + PR +Q+I  I+ RF+ +   K+  D+
Sbjct: 376 EAWDIVTKTFAYTNHTILPEALEMWPVSLIEDLLPRHMQLIYGINHRFLIQVTQKWPGDI 435

Query: 393 --IERTRIIKDNQ---VRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNK 447
             +    II++ +   VRMA+L+I+GSH  NGVA +H+EL+K  V  DF+ ++PE+F NK
Sbjct: 436 GKMRGLSIIQEGEEKRVRMAHLAIVGSHCVNGVAAMHSELVKHKVFPDFFCLWPEKFQNK 495

Query: 448 TNGITDRRWLQIANPELSKVLDKAIGTE-WRQDPTKLQKLLKHQNDNKVLNQIANAKLKN 506
           TNG+T RRW++ ANP LS +  K +GT+ W  +   ++ + +H ++ +++ +    K  N
Sbjct: 496 TNGVTPRRWIEQANPGLSAIFTKWLGTDKWTTNLELVKGIKEHMDNPELIAEWKYVKQGN 555

Query: 507 KERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQ--GKVASDF 564
           K+RLA+FI K  GI V+ +A+FDV IKR+H YKRQLL ++ ++  YL IK+   K  +  
Sbjct: 556 KQRLAEFILKHCGIHVNPNALFDVHIKRIHEYKRQLLNILSVIYRYLSIKKMSPKDRAQV 615

Query: 565 QPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIP 624
            PRV IF                 IN VA ++N D E+   LKVVF+ +Y VS+A+ I+P
Sbjct: 616 VPRVVIFAGKAAPGYVMAKRHIKLINSVAEVINRDKEVDQYLKVVFIANYNVSIAQVIVP 675

Query: 625 AANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEV 684
           A++I++QIS A  EASGTSNMK  +NG+L + TLDGAN+EI + VG++N+FIFGL   EV
Sbjct: 676 ASDINQQISTAGTEASGTSNMKFTMNGSLIIGTLDGANVEIAEEVGQENMFIFGLRTSEV 735

Query: 685 YDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDF 744
                       +     +E+   LN  +    P      + I DSL  ++D Y  ++DF
Sbjct: 736 EAAREKMTNKEVNIDPRLQEV--FLNIELGTFGP--PDVFRPILDSLI-FSDFYLSIQDF 790

Query: 745 ESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLKDE 800
             Y++ Q  VD  + ++  W + S++N A    FSSD  +  YAE IW+I P + E
Sbjct: 791 PLYLDSQASVDELWKDQSAWVKKSIINSASTYFFSSDRAMNEYAEQIWDIKPCEVE 846


>PHSG_YEAST RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 902

 Score =  541 bits (1393), Expect = e-155
 Identities = 312/814 (38%), Positives = 461/814 (56%), Gaps = 53/814 (6%)

Query: 33  YLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGW------- 85
           Y   S  +R +    W KT +K+     K++YY S+EFL GR L + L+NM         
Sbjct: 92  YEAASMSIRDNLVIDWNKTQQKFTTRDPKRVYYLSLEFLMGRALDNALINMKIEDPEDPA 151

Query: 86  ------LETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNG 139
                  E ++ AL +    L+++ + E D              F+DS+A++G+P  G G
Sbjct: 152 ASKGKPREMIKGALDEGGFKLEDVLDQEPDXXXXXXXXXXXXXCFVDSMATEGIPAWGYG 211

Query: 140 IRYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPV 199
           +RY YG+F QK IDGYQ+E P+ WL+SGNPWEI R    + V   G V   + G      
Sbjct: 212 LRYEYGIFAQKIIDGYQVETPDYWLNSGNPWEIERNEVQIPVTFYGYVDRPEGGKTTLSA 271

Query: 200 YE--DAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEE--AKYR------TIEQRRE 249
            +    + + AV YD  + G+K   VN +RLW A  P++E   AK+       ++ Q++ 
Sbjct: 272 SQWIGGERVLAVAYDFPVPGFKTSNVNNLRLWQAR-PTTEFDFAKFNNGDYKNSVPQQQR 330

Query: 250 VEDLVSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHIND 309
            E + +VLYP+D+   G+ LRLKQ+YF+ +A +  I+R FKK  +   +  + + I +ND
Sbjct: 331 AESITAVLYPNDNFAQGKELRLKQQYFWCAASLHDILRRFKKSKRPWTEFPDQVAIQLND 390

Query: 310 THPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRI 369
           THP +++ EL R+LVD E + W +AW       +YTNHT+M EALEKWP  +   + PR 
Sbjct: 391 THPTLAIVELQRVLVDLEKLDWHEAWDIVTKTFAYTNHTVMQEALEKWPRRLFGHLLPRH 450

Query: 370 LQIIQEIDRRFVEEKQGKYAR--DMIERTRIIKDN----QVRMANLSIIGSHSTNGVAKL 423
           L+II +I+  F+++   K+ +  D++ R  II++N    Q+RMA L+I+GSH  NGV +L
Sbjct: 451 LEIIYDINWFFLQDVAKKFPKDVDLLSRISIIEENSPERQIRMAFLAIVGSHKVNGVVEL 510

Query: 424 HTELLKDDVLHDFYVMY-PERFNNKTNGITDRRWLQIANPELSKVLDKAIG---TEWRQD 479
           H+EL+K  +  DF   Y P +F N TNGIT RRWL+ ANP L+K++ + +     E+  D
Sbjct: 511 HSELIKTTIFKDFIKFYGPSKFVNVTNGITPRRWLKQANPSLAKLISETLNDPTEEYLLD 570

Query: 480 PTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKET-GIKVST-----DAIFDVQIK 533
             KL +L K+  D + L +    KL NK RL   I+KE  G+ +       D +FD+Q+K
Sbjct: 571 MAKLTQLEKYVEDKEFLKKWNQVKLNNKIRLVDLIKKENDGVDIINREYLDDTLFDMQVK 630

Query: 534 RLHAYKRQLLKLMHIVKLYLDIKQ--------GKVASDFQPRVFIFGXXXXXXXXXXXXX 585
           R+H YKRQ L +  I+  YL +K          +VA  +  +V IFG             
Sbjct: 631 RIHEYKRQQLNVFGIIYRYLAMKNMLKNGASIEEVAKKYPRKVSIFGGKSAPGYYMAKLI 690

Query: 586 XXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNM 645
              IN VA++VNND  I   LKVVF+ DY VS AE IIPA+++SE IS A  EASGTSNM
Sbjct: 691 IKLINCVADIVNNDESIEHLLKVVFVADYNVSKAEIIIPASDLSEHISTAGTEASGTSNM 750

Query: 646 KLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEI 705
           K ++NG L + T+DGAN+EI   +GEDN+F+FG   + V +   N  YH  D  ++   +
Sbjct: 751 KFVMNGGLIIGTVDGANVEITREIGEDNVFLFGNLSENVEELRYNHQYHPQDLPSS---L 807

Query: 706 RRVLNAFVDGTI-PNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKR-H 763
             VL+    G   P    E + + DS+  + D Y V  DFESY+   E+VD+ + N+R  
Sbjct: 808 DSVLSYIESGQFSPENPNEFKPLVDSIKYHGDYYLVSDDFESYLATHELVDQEFHNQRSE 867

Query: 764 WNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPL 797
           W + S++++A  G FSSD  I+ Y++ IWN+ P+
Sbjct: 868 WLKKSVLSLANVGFFSSDRCIEEYSDTIWNVEPV 901


>PHSM_ECOLI RecName: Full=Maltodextrin phosphorylase;       
           EC=2.4.1.1;
          Length = 797

 Score =  537 bits (1383), Expect = e-154
 Identities = 298/744 (40%), Positives = 427/744 (57%), Gaps = 20/744 (2%)

Query: 60  KKQIYYFSIEFLPGRLLMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGR 119
           ++ + Y S+EF              W + V+D+LK  DI+L ++ E E D          
Sbjct: 59  QRHVNYISMEFXXXXXXXXXXXXXXWYQDVQDSLKAYDINLTDLLEEEIDPXXXXXXXXX 118

Query: 120 LASAFMDSLASDGLPGNGNGIRYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSV 179
               F+DS+A+ G    G G+ Y+YGLF+Q F+DG Q+E P++W  S  PW    E+  V
Sbjct: 119 XXXCFLDSMATVGQSATGYGLNYQYGLFRQSFVDGKQVEAPDDWHRSNYPWFRHNEALDV 178

Query: 180 TVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMRLWDA------EI 233
            V +GGKV    R       +E    I    +D  +VGY+NG    +RLW A      ++
Sbjct: 179 QVGIGGKVTKDGR-------WEPEFTITGQAWDLPVVGYRNGVAQPLRLWQATHAHPFDL 231

