# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_16629.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABD99672.1  [L=375]
Description: lsal0 trmU GIB00337CH01 "tRNA (5-methylaminomethyl-2-thiouridylate)-methy.."
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
     2e-144  483.2   0.1   2.3e-144  483.0   0.0    1.0  1  PF03054  tRNA methyl transferase
    4.4e-06   28.4   0.0    3.4e-05   25.5   0.0    2.1  2  PF02540  NAD synthase
    1.2e-05   27.5   0.0    2.1e-05   26.8   0.0    1.3  1  PF02568  Thiamine biosynthesis protein (ThiI)
     0.0016   20.6   0.0     0.0029   19.8   0.0    1.3  1  PF00733  Asparagine synthase
  ------ inclusion threshold ------
      0.026   16.7   0.0      0.068   15.3   0.0    1.7  1  PF01171  PP-loop family
      0.036   16.5   0.1      0.087   15.3   0.1    1.7  1  PF06508  ExsB
       0.52   12.6   0.0        1.1   11.6   0.0    1.4  1  PF10989  Protein of unknown function (DUF2808)
        1.2   11.5   0.3        8.3    8.8   0.1    2.1  1  PF12604  Tail fiber protein gp37 C terminal
          3   10.3   0.2        7.2    9.1   0.1    1.6  1  PF03698  Uncharacterised protein family (UPF0180)
        3.6   10.1   0.0        6.2    9.3   0.0    1.4  1  PF04719  hTAFII28-like protein conserved region
        3.7    9.5   0.0        7.3    8.6   0.0    1.4  1  PF01397  Terpene synthase, N-terminal domain
        4.3    9.0   0.1        6.5    8.4   0.1    1.3  1  PF00764  Arginosuccinate synthase
         17    7.4   0.0         32    6.5   0.0    1.4  1  PF12483  E3 Ubiquitin ligase
         25    7.3   0.1    1.4e+02    4.9   0.0    2.2  1  PF10788  Protein of unknown function (DUF2603)
         25    7.3   0.2         58    6.1   0.1    1.8  1  PF01507  Phosphoadenosine phosphosulfate reductase family
         25    7.4   0.0         73    5.9   0.0    1.8  1  PF04422  Coenzyme F420 hydrogenase/dehydrogenase, beta subun
         37    6.8   0.0         85    5.7   0.0    1.6  1  PF05295  Luciferase/LBP N-terminal domain
         47    7.0   0.0    1.6e+02    5.3   0.0    1.8  1  PF07833  Copper amine oxidase N-terminal domain
         61    6.2   0.0    1.2e+02    5.2   0.0    1.5  1  PF01113  Dihydrodipicolinate reductase, N-terminus
         68    5.2   0.1    1.5e+02    4.1   0.0    1.6  1  PF03388  Legume-like lectin family
         80    6.2   0.0    1.9e+02    5.0   0.0    1.6  1  PF06742  Protein of unknown function (DUF1214)
         87    5.7   0.0    3.5e+02    3.7   0.0    2.0  1  PF01599  Ribosomal protein S27a
    1.2e+02    5.3   0.0    2.4e+02    4.2   0.0    1.5  1  PF11629  C terminal SARAH domain of Mst1
    1.2e+02    5.2   0.2    3.7e+02    3.6   0.0    1.9  1  PF11552  Protein of unknown function (DUF3230)
    1.7e+02    4.6   0.0    3.9e+02    3.4   0.0    1.5  1  PF01910  Domain of unknown function DUF77
    1.9e+02    4.0   0.0    3.2e+02    3.2   0.0    1.3  1  PF06326  Vesiculovirus matrix protein
      2e+02    3.2   0.1    3.2e+02    2.5   0.0    1.3  1  PF06202  Amylo-alpha-1,6-glucosidase
      2e+02    3.3   0.0    3.2e+02    2.7   0.0    1.3  1  PF01266  FAD dependent oxidoreductase
    2.1e+02    4.7   0.0    4.2e+02    3.7   0.0    1.4  1  PF06129  Chordopoxvirus G3 protein
    2.6e+02    1.6   0.0    3.8e+02    1.0   0.0    1.1  1  PF03395  Poxvirus P4A protein
    2.6e+02    4.1   0.1      5e+02    3.2   0.0    1.4  1  PF03905  Coronavirus non-structural protein NS4
    2.7e+02    3.9   0.2    6.4e+02    2.7   0.1    1.5  1  PF02817  e3 binding domain
      3e+02    3.7   0.0    6.5e+02    2.6   0.0    1.5  1  PF08035  Opioids neuropeptide
    3.2e+02    3.0   0.0    5.3e+02    2.2   0.0    1.2  1  PF04245  37-kD nucleoid-associated bacterial protein
    3.6e+02    3.4   0.0    8.8e+02    2.1   0.0    1.6  1  PF02775  Thiamine pyrophosphate enzyme, C-terminal TPP bindi
    4.5e+02    2.7   0.0    1.3e+03    1.2   0.0    1.6  1  PF10018  Vitamin-D-receptor interacting Mediator subunit 17t
    5.1e+02    3.8   0.0      1e+03    2.8   0.0    1.4  1  PF01408  Oxidoreductase family, NAD-binding Rossmann fold
    6.7e+02    2.7   0.0    1.8e+03    1.4   0.0    1.7  1  PF12399  Branched-chain amino acid ATP-binding cassette tran
    1.5e+03    1.0   0.0    2.5e+03    0.3   0.0    1.2  1  PF00487  Fatty acid desaturase
    1.5e+03    1.6   0.5    6.9e+03   -0.5   0.4    1.9  1  PF01839  FG-GAP repeat
    3.7e+03    1.5   0.8    7.7e+03    0.5   0.6    1.4  1  PF08249  Mastoparan protein


