# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_16623.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABD99073.1  [L=67]
Description: lsal0 ABD99073.1 GIB00337CH01 "Hypothetical protein, phage associated"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
        2.1   10.1   0.1        2.3    9.9   0.0    1.1  1  PF11348  Protein of unknown function (DUF3150)
        4.7   10.1   0.1        5.1   10.0   0.0    1.1  1  PF01519  Protein of unknown function DUF16
         35    7.0   0.0         48    6.5   0.0    1.3  1  PF11961  Domain of unknown function (DUF3475)
         39    7.0   0.1         45    6.8   0.1    1.2  1  PF10249  NADH-ubiquinone oxidoreductase subunit 10
         43    6.2   0.4         46    6.1   0.3    1.1  1  PF03114  BAR domain
         62    6.2   0.1         81    5.8   0.0    1.3  1  PF08460  Bacterial SH3 domain
         91    4.5   0.0         98    4.4   0.0    1.1  1  PF02153  Prephenate dehydrogenase
    1.1e+02    5.3   0.0    1.7e+02    4.7   0.0    1.3  1  PF11585  Insect antimicrobial peptide, stomoxyn
    1.2e+02    4.9   0.0    1.4e+02    4.7   0.0    1.1  1  PF10088  Uncharacterized protein conserved in bacteria (DUF2
    1.4e+02    4.8   0.2    2.1e+02    4.2   0.1    1.4  1  PF06203  CCT motif
    1.5e+02    4.9   0.1      2e+02    4.5   0.0    1.1  1  PF09966  Uncharacterized protein conserved in bacteria (DUF2
    1.8e+02    4.7   0.0    2.3e+02    4.4   0.0    1.1  1  PF03903  Phage T4 tail fibre
    1.9e+02    5.2   0.5    5.6e+02    3.8   0.1    1.9  1  PF02412  Thrombospondin type 3 repeat
    2.2e+02    3.9   0.1    4.8e+02    2.8   0.0    1.5  1  PF12023  Domain of unknown function (DUF3511)
    2.4e+02    3.4   0.0    2.4e+02    3.4   0.0    1.0  1  PF00728  Glycosyl hydrolase family 20, catalytic domain
    5.9e+02    1.6   0.1    6.4e+02    1.5   0.1    1.0  1  PF05600  Protein of unknown function (DUF773)
    9.7e+02    2.8   1.7    3.2e+03    1.2   1.2    1.8  1  PF05901  Excalibur calcium-binding domain
    2.4e+03    0.9   3.2    1.8e+03    1.3   0.7    1.9  1  PF09453  HIRA B motif


Domain and alignment annotation for each model:
>> PF11348  Protein of unknown function (DUF3150)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.0   0.00042       2.3      95     115 ..       6      26 ..       2      40 .. 0.88

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.00042
     PF11348  95 teFeeakqdflanydkaiedw 115
                 +eF++ak +f+++ydk +++ 
  ABD99073.1   6 AEFKDAKGQFVKRYDKLVDKD 26 
                 69****************975 PP

>> PF01519  Protein of unknown function DUF16
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.0   0.0   0.00093       5.1      25      54 ..       2      29 ..       1      45 [. 0.82

  Alignments for each domain:
  == domain 1    score: 10.0 bits;  conditional E-value: 0.00093
                HHHHHTB.......-BHHHHHHHHHHHHHH CS
     PF01519 25 hkqldeFKdandqrltkiEtkvdqlaqgeq 54
                +k + eFKda+ q++++ ++ vd  + g q
  ABD99073.1  2 KKRIAEFKDAKGQFVKRYDKLVD--KDGIQ 29
                57889***************999..44444 PP

>> PF11961  Domain of unknown function (DUF3475)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0086        48      33      53 ..      23      43 ..      12      48 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0086
     PF11961 33 lsseGVrkLvseDdsfLlsLa 53
                +  +G++++vse+ +  l L+
  ABD99073.1 23 VDKDGIQYMVSEHHDRYLVLV 43
                6678********999888776 PP

>> PF10249  NADH-ubiquinone oxidoreductase subunit 10
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.1    0.0081        45      86     121 ..       2      37 ..       1      43 [. 0.78

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.0081
     PF10249  86 aklleqfeeaaknyfikygdlgayadarkalmkqkh 121
                 +k +++f++a+ ++ ++y+ l  +  ++ +     +
  ABD99073.1   2 KKRIAEFKDAKGQFVKRYDKLVDKDGIQYMVSEHHD 37 
                 578999************999888777666555555 PP

>> PF03114  BAR domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.3    0.0083        46     126     149 ..       4      27 ..       1      39 [. 0.85

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.0083
     PF03114 126 llkefkeiqkeikklerkrlDyDa 149
                  ++efk+ + +  k+ +k++D D 
  ABD99073.1   4 RIAEFKDAKGQFVKRYDKLVDKDG 27 
                 5689*****************985 PP