Query: 234 PSSEEAKYRTIEQRR-EVEDLVSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKY 292
               +  +   EQ+    E L  VLYP+D+  +G+ LRL Q+YF  +  +  I+R     
Sbjct: 232 TKFNDGDFLRAEQQGINAEKLTKVLYPNDNHTAGKKLRLMQQYFQCACSVADILRRHHLA 291

Query: 293 NKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAE 352
            + ++++ +Y  I +NDTHP +++ EL+R+L+DE  MSWDDAW  T    +YTNHT+M E
Sbjct: 292 GRKLHELADYEVIQLNDTHPTIAIPELLRVLIDEHQMSWDDAWAITSKTFAYTNHTLMPE 351

Query: 353 ALEKWPVHIMQQVQPRILQIIQEIDRRF--VEEKQGKYARDMIERTRIIKDNQVRMANLS 410
           ALE+W V +++ + PR +QII EI+ RF  + EK       +  +  ++ D QV MANL 
Sbjct: 352 ALERWDVKLVKGLLPRHMQIINEINTRFKTLVEKTWPGDEKVWAKLAVVHDKQVHMANLC 411

Query: 411 IIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDK 470
                       LH++L+  D+  +++ ++P +F+N TNGIT RRW++  NP L+ +LDK
Sbjct: 412 XXXXXXXXXXXXLHSDLVVKDLFPEYHQLWPNKFHNVTNGITPRRWIKQCNPALAALLDK 471

Query: 471 AIGTEWRQDPTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDV 530
           ++  EW  D  +L  L K  +D K   Q    K  NK RLA+F++  TGI+++  AIFD+
Sbjct: 472 SLQKEWANDLDQLINLEKFADDAKFRQQYREIKQANKVRLAEFVKVRTGIEINPQAIFDI 531

Query: 531 QIKRLHAYKRQLLKLMHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCIN 590
           QIKRLH YKRQ L L+HI+ LY +I++   A D  PRVF+FG                IN
Sbjct: 532 QIKRLHEYKRQHLNLLHILALYKEIRENPQA-DRVPRVFLFGAKAAPGYYLAKNIIFAIN 590

Query: 591 EVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLN 650
           +VA+++NNDP +GDKLKVVFL DY VS AEK+IPAA+ISEQIS A KEASGT NMKL LN
Sbjct: 591 KVADVINNDPLVGDKLKVVFLPDYCVSAAEKLIPAADISEQISTAGKEASGTGNMKLALN 650

Query: 651 GALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLN 710
           GALTV TLDGAN+EI + VGE+NIFIFG T ++V      G Y    +    + +  VL 
Sbjct: 651 GALTVGTLDGANVEIAEKVGEENIFIFGHTVEQVKAILAKG-YDPVKWRKKDKVLDAVLK 709

Query: 711 AFVDGTIPNCQAEG-QEIFDSLTKY-NDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMS 768
               G   +       ++  S+ K   D Y V+ DF +YV  Q+ VD  Y ++  W + +
Sbjct: 710 ELESGKYSDGDKHAFDQMLHSIGKQGGDPYLVMADFAAYVEAQKQVDVLYRDQEAWTRAA 769

Query: 769 LVNIAYGGMFSSDDTIKRYAEDIW 792
           ++N A  GMFSSD +I+ Y   IW
Sbjct: 770 ILNTARCGMFSSDRSIRDYQARIW 793


>PHSH_ARATH RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
               EC=2.4.1.1;AltName: Full=Starch phosphorylase H;
          Length = 841

 Score =  533 bits (1372), Expect = e-153
 Identities = 297/798 (37%), Positives = 465/798 (58%), Gaps = 36/798 (4%)

Query: 24  VKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNM 83
           +K    Q LY T  S+ R    + W +T+  + +   KQ YY S+E+L GR L + + N+
Sbjct: 47  LKFGPEQALYATAESL-RDRLIQLWNETYVHFNKVDPKQTYYLSMEYLQGRALTNAIGNL 105

Query: 84  GWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYR 143
                  DAL+ L  +L+EIAE EKD            S F+DS+A+  LP  G G+RYR
Sbjct: 106 NLQGPYADALRTLGYELEEIAEQEKDXXXXXXXXXXXXSCFLDSMATLNLPAWGYGLRYR 165

Query: 144 YGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDA 203
           +GLFKQ      Q E+P +WL+  +PWEI R      VR  GKV +   G+     + D 
Sbjct: 166 HGLFKQIITKKGQEEIPEDWLEKFSPWEIVRHDVVFPVRFFGKVQVNPDGSRK---WVDG 222

Query: 204 QLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSE-------EAKYRTIEQ-RREVEDLVS 255
            +++A+ YD  I GY      ++RLW+A+  + +       E +Y    Q     + + +
Sbjct: 223 DVVQALAYDVPIPGYGTKNTISLRLWEAKARAEDLDLFQFNEGEYELAAQLHSRAQQICT 282

Query: 256 VLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHF--KKYNKSMNKIGEY---IGIHINDT 310
           VLYP D+ E+G++LRLKQ++F  SA +Q I+  F  +   +   K  E+   + + +NDT
Sbjct: 283 VLYPGDATENGKLLRLKQQFFLCSASLQDIISRFHERSTTEGSRKWSEFPSKVAVQMNDT 342

Query: 311 HPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRIL 370
           HP +++ ELMR+L+D+  + WD+AW  T   ++YTNHT++ EALEKW   +M ++ PR +
Sbjct: 343 HPTLAIPELMRLLMDDNGLGWDEAWDVTSKTVAYTNHTVLPEALEKWSQSLMWKLLPRHM 402

Query: 371 QIIQEIDRRFVEEKQGKYA--RDMIERTRIIKDNQ----VRMANLSIIGSHSTNGVAKLH 424
           +II+EID+RFV+  +       D I    I+ +N     VRMANL ++ SH+ NGVA+LH
Sbjct: 403 EIIEEIDKRFVQTIRDTRVDLEDKISSLSILDNNPQKPVVRMANLCVVSSHTVNGVAQLH 462

Query: 425 TELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTE-WRQDPTKL 483
           +++LK ++  D+  ++P +F NKTNGIT RRWL+  +PELS ++ K + T+ W  D   L
Sbjct: 463 SDILKAELFADYVSIWPNKFQNKTNGITPRRWLRFCSPELSDIITKWLKTDKWITDLDLL 522

Query: 484 QKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLL 543
             L +  ++ ++ ++ A+AK  NK+RLA++IE+ TG+ +   ++FD+Q+KR+H YKRQL+
Sbjct: 523 TGLRQFADNEELQSEWASAKTANKKRLAQYIERVTGVSIDPTSLFDIQVKRIHEYKRQLM 582

Query: 544 KLMHIVKLYLDIKQGKVASDFQ--PRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPE 601
            ++ +V  +  +K+ K     +  PR  + G                +N+V ++VN+DPE
Sbjct: 583 NILGVVYRFKKLKEMKPEERKKTVPRTVMIGGKAFATYTNAKRIVKLVNDVGDVVNSDPE 642

Query: 602 IGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGA 661
           + + LKVVF+ +Y V++AE +IP + +S+ IS A  EASGTSNMK  LNG L + TLDGA
Sbjct: 643 VNEYLKVVFVPNYNVTVAEMLIPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGA 702

Query: 662 NIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQ 721
           N+EI++ VGE+N F+FG T D+V           +      EE ++ + + V G+     
Sbjct: 703 NVEIREEVGEENFFLFGATADQVPRLRKEREDGLFKPDPRFEEAKQFVKSGVFGSY---- 758

Query: 722 AEGQEIFDSLT-----KYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGG 776
            +   + DSL         D + V  DF SY++ Q  VD  Y +++ W +MS+++ A  G
Sbjct: 759 -DYGPLLDSLEGNTGFGRGDYFLVGYDFPSYMDAQAKVDEAYKDRKGWLKMSILSTAGSG 817

Query: 777 MFSSDDTIKRYAEDIWNI 794
            FSSD TI +YA++IWNI
Sbjct: 818 KFSSDRTIAQYAKEIWNI 835


>PHSM_STRPN RecName: Full=Maltodextrin phosphorylase;       
           EC=2.4.1.1;
          Length = 752

 Score =  532 bits (1371), Expect = e-153
 Identities = 304/782 (38%), Positives = 457/782 (58%), Gaps = 39/782 (4%)

Query: 16  LDEKYALDVKDATPQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRL 75
           +  +Y   + + + +ELYL L +  + + S+       K +  GKK++YY S EFL G+L
Sbjct: 8   VQNRYNKTIAECSNEELYLALLNYSKLASSQ-------KPVNTGKKKVYYISAEFLIGKL 60

Query: 76  LMSNLLNMGWLETVRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPG 135
           L +NL+N+G  + V+  L     DL E+ EVE + +LGNGGLGRLA+ F+DS+A+ GL G
Sbjct: 61  LSNNLINLGLYDDVKKELAAAGKDLIEVEEVELEPSLGNGGLGRLAACFIDSIATLGLNG 120

Query: 136 NGNGIRYRYGLFKQKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNY 195
           +G G+ Y +GLF+Q   +  Q  +PN WL   N W +R  S+S  V              
Sbjct: 121 DGVGLNYHFGLFQQVLKNNQQETIPNAWLTEQN-WLVR-SSRSYQVP------------- 165

Query: 196 LEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRREV-EDLV 254
               + D  L   + YD  + GY+  T N +RL+D +   S   K      + ++  +L 
Sbjct: 166 ----FADFTLTSTL-YDIDVTGYETATKNRLRLFDLDSVDSSIIKDGINFDKTDIARNLT 220

Query: 255 SVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEYIGIHINDTHPAM 314
             LYPDDS   G +LR+ Q+YF VS G Q I+    +   +++ + +Y  + INDTHP+M
Sbjct: 221 LFLYPDDSDRQGELLRIFQQYFMVSNGAQLIIDEAIEKGSNLHDLADYAVVQINDTHPSM 280

Query: 315 SVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQ 374
            + EL+R+L     +  D+A     ++ +YTNHTI+AEALEKWP+  +Q+V P ++ II+
Sbjct: 281 VIPELIRLLT-ARGIDLDEAISIVRSMTAYTNHTILAEALEKWPLEFLQEVVPHLVPIIE 339

Query: 375 EIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGVAKLHTELLKDDVLH 434
           E+DRR   E +    + + E  R      V MA++ I   +S NGVA LHTE+LK+  L 
Sbjct: 340 ELDRRVKAEYKDPAVQIIDESGR------VHMAHMDIHYGYSVNGVAALHTEILKNSELK 393

Query: 435 DFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQNDNK 494
            FY +YPE+FNNKTNGIT RRWL  ANP LS  LD+ +G  W  +  +L+KLL +++   
Sbjct: 394 AFYDLYPEKFNNKTNGITFRRWLMHANPRLSHYLDEILGDGWHHEADELEKLLSYEDKAV 453

Query: 495 VLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLD 554
           V  ++ + K  NK +LA+ +++  G++++ ++IFD+QIKRLH YKRQ +  ++++  YLD
Sbjct: 454 VKEKLESIKAHNKRKLARHLKEHQGVEINPNSIFDIQIKRLHEYKRQQMNALYVIHKYLD 513

Query: 555 IKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDY 614
           IK G + +  +P    FG                I  ++ ++ NDP +   L+VV +E+Y
Sbjct: 514 IKAGNIPA--RPITIFFGGKAAPAYTIAQDIIHLILCMSEVIANDPAVAPHLQVVMVENY 571

Query: 615 RVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNI 674
            V+ A  +IPA +ISEQISLASKEASGT NMK MLNGALT+ T+DGAN+EI + VGE+NI
Sbjct: 572 NVTAASFLIPACDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELVGEENI 631

Query: 675 FIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFV-DGTIPNCQAEGQEIFDSLTK 733
           +IFG   + V D Y    Y S ++Y   E I+ +++  V D  +     E  E F +   
Sbjct: 632 YIFGEDSETVIDLYAKAAYKSSEFY-AREAIKPLVDFIVSDAVLAAGNKERLERFYNELI 690

Query: 734 YNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWN 793
             D +  L D E Y+ ++E +   Y ++  W    +VNI+  G FSSD TI +Y EDIW+
Sbjct: 691 NKDWFMTLLDLEDYIKVKEQMLADYEDRDAWLDKVIVNISKAGFFSSDRTIAQYNEDIWH 750

Query: 794 IS 795
           ++
Sbjct: 751 LN 752


>PHSH_VICFA RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
               EC=2.4.1.1;AltName: Full=Starch phosphorylase H;
          Length = 842

 Score =  525 bits (1352), Expect = e-151
 Identities = 290/790 (36%), Positives = 455/790 (57%), Gaps = 33/790 (4%)

Query: 30  QELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETV 89
           Q+ Y   +  VR    + W +T+  + +   KQ YY S+EFL GR L + + N+   +  
Sbjct: 55  QQAYYATAESVRDRLIQQWNETYLHFHKVDPKQTYYLSMEFLQGRALTNAIGNLNIQDAY 114

Query: 90  RDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQ 149
            DAL+   ++L+EI E EKD            S F+DS+A+  LP  G G+RYRYGLFKQ
Sbjct: 115 ADALRKFGLELEEITEQEKDXXXXXXXXXXXXSCFLDSMATLNLPAWGYGLRYRYGLFKQ 174

Query: 150 KFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAV 209
                 Q E+  +WL+  +PWEI R      +R  G+V +   G+     +   ++I+A+
Sbjct: 175 IITKEGQEEVAEDWLEKFSPWEIVRHDVLYPIRFFGQVEVNPDGSRQ---WIGGEVIQAL 231

Query: 210 PYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKYRTIEQRRE--------VEDLVSVLYPDD 261
            YD  I GY+     ++RLW+A+  + +   +   + + E         + + SVLYP D
Sbjct: 232 AYDVPIPGYQTKNTISLRLWEAKACADDFDLFLFNDGQLESASVLHSRAQQICSVLYPGD 291

Query: 262 SKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEY---IGIHINDTHPAMSVAE 318
           + E G++LRLKQ+YF  SA +Q I+  FK+  +      E+   + + +NDTHP +S+ E
Sbjct: 292 ATEGGKLLRLKQQYFLCSASLQDIISRFKERRQGPWNWSEFPTKVAVQLNDTHPTLSIPE 351

Query: 319 LMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEIDR 378
           LMR+L+D+E + WD+AW  T   ++YTNHT++ EALEKW   +M ++ PR ++II+EIDR
Sbjct: 352 LMRLLMDDEGLGWDEAWAVTSKTVAYTNHTVLPEALEKWSQPVMWKLLPRHMEIIEEIDR 411

Query: 379 RFVE--EKQGKYARDMIERTRIIKDNQ----VRMANLSIIGSHSTNGVAKLHTELLKDDV 432
           RFV    K      D +   RI+ +N     VRMANL ++ SH+ NGVA+LH+++LK ++
Sbjct: 412 RFVALISKTRLDLEDEVSNMRILDNNLQKPVVRMANLCVVSSHTVNGVAQLHSDILKSEL 471

Query: 433 LHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTE-WRQDPTKLQKLLKHQN 491
              +  ++P +F NKTNGIT RRW+   +PELS+++ K + T+ W  +   L  L +  +
Sbjct: 472 FASYVSIWPTKFQNKTNGITPRRWINFCSPELSRIITKWLKTDKWVTNLDLLTGLREFAD 531

Query: 492 DNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKL 551
           +  +  +  +AK  NK+RLA+++ + TG  +  D++FD+Q+KR+H YKRQLL ++ ++  
Sbjct: 532 NEDLQAEWLSAKRANKQRLAQYVLQVTGENIDPDSLFDIQVKRIHEYKRQLLNILGVIYR 591

Query: 552 YLDIKQ--GKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVV 609
           Y  +K+   +       R  + G                +++V ++VN+DPE+   LKVV
Sbjct: 592 YKKLKEMSPEERKSTTARTVMIGGKAFATYTNAKRIVKLVDDVGSVVNSDPEVNSYLKVV 651

Query: 610 FLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKDYV 669
           F+ +Y VS+AE +IP + +S+ IS A  EASGTSNMK  LN  L + TLDGAN+EI++ +
Sbjct: 652 FVPNYNVSVAEVLIPGSELSQHISTAGMEASGTSNMKFALNRVLIIGTLDGANVEIREEI 711

Query: 670 GEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIFD 729
           GE+N F+FG T DEV           +      EE ++ + + V G+      +   + D
Sbjct: 712 GEENFFLFGATADEVPRLRKERENGLFKPDPRFEEAKKFIRSGVFGSY-----DYNPLLD 766

Query: 730 SLTKYN-----DEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTI 784
           SL   +     D + V  DF SY++ QE VD  Y +K+ W +MS+++ A  G FSSD TI
Sbjct: 767 SLEGNSGYGRGDYFLVGYDFPSYMDAQEKVDEAYRDKKRWLKMSILSTAGSGKFSSDRTI 826

Query: 785 KRYAEDIWNI 794
            +YA++IWNI
Sbjct: 827 AQYAKEIWNI 836


>PHSH_SOLTU RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
               EC=2.4.1.1;AltName: Full=Starch phosphorylase H;
          Length = 838

 Score =  520 bits (1338), Expect = e-149
 Identities = 284/789 (35%), Positives = 451/789 (57%), Gaps = 27/789 (3%)

Query: 30  QELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETV 89
           Q  Y   +  VR    + W  T+  Y +   KQ YY S+E+L GR L + + N+      
Sbjct: 49  QAYYAATADSVRDRLIKQWNDTYLHYDKVNPKQTYYLSMEYLQGRALTNAVGNLDIHNAY 108