Domain and alignment annotation for each model:
>> PF03054  tRNA methyl transferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  483.0   0.0  9.5e-148  2.3e-144       2     356 .]       8     362 ..       7     362 .. 0.99

  Alignments for each domain:
  == domain 1    score: 483.0 bits;  conditional E-value: 9.5e-148
                 EEE-------HHHHHHHHHHH---EEE--EEE-SS-----H.HHHHHHHHHHHHHHHHH------EEETHHHHHHHTHHHHHHHHH------HHHHHHH CS
     PF03054   2 kvvvalSgGVDSsvaalllkeqgyevigvfmknweeedeegkeccaeedlkdaervaeklgiplevvnfekeykekvfeefleeykkGrTPnPdvlCNk 100
                 +vvv++SgGVDSsv+a+llk+qgy+v+gvfmknw+++++ g +c+ +ed++d+ +va+++gip++ vnfekey+++vf +fl+eyk+GrTPnPd++CNk
  ABD99672.1   8 RVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSG-VCTVTEDYQDVAKVASQIGIPYYSVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNK 105
                 79**********************************99999.********************************************************* PP

                 HTTTTHHHHHHHTT----EEE-----EEEE-..---EEEE----TTC--GGGGTT--HHHHHHEE-------HHHHHHHHHH---TTSS-------TT- CS
     PF03054 101 eiKfgallekakeelgadalatGHYarvsleeeknevellraldkkkDQsyfLsqlskeqlekllfPlgeltKeevrkiAkeaglevaekkdSqgiCFi 199
                 e+Kf+a+l++a +  +ad++a GHYa+++ +e +++v+llr++d +kDQ+yfLsqls+eql+k++fP+g+l+K+evr+iA+eagl++a+kkdS+giCFi
  ABD99672.1 106 EVKFKAFLDYAMS-IDADYIAMGHYAQLRRDE-DGRVHLLRGADDNKDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLATAKKKDSTGICFI 202
                 ************9.***************996.8***************************************************************** PP

                 --HHHHHH----S------EEE--.--B-------TT-------------...--S--EEEEEETTTTEEEEE-----GGGEE---EE-S---TT-S-- CS
     PF03054 200 gkrkfkdflkkyleekeGkiidietgevlgeheGllsyTiGqrkGlklgg...leeplyVvekdaeknevvvskgedkeallskellvkelnwlaeelk 295
                 g+r+f++fl ++l++++G++++++ gev g+h Gl++yTiGqrkGl++gg   ++ep++V+ kd+++n+++v++g+++e+l+ ++l +++l+++++   
  ABD99672.1 203 GERNFSKFLGEFLPAQPGEMVTLD-GEVKGNHFGLMNYTIGQRKGLGIGGdgkSNEPWFVIGKDLKTNTLLVGQGYHNEHLYANSLDASKLSFVDDISD 300
                 ************************.************************99999*****************************************9999 PP

                 -.--EEEEEESSTT---EEEEEEE-SS.S-EEEEESS-EET-------EEE---BB-----E CS
     PF03054 296 ekealevevkvrhrqeevkakvklked.eevevklkekvravtpGQaavlYkgdevLGggvi 356
                  ++++++++k+r+rq+++ ++vk +ed  +vev ++e+vra+tpGQ +v+Y+g+e+LG+g+i
  ABD99672.1 301 CGDEFHCTAKFRYRQKDTGVTVKFNEDrTKVEVIFDEPVRAITPGQEVVFYDGEECLGSGTI 362
                 9999*********************99889******************************98 PP