>> PF08460  Bacterial SH3 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.015        81      33      50 ..      12      30 ..       8      41 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.015
                ---EEE.EEEEEE----EE CS
     PF08460 33 kGdkvk.YDevltadGyvW 50
                kG+ vk YD+ +++dG ++
  ABD99073.1 12 KGQFVKrYDKLVDKDGIQY 30
                5666644*********887 PP

>> PF02153  Prephenate dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.018        98     153     169 ..      28      44 ..       8      48 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.018
                 EEE--HHHHHHHHHHHT CS
     PF02153 153 villspeeHDrvvalvs 169
                 + ++ +e+HDr + lvs
  ABD99073.1  28 IQYMVSEHHDRYLVLVS 44 
                 67899********9998 PP

>> PF11585  Insect antimicrobial peptide, stomoxyn
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.031   1.7e+02       3      20 ..      15      34 ..      13      36 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.031
                -HHHHHHHHHH..HHHHHHH CS
     PF11585  3 FRKrFNklvKK..vKHTiSE 20
                F Kr+ klv K  ++  +SE
  ABD99073.1 15 FVKRYDKLVDKdgIQYMVSE 34
                89*******98667777766 PP

>> PF10088  Uncharacterized protein conserved in bacteria (DUF2326)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.025   1.4e+02      78     101 ..      10      33 ..       8      46 .. 0.88

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.025
     PF10088  78 rqkakllklvneyaekrgiQyivt 101
                 + k +++k ++++++k giQy v+
  ABD99073.1  10 DAKGQFVKRYDKLVDKDGIQYMVS 33 
                 5678899999***********997 PP

>> PF06203  CCT motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.1     0.038   2.1e+02      36      43 ..      11      18 ..       1      20 [. 0.73

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.038
     PF06203 36 vKGrFvkq 43
                 KG+Fvk+
  ABD99073.1 11 AKGQFVKR 18
                6*****97 PP

>> PF09966  Uncharacterized protein conserved in bacteria (DUF2200)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.037     2e+02      78      99 ..       4      25 ..       2      28 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.037
     PF09966 78 rveeiedelmreiryldklvde 99
                r+ e +d   + +++ dklvd+
  ABD99073.1  4 RIAEFKDAKGQFVKRYDKLVDK 25
                899999999***********96 PP

>> PF03903  Phage T4 tail fibre
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.041   2.3e+02     197     215 ..      12      30 ..       5      32 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.041
     PF03903 197 dpshvprfdqivikDsvqd 215
                 + ++v r+d++v kD +q 
  ABD99073.1  12 KGQFVKRYDKLVDKDGIQY 30 
                 5679************995 PP

>> PF02412  Thrombospondin type 3 repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1       0.1   5.6e+02       4       9 ..      24      29 ..      23      29 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.1
     PF02412  4 DgDGvg 9 
                D+DG++
  ABD99073.1 24 DKDGIQ 29
                9***97 PP

>> PF12023  Domain of unknown function (DUF3511)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.086   4.8e+02      11      18 ..       2       9 ..       1      11 [. 0.91

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.086
     PF12023 11 rkRvAsYk 18
                +kR+A +k
  ABD99073.1  2 KKRIAEFK 9 
                8****998 PP

>> PF00728  Glycosyl hydrolase family 20, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.043   2.4e+02     185     213 ..       4      32 ..       1      44 [. 0.85

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.043
                 ...........HHHHHHHHHHH---EEE- CS
     PF00728 185 glksleelqsyfikrvekivkkrgkklig 213
                 ++++ ++ + +f+kr+ k+v+k g++ ++
  ABD99073.1   4 RIAEFKDAKGQFVKRYDKLVDKDGIQYMV 32 
                 46778999999*************99664 PP

>> PF05600  Protein of unknown function (DUF773)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.1      0.12   6.4e+02     144     171 ..       2      29 ..       1      38 [. 0.91

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.12
     PF05600 144 erkeedlkksaaevreqyeeackqlgik 171
                 +++ +++k ++ +  ++y + + + gi+
  ABD99073.1   2 KKRIAEFKDAKGQFVKRYDKLVDKDGIQ 29 
                 79999*****************999997 PP

>> PF05901  Excalibur calcium-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   1.2      0.58   3.2e+03      30      33 ..      24      27 ..       7      28 .. 0.50

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.58
     PF05901 30 DkDG 33
                DkDG
  ABD99073.1 24 DKDG 27
                5555 PP

>> PF09453  HIRA B motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.3   0.7      0.32   1.8e+03      11      15 ..       2       6 ..       2       6 .. 0.95

  Alignments for each domain:
  == domain 1    score: 1.3 bits;  conditional E-value: 0.32
     PF09453 11 KkRiA 15
                KkRiA
  ABD99073.1  2 KKRIA 6 
                9***9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (67 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       278  (0.0233378); expected 238.2 (0.02)
Passed bias filter:                      272  (0.0228341); expected 238.2 (0.02)
Passed Vit filter:                        19  (0.00159503); expected 11.9 (0.001)
Passed Fwd filter:                        19  (0.00159503); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              18  [number of targets reported over threshold]
# CPU time: 0.11u 0.04s 00:00:00.15 Elapsed: 00:00:01
# Mc/sec: 1314.97
//