Query: 90  RDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQ 149
            DAL  L           KD            S F+DS+A+  LP  G G+RYRYGLFKQ
Sbjct: 109 ADALNKLGXXXXXXXXXXKDXXXXXXXXXXXXSCFLDSMATLNLPAWGYGLRYRYGLFKQ 168

Query: 150 KFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAV 209
                 Q E+P +WL+  +PWEI R      +R  G V ++  G+     +   ++++A+
Sbjct: 169 LITKAGQEEVPEDWLEKFSPWEIVRHDVVFPIRFFGHVEVLPSGSRK---WVGGEVLQAL 225

Query: 210 PYDTAIVGYKNGTVNTMRLWDAEIPSSE-------EAKYRTIEQ-RREVEDLVSVLYPDD 261
            YD  I GY+    N++RLW+A+  S +       + +Y    Q     + + +VLYP D
Sbjct: 226 AYDVPIPGYRTKNTNSLRLWEAKASSEDFNLFLFNDGQYDAAAQLHSRAQQICAVLYPGD 285

Query: 262 SKESGRILRLKQEYFFVSAGIQSIVRHFK-----KYNKSMNKIGEYIGIHINDTHPAMSV 316
           + E+G++LRLKQ++F  SA +Q I+  FK     K +   ++  + + I +NDTHP +++
Sbjct: 286 ATENGKLLRLKQQFFLCSASLQDIIARFKEREDGKGSHQWSEFPKKVAIQLNDTHPTLTI 345

Query: 317 AELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEI 376
            ELMR+L+D+E + WD++W  T   ++YTNHT++ EALEKW   +M ++ PR ++II+EI
Sbjct: 346 PELMRLLMDDEGLGWDESWNITTRTIAYTNHTVLPEALEKWSQAVMWKLLPRHMEIIEEI 405

Query: 377 DRRFVEEKQGKYA--RDMIERTRIIKDNQ----VRMANLSIIGSHSTNGVAKLHTELLKD 430
           D+RFV     +     + +   RI+  N     V MANL ++ SH+ NGVA+LH+++LK 
Sbjct: 406 DKRFVATIMSERPDLENKMPSMRILDHNATKPVVHMANLCVVSSHTVNGVAQLHSDILKA 465

Query: 431 DVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTE-WRQDPTKLQKLLKH 489
           ++  D+  ++P +F NKTNGIT RRW++  +PELS ++ K + T+ W  +   L  L + 
Sbjct: 466 ELFADYVSVWPTKFQNKTNGITPRRWIRFCSPELSHIITKWLKTDQWVTNLELLANLREF 525

Query: 490 QNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIV 549
            +++++  +  +AK+ NK+RLA++I   TG+ +  +++FD+Q+KR+H YKRQLL ++ ++
Sbjct: 526 ADNSELHAEWESAKMANKQRLAQYILHVTGVSIDPNSLFDIQVKRIHEYKRQLLNILGVI 585

Query: 550 KLYLDIK--QGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLK 607
             Y  +K    +   +  PR  + G                + +V ++VN+DP++ D LK
Sbjct: 586 YRYKKLKGMSPEERKNTTPRTVMIGGKAFATYTNAKRIVKLVTDVGDVVNSDPDVNDYLK 645

Query: 608 VVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIKD 667
           VVF+ +Y VS+AE +IP + +S+ IS A  EASGTSNMK  LNG L + TLDGAN+EI++
Sbjct: 646 VVFVPNYNVSVAEMLIPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIRE 705

Query: 668 YVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIP-NCQAEGQE 726
            +GEDN F+FG T DEV     +     +      EE ++ + +   GT   N   E  E
Sbjct: 706 EIGEDNFFLFGATADEVPQLRKDRENGLFKPDPRFEEAKQFIRSGAFGTYDYNPLLESLE 765

Query: 727 IFDSLTKYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKR 786
             +S     D + V  DF SY++ Q  VD  Y +++ W +MS+++ +  G FSSD TI +
Sbjct: 766 -GNSGYGRGDYFLVGHDFPSYMDAQARVDEAYKDRKRWIKMSILSTSGSGKFSSDRTISQ 824

Query: 787 YAEDIWNIS 795
           YA++IWNI+
Sbjct: 825 YAKEIWNIA 833


>PHSH_WHEAT RecName: Full=Alpha-glucan phosphorylase, H isozyme;    
               EC=2.4.1.1;AltName: Full=Starch phosphorylase H;
          Length = 832

 Score =  492 bits (1266), Expect = e-141
 Identities = 283/794 (35%), Positives = 428/794 (53%), Gaps = 35/794 (4%)

Query: 29  PQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLET 88
           P++ +   +  VR    + W  T+  + +   KQ YY S+E+L GR L + + N+     
Sbjct: 42  PEQAFYATAESVRDHLLQRWNDTYLHFHKTDPKQTYYLSMEYLQGRALTNAVGNLAITGA 101

Query: 89  VRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFK 148
             DALK    +L+ IA  E+D            S F+DS+A+  LP  G G+RYRYGLFK
Sbjct: 102 YADALKKFGYELEAIAGQERDXXXXXXXXXXXXSCFLDSMATLNLPSWGYGLRYRYGLFK 161

Query: 149 QKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKA 208
           Q+     Q E+  +WLD  +PWEI R      +R  G V +   G   +  +   +++ A
Sbjct: 162 QRIAKEGQEEIAEDWLDKFSPWEIVRHDVVYPIRFFGHVEISPDG---KRKWAGGEVLNA 218

Query: 209 VPYDTAIVGYKNGTVNTMRLWDAEIPSSE-------EAKYRTIEQ-RREVEDLVSVLYPD 260
           + YD  I GYK     ++RLWDA   + +       + +Y +  Q     + + +VLYP 
Sbjct: 219 LAYDVPIPGYKTKNAISLRLWDATATAEDFNLFQFNDGQYESAAQLHSRAQQICAVLYPG 278

Query: 261 DSKESGRILRLKQEYFFVSAGIQSIVRHFK--KYNKSMNKIGEY---IGIHINDTHPAMS 315
           D+ E G++LRLKQ+YF  SA +Q I+  FK  K ++   K  E+   + + +NDTHP ++
Sbjct: 279 DATEEGKLLRLKQQYFLCSASLQDIIFRFKERKADRVSGKWSEFPSKVAVQMNDTHPTLA 338

Query: 316 VAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQE 375
           + ELMR+L+D E + WD+AW  T   ++YTNHT++ EALEKW   +M+++ PR ++II+E
Sbjct: 339 IPELMRLLMDVEGLGWDEAWAVTNKTVAYTNHTVLPEALEKWSQAVMKKLLPRHMEIIEE 398

Query: 376 IDRRFVEE--KQGKYARDMIERTRIIKDNQ----VRMANLSIIGSHSTNGVAKLHTELLK 429
           ID+RF E      K     IE  R++ +N     VRMANL ++  H+ NGVA+LH+ +LK
Sbjct: 399 IDKRFREMVISTRKDMEGKIESMRVLDNNPEKPVVRMANLCVVAGHTVNGVAELHSNILK 458

Query: 430 DDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGT-EWRQDPTKLQKLLK 488
            ++  D+  ++P +F NKTNGIT RRWL+  NPELS+++ K + T +W  +   L  L K
Sbjct: 459 QELFADYVSIWPNKFQNKTNGITPRRWLRFCNPELSEIVTKWLKTDQWTSNLDLLTGLRK 518

Query: 489 HQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHI 548
             +D K+  +               +   TG+ +  D++FD+QIKR+H YKRQL+ ++  
Sbjct: 519 FADDEKLHAEWXXXXXXXXXXXXXHVLDVTGVTIDPDSLFDIQIKRIHEYKRQLMNILGA 578

Query: 549 VKLYLDIKQGKVA--SDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKL 606
           V  Y  +K+   A      PR  + G                                 L
Sbjct: 579 VYRYKKLKEMSAADRQKVTPRTVMVGGKAFATYTNAKRIVKLXXXXXXXXXXXXXXXKYL 638

Query: 607 KVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEIK 666
           KVVF+ +Y VS+AE +IP + +S+ IS A  EASGTSNMK  LNG + + TLDGAN+EI+
Sbjct: 639 KVVFIPNYNVSVAEVLIPGSELSQHISTAGMEASGTSNMKFSLNGCVIIGTLDGANVEIR 698

Query: 667 DYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYNNHEEIRRVLNAFVDGTIPNCQAEGQE 726
           + VG+DN F+FG   D+V     +     +      EE ++ + +   GT      +   
Sbjct: 699 EEVGQDNFFLFGAKADQVAGLRKDRENGLFKPDPRFEEAKQFIRSGAFGTY-----DYTP 753

Query: 727 IFDSLT-----KYNDEYFVLRDFESYVNIQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSD 781
           + DSL         D + V  DF SY++ Q  VD  Y +K+ W +MS++N A  G FSSD
Sbjct: 754 LLDSLEGNTGFGRGDYFLVGYDFPSYIDAQARVDEAYKDKKKWVKMSILNTAGSGKFSSD 813