>> PF02540  NAD synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.5   0.0   1.4e-08   3.4e-05      19      85 ..       7      79 ..       1     128 [. 0.73
   2 ?    0.5   0.0      0.62   1.5e+03     148     167 ..     168     187 ..     164     196 .. 0.87

  Alignments for each domain:
  == domain 1    score: 25.5 bits;  conditional E-value: 1.4e-08
                -EEEE------HHHHHHHHHHHHHTCCCEEEEE--..-......SSTTHHHHHHHHHHHHHHTSEEEE---HHHH CS
     PF02540 19 kgvvlGlSGGvDSalvaalavkalgkenvlalimP..s......svsseedvedalalaeklgiesktidikeiv 85
                  vv+G+SGGvDS++ a+l ++      v+++ m   +      + +  ed++d  ++a ++gi +  ++ ++ +
  ABD99672.1  7 IRVVVGMSGGVDSSVSAYLLKQQG--YDVVGVFMKnwDdkndsgVCTVTEDYQDVAKVASQIGIPYYSVNFEKEY 79
                579****************99875..78999999632111111123346899*************9999987644 PP

  == domain 2    score: 0.5 bits;  conditional E-value: 0.62
                 BETTTTS-CHHHHHHHHHTT CS
     PF02540 148 lapiaellKtevyeLakrln 167
                 + pi++l K+ev+++a++ +
  ABD99672.1 168 MFPIGHLQKSEVRRIAEEAG 187
                 67*************99876 PP

>> PF02568  Thiamine biosynthesis protein (ThiI)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.8   0.0   8.4e-09   2.1e-05       2      74 ..       5      77 ..       4      92 .. 0.85

  Alignments for each domain:
  == domain 1    score: 26.8 bits;  conditional E-value: 8.4e-09
     PF02568  2 tqgkvlaLlSgGiDSpVaaylllkRGcevvlvhfkneplkseeaeekvrklaellaeyktelevklvvvdfkk 74
                +q +v++ +SgG+DS V+ayll + G +vv v++kn   k+++    v++  + +a+  +++ + ++ v+f+k
  ABD99672.1  5 SQIRVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPYYSVNFEK 77
                57899******************************99999988887777777777777777777777777765 PP

>> PF00733  Asparagine synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   19.8   0.0   1.2e-06    0.0029      19      92 ..       8      88 ..       2     101 .. 0.88

  Alignments for each domain:
  == domain 1    score: 19.8 bits;  conditional E-value: 1.2e-06
                EE-EE-----HHHHHHHHHTT.TSSEEEEEE---TSS-.........-HHHHHHHHHH---EEEE----HHHHH---HHHH CS
     PF00733 19 pvgvlLSGGlDSsliaalaaresskplktfsvgfeesead.......eagyaelvaehlgtehveinvteeellealpevi 92
                +v v  SGG+DSs+ a+l++++ ++ +  f  ++++++++       + +  ++va ++g+  + +n+++e + +++  ++
  ABD99672.1  8 RVVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSgvctvteDYQDVAKVASQIGIPYYSVNFEKEYWDRVFTYFL 88
                677889********************************99*****99999999**************99987776665555 PP

>> PF01171  PP-loop family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.3   0.0   2.8e-05     0.068       2     163 ..       9     190 ..       8     207 .. 0.69

  Alignments for each domain:
  == domain 1    score: 15.3 bits;  conditional E-value: 2.8e-05
                 EEEE-----HHHHHHHHHHHHCTTTT-EEEEEEE--SSSTCH.....HHHHHHHHHHHHHTT-EEEEE---H................HHHTT--TTTH CS
     PF01171   2 vlvAvSGGlDSmaLlkllkklkkklgiklvavhvdhglrees.....keeaelveelckklnipleiekvdv................akkkgknleea 79 
                 v+v++SGG+DS +  +llk++  +    + +++ ++  +++s      e+ + v++++++++ip++  +++                 +++ + ++   
  ABD99672.1   9 VVVGMSGGVDSSVSAYLLKQQGYD---VVGVFMKNWDDKNDSgvctvTEDYQDVAKVASQIGIPYYSVNFEKeywdrvftyfldeyknGRTPNPDI-MC 103
                 89****************999654...556666666666544333337999***************999998888888888886443222222222.35 PP