Query: 782 DTIKRYAEDIWNIS 795
            TI +YA++IW IS
Sbjct: 814 RTIDQYAKEIWGIS 827


>PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme,
            chloroplastic/amyloplastic;         EC=2.4.1.1;AltName:
            Full=Starch phosphorylase L;
          Length = 1003

 Score =  328 bits (840), Expect = 1e-91
 Identities = 175/404 (43%), Positives = 248/404 (61%), Gaps = 12/404 (2%)

Query: 405  RMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPEL 464
            RMANL ++G H+ NGVA++H+E++KDDV + FY ++PE+F NKTNG+T RRW++  NP+L
Sbjct: 604  RMANLCVVGGHAVNGVAEIHSEIVKDDVFNAFYKLWPEKFQNKTNGVTPRRWIRFCNPDL 663

Query: 465  SKVLDKAIGTE-WRQDPTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVS 523
            SK++ + IGTE W  +  KL +L K  ++  +  Q   AK  NK ++A F+ + TG  VS
Sbjct: 664  SKIITQWIGTEDWILNTEKLAELRKFADNEDLQTQWREAKRNNKVKVAAFLRERTGYSVS 723

Query: 524  TDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVAS---DFQPRVFIFGXXXXXXXX 580
             D++FD+Q+KR+H YKRQLL +  IV  Y  +K+   A    +F PRV IFG        
Sbjct: 724  PDSMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMNAAERKENFVPRVCIFGGKAFATYV 783

Query: 581  XXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLASKEAS 640
                    I +V   VN+DPEIGD LKV+F+ DY VS+AE +IPA+ +S+ IS A  EAS
Sbjct: 784  QAKRIVKFITDVGATVNHDPEIGDLLKVIFVPDYNVSVAEMLIPASELSQHISTAGMEAS 843

Query: 641  GTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHSYDYYN 700
            GTSNMK  +NG L + TLDGAN+EI++ VG DN F+FG    E+           +    
Sbjct: 844  GTSNMKFAMNGCLQIGTLDGANVEIREEVGADNFFLFGAKAREIVGLRKERARGKFVPDP 903

Query: 701  NHEEIRRVLNAFVDGTIPNCQ----AEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVDR 756
              EE+++ + + V G+    +     EG E F       D + V +DF SY+  QE VD+
Sbjct: 904  RFEEVKKFVRSGVFGSYNYDELIGSLEGNEGFGRA----DYFLVGQDFPSYLECQEEVDK 959

Query: 757  TYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLKDE 800
             Y +++ W +MS++N A    FSSD TI  YA +IWNI P+K E
Sbjct: 960  AYRDQKKWTRMSILNTAGSSKFSSDRTIHEYAREIWNIEPVKLE 1003



 Score =  231 bits (589), Expect = 2e-62
 Identities = 137/371 (36%), Positives = 192/371 (51%), Gaps = 15/371 (4%)

Query: 29  PQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLET 88
           PQ    T  S VR +    W  T+  Y +   KQ YY S+EFL GR L++ + N+     
Sbjct: 119 PQAFIATAQS-VRDALIINWNATYDYYEKLNVKQAYYLSMEFLQGRALLNAIGNLELTGP 177

Query: 89  VRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFK 148
             +AL  L   L+++A  E D            S F+DSLA+   P  G G+RY+YGLFK
Sbjct: 178 YAEALSQLSYKLEDVAHQEPDXXXXXXXXXXXXSCFLDSLATLNYPAWGYGLRYKYGLFK 237

Query: 149 QKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKA 208
           Q+     Q E+  +WL+ GNPWEI R   S  VR  GKV     G       ED   IKA
Sbjct: 238 QRITKDGQEEVAEDWLEMGNPWEIVRNDVSYPVRFYGKVVSGSDGKKHWVGGED---IKA 294

Query: 209 VPYDTAIVGYKNGTVNTMRLWDAEIPSSE--------EAKYRTIEQRREVEDLVSVLYPD 260
           V +D  I GYK  +   +RLW  +  S E               E     E +  +LYP 
Sbjct: 295 VAHDVPIPGYKTRSTINLRLWSTKAASEEFDLNAFNSGRHTEASEALANAEKICYILYPG 354

Query: 261 DSKESGRILRLKQEYFFVSAGIQSIVRHF-KKYNKSMN--KIGEYIGIHINDTHPAMSVA 317
           D    G+ LRLKQ+Y   SA +Q I+  F ++   S+N     E + + +NDTHP + + 
Sbjct: 355 DESIEGKTLRLKQQYTLCSASLQDIIARFERRSGASVNWEDFPEKVAVQMNDTHPTLCIP 414

Query: 318 ELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEID 377
           ELMRIL+D + +SW DAW  T   ++YTNHT++ EALEKW + +M+++ PR ++II+ ID
Sbjct: 415 ELMRILIDIKGLSWKDAWNITQRTVAYTNHTVLPEALEKWSMDLMEKLLPRHVEIIEMID 474

Query: 378 RRFVEEKQGKY 388
              +     +Y
Sbjct: 475 EELIRTIIAEY 485


>PHSL1_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-1
           isozyme, chloroplastic/amyloplastic;       
           EC=2.4.1.1;AltName: Full=Starch phosphorylase L-1;
          Length = 966

 Score =  321 bits (822), Expect = 2e-89
 Identities = 171/409 (41%), Positives = 247/409 (60%), Gaps = 12/409 (2%)

Query: 398 IIKDNQVRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWL 457
           +I   +VRMANL ++G H+ NGVA++H+E++K++V +DFY ++PE+F NKTNG+T RRW+
Sbjct: 560 VIPPKKVRMANLCVVGGHAVNGVAEIHSEIVKEEVFNDFYELWPEKFQNKTNGVTPRRWI 619

Query: 458 QIANPELSKVLDKAIGTE-WRQDPTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEK 516
           +  NP LS ++ K  GTE W     KL +L K  ++  + N+   AK  NK ++  F+++
Sbjct: 620 RFCNPPLSAIITKWTGTEDWVLKTEKLAELQKFADNEDLQNEWREAKRSNKIKVVSFLKE 679

Query: 517 ETGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVA---SDFQPRVFIFGX 573
           +TG  V  DA+FD+Q+KR+H YKRQLL +  IV  Y  +K+   A   ++F PRV IFG 
Sbjct: 680 KTGYSVVPDAMFDIQVKRIHEYKRQLLNIFGIVYRYKKMKEMTAAERKTNFVPRVCIFGG 739

Query: 574 XXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISEQIS 633
                          I +V   +N+DPEIGD LKVVF+ DY VS+AE +IPA+++SE IS
Sbjct: 740 KAFATYVQAKRIVKFITDVGATINHDPEIGDLLKVVFVPDYNVSVAELLIPASDLSEHIS 799

Query: 634 LASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNY 693
            A  EASGTSNMK  +NG + + TLDGAN+EI++ VGE+N F+FG    E+         
Sbjct: 800 TAGMEASGTSNMKFAMNGCIQIGTLDGANVEIREEVGEENFFLFGAQAHEIAGLRKERAD 859

Query: 694 HSYDYYNNHEEIRRVLNAFVDGTIPN----CQAEGQEIFDSLTKYNDEYFVLRDFESYVN 749
             +      EE++  + +   G+          EG E F       D + V +DF SY+ 
Sbjct: 860 GKFVPDERFEEVKEFVRSGAFGSYNYDDLIGSLEGNEGFGRA----DYFLVGKDFPSYIE 915

Query: 750 IQEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLK 798
            QE VD  Y +++ W  MS++N A    FSSD TI  YA+DIWNI  ++
Sbjct: 916 CQEKVDEAYRDQKRWTTMSILNTAGSYKFSSDRTIHEYAKDIWNIEAVE 964



 Score =  249 bits (635), Expect = 8e-68
 Identities = 139/371 (37%), Positives = 204/371 (54%), Gaps = 15/371 (4%)

Query: 29  PQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLET 88
           P+  + T  S VR S    W  T+  Y +   KQ YY S+EFL GR L++ + N+     
Sbjct: 101 PKAFFATAQS-VRDSLLINWNATYDIYEKLNMKQAYYLSMEFLQGRALLNAIGNLELTGA 159

Query: 89  VRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFK 148
             +ALK+L  +L+ +A  E D            S F+DSLA+   P  G G+RY+YGLFK
Sbjct: 160 FAEALKNLGHNLENVASQEPDXXXXXXXXXXXXSCFLDSLATLNYPAWGYGLRYKYGLFK 219

Query: 149 QKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKA 208
           Q+     Q E+  +WL+ G+PWE+ R   S  ++  GKV     G       ED   IKA
Sbjct: 220 QRITKDGQEEVAEDWLEIGSPWEVVRNDVSYPIKFYGKVSTGSDGKRYWIGGED---IKA 276

Query: 209 VPYDTAIVGYKNGTVNTMRLWDAEIPSSE--------EAKYRTIEQRREVEDLVSVLYPD 260
           V YD  I GYK  T  ++RLW  ++PS++            +  E +   E +  +LYP 
Sbjct: 277 VAYDVPIPGYKTRTTISLRLWSTQVPSADFDLSAFNAGEHTKACEAQANAEKICYILYPG 336

Query: 261 DSKESGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEY---IGIHINDTHPAMSVA 317
           D  E G+ILRLKQ+Y   SA +Q I+  F++ +    K  E+   + + +NDTHP + + 
Sbjct: 337 DESEEGKILRLKQQYTLCSASLQDIISRFERRSGDRIKWEEFPEKVAVQMNDTHPTLCIP 396

Query: 318 ELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEID 377
           ELMRIL+D + ++W++AW  T   ++YTNHT++ EALEKW   +MQ++ PR ++II+ ID
Sbjct: 397 ELMRILIDLKGLNWNEAWNITQRTVAYTNHTVLPEALEKWSYELMQKLLPRHVEIIEAID 456

Query: 378 RRFVEEKQGKY 388
              V E   KY
Sbjct: 457 EELVHEIVLKY 467


>PHSL_IPOBA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme,
           chloroplastic/amyloplastic;         EC=2.4.1.1;AltName:
           Full=Starch phosphorylase L;
          Length = 955

 Score =  318 bits (815), Expect = 1e-88
 Identities = 170/407 (41%), Positives = 244/407 (59%), Gaps = 12/407 (2%)

Query: 399 IKDNQVRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQ 458
           I    VRMANL ++G H+ NGVA++H++++K+DV +DFY ++PE+F NKTNG+T RRW++
Sbjct: 550 IPPKMVRMANLCVVGGHAVNGVAEIHSDIVKEDVFNDFYQLWPEKFQNKTNGVTPRRWIR 609

Query: 459 IANPELSKVLDKAIGTE-WRQDPTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKE 517
             NP LS ++ K IGTE W  +  KL +L K  ++  +  +   AK  NK ++A F+++ 
Sbjct: 610 FCNPALSNIITKWIGTEDWVLNTEKLAELRKFADNEDLQIEWRAAKRSNKVKVASFLKER 669

Query: 518 TGIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVA---SDFQPRVFIFGXX 574
           TG  VS +A+FD+Q+KR+H YKRQLL ++ IV  Y  +K+       + F PRV IFG  
Sbjct: 670 TGYSVSPNAMFDIQVKRIHEYKRQLLNILGIVYRYKQMKEMSAREREAKFVPRVCIFGGK 729

Query: 575 XXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISL 634
                         I +V   +N+DPEIGD LKV+F+ DY VS AE +IPA+ +S+ IS 
Sbjct: 730 AFATYVQAKRIAKFITDVGATINHDPEIGDLLKVIFVPDYNVSAAELLIPASGLSQHIST 789

Query: 635 ASKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYH 694
           A  EASG SNMK  +NG + + TLDGAN+EI+  VGE+N F+FG    E+          
Sbjct: 790 AGMEASGQSNMKFAMNGCILIGTLDGANVEIRQEVGEENFFLFGAEAHEIAGLRKERAEG 849

Query: 695 SYDYYNNHEEIRRVLNAFVDGTIPNCQ----AEGQEIFDSLTKYNDEYFVLRDFESYVNI 750
            +      EE++  +   V G+    +     EG E F       D + V +DF SY+  
Sbjct: 850 KFVPDERFEEVKEFIKRGVFGSNTYDELLGSLEGNEGFGR----GDYFLVGKDFPSYIEC 905

Query: 751 QEMVDRTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPL 797
           QE VD  Y +++ W +MS++N A    FSSD TI  YA+DIWNI P+
Sbjct: 906 QEKVDEAYRDQKIWTRMSILNTAGSYKFSSDRTIHEYAKDIWNIQPV 952



 Score =  242 bits (617), Expect = 9e-66
 Identities = 137/377 (36%), Positives = 202/377 (53%), Gaps = 17/377 (4%)

Query: 33  YLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLETVRDA 92
           Y   +  VR +    W  T+  Y +   KQ YY S+EFL GR L++ + N+       +A
Sbjct: 97  YFATAQSVRDALIVNWNATYDYYEKLNMKQAYYLSMEFLQGRALLNAIGNLELTGEYAEA 156

Query: 93  LKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFI 152
           L  L  +L+ +A  E D            S F+DSLA+   P  G G+RY+YGLFKQ+  
Sbjct: 157 LNKLGHNLENVASKEPDXXXXXXXXXXXXSCFLDSLATLNYPAWGYGLRYKYGLFKQRIT 216

Query: 153 DGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYD 212
              Q E+  +WL+ GNPWEI R   S  V+  GKV     G       ED   I AV YD
Sbjct: 217 KDGQEEVAEDWLELGNPWEIIRMDVSYPVKFFGKVITGSDGKKHWIGGED---ILAVAYD 273

Query: 213 TAIVGYKNGTVNTMRLWDAEIPSSEEAKY--------RTIEQRREVEDLVSVLYPDDSKE 264
             I GYK  T  ++RLW  ++PS +   Y        +  E +   E +  +LYP D   
Sbjct: 274 VPIPGYKTRTTISLRLWSTKVPSEDFDLYSFNAGEHTKACEAQANAEKICYILYPGDESI 333

Query: 265 SGRILRLKQEYFFVSAGIQSIVRHFKKYNKSMNKIGEY---IGIHINDTHPAMSVAELMR 321
            G+ILRLKQ+Y   SA +Q I+  F++ +    K  E+   + + +NDTHP + + EL+R
Sbjct: 334 EGKILRLKQQYTLCSASLQDIIARFERRSGEYVKWEEFPEKVAVQMNDTHPTLCIPELIR 393

Query: 322 ILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEIDRRFV 381
           IL+D + +SW +AW  T   ++YTNHT++ EALEKW   +M+++ PR ++II+ ID + +
Sbjct: 394 ILIDLKGLSWKEAWNITQRTVAYTNHTVLPEALEKWSYELMEKLLPRHIEIIEMIDEQLI 453

Query: 382 EEKQGKYAR---DMIER 395
            E   +Y     DM+E+
Sbjct: 454 NEIVSEYGTSDLDMLEK 470


>PHSL2_SOLTU RecName: Full=Alpha-1,4 glucan phosphorylase L-2
           isozyme, chloroplastic/amyloplastic;       
           EC=2.4.1.1;AltName: Full=Starch phosphorylase L-2;
          Length = 974

 Score =  315 bits (806), Expect = 1e-87
 Identities = 168/403 (41%), Positives = 241/403 (59%), Gaps = 4/403 (0%)

Query: 400 KDNQVRMANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQI 459
           K   V MANL ++  H+ NGVA++H+E++KD+V ++FY ++PE+F NKTNG+T RRWL  
Sbjct: 570 KPQVVHMANLCVVSGHAVNGVAEIHSEIVKDEVFNEFYKLWPEKFQNKTNGVTPRRWLSF 629

Query: 460 ANPELSKVLDKAIGTE-WRQDPTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKET 518
            NPELS+++ K  G++ W  +  KL +L K  ++ ++ ++   AK  NK ++   I+++T
Sbjct: 630 CNPELSEIITKWTGSDDWLVNTEKLAELRKFADNEELQSEWRKAKGNNKMKIVSLIKEKT 689

Query: 519 GIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQ---GKVASDFQPRVFIFGXXX 575
           G  VS DA+FDVQIKR+H YKRQLL +  IV  Y  +K+    +    F PRV IFG   
Sbjct: 690 GYVVSPDAMFDVQIKRIHEYKRQLLNIFGIVYRYKKMKEMSPEERKEKFVPRVCIFGGKA 749

Query: 576 XXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAANISEQISLA 635
                        I +V   VN+DPEIGD LKVVF+ DY VS+AE +IP + +S+ IS A
Sbjct: 750 FATYVQAKRIVKFITDVGETVNHDPEIGDLLKVVFVPDYNVSVAEVLIPGSELSQHISTA 809

Query: 636 SKEASGTSNMKLMLNGALTVATLDGANIEIKDYVGEDNIFIFGLTKDEVYDYYNNGNYHS 695
             EASGTSNMK  +NG L + TLDGAN+EI++ VGEDN F+FG    E+           
Sbjct: 810 GMEASGTSNMKFSMNGCLLIGTLDGANVEIREEVGEDNFFLFGAQAHEIAGLRKERAEGK 869

Query: 696 YDYYNNHEEIRRVLNAFVDGTIPNCQAEGQEIFDSLTKYNDEYFVLRDFESYVNIQEMVD 755
           +      EE++  +   V GT    +  G    +      D + V +DF  Y+  Q+ VD
Sbjct: 870 FVPDPRFEEVKAFIRTGVFGTYNYEELMGSLEGNEGYGRADYFLVGKDFPDYIECQDKVD 929

Query: 756 RTYSNKRHWNQMSLVNIAYGGMFSSDDTIKRYAEDIWNISPLK 798
             Y +++ W +MS++N A    FSSD TI +YA DIW I P++
Sbjct: 930 EAYRDQKKWTKMSILNTAGSFKFSSDRTIHQYARDIWRIEPVE 972



 Score =  222 bits (565), Expect = 1e-59
 Identities = 134/389 (34%), Positives = 199/389 (51%), Gaps = 16/389 (4%)

Query: 29  PQELYLTLSSIVRSSYSRYWRKTWKKYMEDGKKQIYYFSIEFLPGRLLMSNLLNMGWLET 88
           P+  Y T  S VR +    W  T++ Y +   KQ YY S+EFL GR L++ + N+G    
Sbjct: 104 PKAYYATAES-VRDTLIINWNATYEFYEKMNVKQAYYLSMEFLQGRALLNAIGNLGLTGP 162

Query: 89  VRDALKDLDIDLDEIAEVEKDMALGNGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFK 148
             DAL  L   L+++A  E D            S F+DS+A+   P  G G+RY+YGLFK
Sbjct: 163 YADALTKLGYSLEDVARQEPDXXXXXXXXXXXXSCFLDSMATLNYPAWGYGLRYQYGLFK 222

Query: 149 QKFIDGYQIELPNEWLDSGNPWEIRRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKA 208
           Q      Q E+   WL+ GNPWEI R   S  V+  GKV     G      +   + I A
Sbjct: 223 QLITKDGQEEVAENWLEMGNPWEIVRNDISYPVKFYGKVI---EGADGRKEWAGGEDITA 279

Query: 209 VPYDTAIVGYKNGTVNTMRLWDAEIPSSEEAKY--------RTIEQRREVEDLVSVLYPD 260
           V YD  I GYK  T   +RLW  ++ +     Y                   +  VLYP 
Sbjct: 280 VAYDVPIPGYKTKTTINLRLWTTKLAAEAFDLYAFNNGDHXXXXXXXXXXXXICYVLYPG 339

Query: 261 DSKESGRILRLKQEYFFVSAGIQSIVRHFKKYN---KSMNKIGEYIGIHINDTHPAMSVA 317
           D    G+ LRLKQ+Y   SA +Q I+  F+K +    + ++  E + + +NDTHP + + 
Sbjct: 340 DESLEGKTLRLKQQYTLCSASLQDIIARFEKRSGNAVNWDQFPEKVAVQMNDTHPTLCIP 399

Query: 318 ELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQVQPRILQIIQEID 377
           EL+RIL+D + +SW  AW+ T   ++YTNHT++ EALEKW   ++ ++ PR ++II  ID
Sbjct: 400 ELLRILMDVKGLSWKQAWEITQRTVAYTNHTVLPEALEKWSFTLLGELLPRHVEIIAMID 459

Query: 378 RRFVEEKQGKYARDMIERTRIIKDNQVRM 406
              +     +Y  + ++  +  K NQ+R+
Sbjct: 460 EELLHTILAEYGTEDLDLLQ-EKLNQMRI 487


>PHSG_AQUAE RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 692

 Score = 78.2 bits (191), Expect = 2e-16
 Identities = 135/578 (23%), Positives = 234/578 (40%), Gaps = 111/578 (19%)

Query: 115 GGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKF-IDGYQIELPNEWLDSGNPWEIR 173
           GGLG LA   +   +  G P  G G  Y  G  KQ+  +DG+Q     E LD+ N  E+ 
Sbjct: 110 GGLGFLAGDILKESSDLGFPLIGVGFMYPQGYVKQRIRVDGWQ-----EDLDAQNQKELM 164

Query: 174 RESKSVTVR---LGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMRLWD 230
              K +      L   VY+ D   Y      +    K    DT      N   NT   W+
Sbjct: 165 PVKKVLDKEGKWLKCYVYVRDEKVYFGVWEVNVGKTKLYLLDT------NVEENTP--WN 216

Query: 231 AEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRHFK 290
            EI S                     LY  D       LRL+Q+   +  G  +++    
Sbjct: 217 REISSR--------------------LYVPDKD-----LRLRQQ---IVLGFGTVIL--- 245

Query: 291 KYNKSMNKIG-EYIGIHINDTHPA-MSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHT 348
                + K+G +  G HIN+ +P+ + +AE+ ++L  ++ ++WD A ++   +  +T HT
Sbjct: 246 -----LEKLGIDAGGFHINEDYPSFVFLAEIFKLL--KKGLTWDKAIEEVRKISLFTTHT 298

Query: 349 IMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMAN 408
            +  A+  +P H++++      Q +      FV++  G   + ++E     +D      +
Sbjct: 299 PLRVAVNTYPFHMIEE------QFL------FVKDVYGIDVKKVLELGTNPEDPSEGFNS 346

Query: 409 --LSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPER-FNNKTNGITDRRWLQIANPELS 465
             +S+  +   N V+K H E+     +  F     E   +  TNG+    W+     +L 
Sbjct: 347 TIMSLRLAKYVNAVSKRHQEV--SSKMWSFLFKEKENPIDYVTNGVHFPTWIC---SDLR 401

Query: 466 KVLDKAIGTEWRQ--DPTKLQKLLKHQNDNKVLNQIANAKLKNKERLAKFIEKET----- 518
           ++ ++ +G  + +  D   L +L++   D ++        ++NKERL + I+        
Sbjct: 402 RLYEEYLGENFVELHDHKSLWELIRDIPDEELWEY----HIRNKERLIEHIKDRARERWV 457

Query: 519 ------------GIKVSTDAIFDVQIKRLHAYKRQLLKLMHIVKLYLDIKQGKVASDFQP 566
                       G+ + +D +     +R+  YKR  L    + +L       K+ +D + 
Sbjct: 458 KEKADPSILMAEGLFLDSDVLTVGFARRMTGYKRPDLIFTDVERLK------KIVNDSER 511

Query: 567 RVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDYRVSLAEKIIPAA 626
            V I                  I  + N    DPE G +  + F+EDY   LA  ++   
Sbjct: 512 PVQII--FAGKAHPADIEGKKIIQRIFNFAK-DPEFGGR--IAFVEDYDELLAHYMVRGV 566

Query: 627 NISEQISLASKEASGTSNMKLMLNGALTVATLDGANIE 664
           ++     L   EA GTS MK  +NG L ++ LDG  IE
Sbjct: 567 DVWLNNPLPPLEACGTSGMKASMNGVLHLSILDGWWIE 604


>PHSG_MYCTU RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 863

 Score = 66.6 bits (161), Expect = 7e-13
 Identities = 129/586 (22%), Positives = 234/586 (39%), Gaps = 122/586 (20%)

Query: 114 NGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFI-DGYQIELPNEWLDSGNPWEI 172
           +GGLG LA   + S +  G+P    G+ YR G F+Q    DG+Q E        G P  +
Sbjct: 130 SGGLGILAGDHLKSASDLGVPLIAVGLYYRSGYFRQSLTADGWQHETYPSLDPQGLPLRL 189

Query: 173 RRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMR----L 228
             ++                         D  L++    D A++  +       R    L
Sbjct: 190 LTDANG-----------------------DPVLVEVALGDNAVLRARIWVAQVGRVPLLL 226

Query: 229 WDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRH 288
            D++IP +E           ++ ++   LY  D +      R+KQE   + AGI   VR 
Sbjct: 227 LDSDIPENEH----------DLRNVTDRLYGGDQEH-----RIKQE---ILAGIGG-VRA 267

Query: 289 FKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHT 348
            + Y  ++ K+      H+N+ H      E +R LV +  + +D A     +   +T HT
Sbjct: 268 IRAYT-AVEKLTPPEVFHMNEGHAGFLGIERIRELVTDAGLDFDTALTVVRSSTVFTTHT 326

Query: 349 IMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDM---IERTRII----KD 401
            +   ++++P+ ++Q               R+V +++G     +   +   RI+    +D
Sbjct: 327 PVPAGIDRFPLEMVQ---------------RYVNDQRGDGRSRLLPGLPADRIVALGAED 371

Query: 402 NQVR--MANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPER--FNNKTNGITDRRWL 457
           +  +  MA++ +  +   NGV+ LH  + +      +    P+     + TNG+    W 
Sbjct: 372 DPAKFNMAHMGLRLAQRANGVSLLHGRVSRAMFNELWAGFDPDEVPIGSVTNGVHAPTW- 430

Query: 458 QIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQNDNK----VLNQIANAKLKNKERLAKF 513
             A P+  ++  +  G++  ++P   Q+L  HQ D      + +Q+ +  +++     + 
Sbjct: 431 --AAPQWLQLGRELAGSDSLREPVVWQRL--HQVDPAHLWWIRSQLRSMLVEDVRARLRQ 486

Query: 514 IEKETGIKVSTDA-------IFDVQI------KRLHAYKRQLLKLM---HIVKLYLDIK- 556
              E G   +TDA        FD  +      +R+  YKR  L L     + +L LD + 
Sbjct: 487 SWLERG---ATDAELGWIATAFDPNVLTVGFARRVPTYKRLTLMLRDPDRLEQLLLDEQR 543

Query: 557 --QGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDY 614
             Q  VA    P                      I +V    +  P++  + ++ FL +Y
Sbjct: 544 PIQLIVAGKSHP--------------ADDGGKALIQQVVRFADR-PQV--RHRIAFLPNY 586

Query: 615 RVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +S+A  +    ++     L   EA GTS MK  LNG L ++  DG
Sbjct: 587 DMSMARLLYWGCDVWLNNPLRPLEACGTSGMKSALNGGLNLSIRDG 632


>PHSG_MYCBO RecName: Full=Glycogen phosphorylase;       
           EC=2.4.1.1;
          Length = 863

 Score = 65.5 bits (158), Expect = 2e-12
 Identities = 129/586 (22%), Positives = 233/586 (39%), Gaps = 122/586 (20%)

Query: 114 NGGLGRLASAFMDSLASDGLPGNGNGIRYRYGLFKQKFI-DGYQIELPNEWLDSGNPWEI 172
           +GGLG LA   + S +  G+P    G+ YR G F+Q    DG+Q E        G P  +
Sbjct: 130 SGGLGILAGDHLKSASDLGVPLIAVGLYYRSGYFRQSLTADGWQHETYPSLDPQGLPLRL 189

Query: 173 RRESKSVTVRLGGKVYLVDRGNYLEPVYEDAQLIKAVPYDTAIVGYKNGTVNTMR----L 228
             ++                         D  L++    D A++  +       R    L
Sbjct: 190 LTDANG-----------------------DPVLVEVALGDNAVLRARIWVAQVGRVPLLL 226

Query: 229 WDAEIPSSEEAKYRTIEQRREVEDLVSVLYPDDSKESGRILRLKQEYFFVSAGIQSIVRH 288
            D++IP +E           ++ ++   LY  D +      R+KQE   + AGI   VR 
Sbjct: 227 LDSDIPENEH----------DLRNVTDRLYGGDQEH-----RIKQE---ILAGIGG-VRA 267

Query: 289 FKKYNKSMNKIGEYIGIHINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHT 348
            + Y  ++ K+      H+N+ H      E +R LV +  + +D A     +   +T HT
Sbjct: 268 IRAYT-AVEKLTPPEVFHMNEGHAGFLGIERIRELVTDAGLDFDTALTVVRSSTVFTTHT 326

Query: 349 IMAEALEKWPVHIMQQVQPRILQIIQEIDRRFVEEKQGKYARDM---IERTRII----KD 401
            +   ++++P+ ++Q               R+V +++G     +   +   RI+    +D
Sbjct: 327 PVPAGIDRFPLEMVQ---------------RYVNDQRGDGRSRLLPGLPADRIVALGAED 371

Query: 402 NQVR--MANLSIIGSHSTNGVAKLHTELLKDDVLHDFYVMYPER--FNNKTNGITDRRWL 457
           +  +  MA++ +  +   NGV+ LH  + +      +    P+     + TNG+    W 
Sbjct: 372 DPAKFNMAHMGLRLAQRANGVSLLHGRVSRAMFNELWAGFDPDEVPIGSVTNGVHAPTW- 430

Query: 458 QIANPELSKVLDKAIGTEWRQDPTKLQKLLKHQNDNK----VLNQIANAKLKNKERLAKF 513
             A P+  ++  +  G++  ++P   Q+L  HQ D      + +Q+ +  +++     + 
Sbjct: 431 --AAPQWLQLGRELAGSDSLREPVVWQRL--HQVDPAHLWWIRSQLRSMLVEDVRARLRQ 486

Query: 514 IEKETGIKVSTDA-------IFDVQI------KRLHAYKRQLLKLM---HIVKLYLDIK- 556
              E G   +TDA        FD  +      +R+  YKR  L L     + +L LD + 
Sbjct: 487 SWLERG---ATDAELGWIATAFDPNVLTVGFARRVPTYKRLTLMLRDPGRLEQLLLDEQR 543

Query: 557 --QGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDKLKVVFLEDY 614
             Q  VA    P                      I +V    +  P+   + ++ FL +Y
Sbjct: 544 PIQLIVAGKSHP--------------ADDGGKALIQQVVRFADR-PQF--RHRIAFLPNY 586

Query: 615 RVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDG 660
            +S+A  +    ++     L   EA GTS MK  LNG L ++  DG
Sbjct: 587 DMSMARLLYWGCDVWLNNPLRPLEACGTSGMKSALNGGLNLSIRDG 632


>Y1631_METJA RecName: Full=Uncharacterized protein MJ1631;
          Length = 519

 Score = 40.0 bits (92), Expect = 7e-05
 Identities = 71/381 (18%), Positives = 132/381 (34%), Gaps = 76/381 (19%)

Query: 306 HINDTHPAMSVAELMRILVDEEHMSWDDAWKQTVAVMSYTNHTIMAEALEKWPVHIMQQV 365
           H+N+ HP   V +L+      E    +   + TV    +T HT + E  E   +++++  
Sbjct: 163 HMNEPHPLPLVFKLI------EEYGLEYTREHTV----FTTHTPLPEGNETQDINLLKS- 211

Query: 366 QPRILQIIQEIDRRFVEEKQGKYARDMIERTRIIKDNQVRMANLSIIGSHSTNGVAKLHT 425
               +     +D +  E+  G      +   R+ K                 N V+K H 
Sbjct: 212 ----MGFFGNVDVKLAEKLGGNPFNYTVCALRVCK---------------RANAVSKKHK 252

Query: 426 ELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKAIGTEWRQDPTKLQK 485
           E                        + DR W  + +      +  A    + QDP   + 
Sbjct: 253 E------------------------VCDRMWSWVKDRCEIVAITNAQDKYYWQDPVIREA 288

Query: 486 LLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVSTDAIFDVQIKRLHAYKRQLLKL 545
             K+  D      +   K++ KE L + +  +TG     D +  V  +R  AYKR  +  
Sbjct: 289 AKKYDID-----MLRERKMELKEILFEEVADQTGKIFKKDRLTVVWARRFTAYKRPHIXX 343

Query: 546 MHIVKLYLDIKQGKVASDFQPRVFIFGXXXXXXXXXXXXXXXCINEVANMVNNDPEIGDK 605
                        ++      +V   G                +++  +M          
Sbjct: 344 XXXXXXXXXXXXXRI------QVIWAGKPHPNDHNMIATFNWIVSKTRDMKG-------- 389

Query: 606 LKVVFLEDYRVSLAEKIIPAANISEQISLASKEASGTSNMKLMLNGALTVATLDGANIEI 665
                L  Y + L++ +   ++I       + EASGTS M   +N ++ ++TLDG ++E 
Sbjct: 390 --ATILTGYELKLSKMLKQGSDIWLNTPKLNHEASGTSGMTASMNASIHMSTLDGWHVEW 447

Query: 666 KDYVGEDNIFI-FGLTKDEVY 685
                +D+  I  G+  D+ Y
Sbjct: 448 AKMYPDDSFTIGDGVRDDDAY 468


>Y078_NANEQ RecName: Full=UPF0027 protein NEQ078;
          Length = 477

 Score = 38.5 bits (88), Expect = 2e-04
 Identities = 42/180 (23%), Positives = 75/180 (41%), Gaps = 23/180 (12%)

Query: 412 IGSHSTNGVAKLHTELLKDDVLHDFYVMYPERFNNKTNGITDRRWLQIANPELSKVLDKA 471
           +G     GV  L T L  D++     ++  E F N   G+ +   L+++  EL+KVLD  
Sbjct: 91  VGFDINCGVRLLRTNLTIDEIKDRLNLLVNEIFRNVPAGVGEGGKLKLSIDELNKVLDYG 150

Query: 472 I------GTEWRQDPTKLQK--LLKHQNDNKVLNQIANAKLKNKERLAKFIEKETGIKVS 523
           +      G  W +D  +++    L   + + V N    AK + K++L         +++ 
Sbjct: 151 VNWAIDNGFGWEEDRNRIESHGYLDFADSDAVSN---TAKQRGKDQLGTIGSGNHFLEIQ 207

Query: 524 -TDAIFDVQIKRLHAY--KRQLLKLMH---------IVKLYLDIKQGKVASDFQPRVFIF 571
             D I+D +I +      K Q+  L+H         +   YL + + K   D   R  I+
Sbjct: 208 VVDQIYDEEIAKAFGIYEKNQVTVLIHTGSRGLGHQVASDYLRLFEKKYKYDVPDRELIY 267


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.330    0.146    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,945,678,051
Number of extensions: 412028977
Number of successful extensions: 1128099
Number of sequences better than 1.0e-03: 20564
Number of HSP's gapped: 1101815
Number of HSP's successfully gapped: 22616
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)