                 HHHHHHHHHHHCHHH-..-EEE---BHH.HHHHHHHHHHC-----..-------SEEE---TCEE-CCCT--HHHHHHHHHHTT--- CS
     PF01171  80 ARelRYellkelakkegaevlllAhhad.DqaEtfllrllrgsgl..aglagikakrelagielvRPlLkvskeeleeylkekkikw 163
                   e+ ++++ ++a + +a++++++h a+  + E   ++llrg+    ++ + +++ ++ +  +++ P+ +++k+e++++++e ++  
  ABD99672.1 104 NKEVKFKAFLDYAMSIDADYIAMGHYAQlRRDEDGRVHLLRGADDnkDQTYFLSQLSQEQLQKVMFPIGHLQKSEVRRIAEEAGLAT 190
                 688999999999999999999999987622346666666666654213444455555444477788888888888888888877665 PP

>> PF06508  ExsB
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.3   0.1   3.6e-05     0.087       2      31 ..       9      38 ..       8      75 .. 0.82

  Alignments for each domain:
  == domain 1    score: 15.3 bits;  conditional E-value: 3.6e-05
                EEEE-----HHHHHHHHHHHH-SEEEEEEE CS
     PF06508  2 avvllSGGlDSttvlalakkegkevealtf 31
                +vv +SGG+DS++ ++l+k++g+ v  + +
  ABD99672.1  9 VVVGMSGGVDSSVSAYLLKQQGYDVVGVFM 38
                7999*******************9987654 PP

>> PF10989  Protein of unknown function (DUF2808)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.6   0.0   0.00043       1.1      74     101 ..     315     341 ..     302     350 .. 0.74

  Alignments for each domain:
  == domain 1    score: 11.6 bits;  conditional E-value: 0.00043
     PF10989  74 geeiplaevevdedgrsieivfaePvpp 101
                 +++   ++v+++ed++++e++f+ePv +
  ABD99672.1 315 QKDTG-VTVKFNEDRTKVEVIFDEPVRA 341
                 33333.67*****************854 PP

>> PF12604  Tail fiber protein gp37 C terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.8   0.1    0.0034       8.3      16      81 ..     247     311 ..     229     335 .. 0.85

  Alignments for each domain:
  == domain 1    score: 8.8 bits;  conditional E-value: 0.0034
     PF12604  16 lli.ldsasdkalyilskdtgrnnwyigrGsdngnDvtlysyvyGtnLtlkddqavvnkrlhvgqav 81 
                 l i  d+ s+++ ++++kd  +n + +g+G  n    +  ++    +L   dd + +++++h ++  
  ABD99672.1 247 LGIgGDGKSNEPWFVIGKDLKTNTLLVGQGYHN--EHLYANSLDASKLSFVDDISDCGDEFHCTAKF 311
                 45567999***********************99..7777799999*****************99865 PP

>> PF03698  Uncharacterised protein family (UPF0180)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.1     0.003       7.2      16      49 ..      25      60 ..      16      65 .. 0.75

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.003
     PF03698 16 aLkekGYeVve..lkeeedldevdaivvtGldsnvl 49
                 Lk++GY+Vv   +k+ +d ++ + + vt   ++v+
  ABD99672.1 25 LLKQQGYDVVGvfMKNWDDKNDSGVCTVTEDYQDVA 60
                58*******972245666999999999998877775 PP

>> PF04719  hTAFII28-like protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0    0.0025       6.2       3      36 ..     154     190 ..     152     215 .. 0.76

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.0025
     PF04719   3 vlvskfteeQleRyevfrrsslkkakvkklisq....v 36 
                 + +s++++eQl++  +f   +l+k++v++++++    +
  ABD99672.1 154 YFLSQLSQEQLQKV-MFPIGHLQKSEVRRIAEEaglaT 190
                 6799********95.9**************99854333 PP

>> PF01397  Terpene synthase, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.6   0.0     0.003       7.3      95     134 ..      20      59 ..      14      70 .. 0.79

  Alignments for each domain:
  == domain 1    score: 8.6 bits;  conditional E-value: 0.003
     PF01397  95 alaFrlLRqhGykvssdvFkkFkdedgk.fkesltkdvkgl 134
                 ++  +lL+q+Gy+v    +k++ d++ + ++   t+d + +
  ABD99672.1  20 SVSAYLLKQQGYDVVGVFMKNWDDKNDSgVCT-VTEDYQDV 59 
                 66778*******************99996555.55555544 PP

>> PF00764  Arginosuccinate synthase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.1    0.0027       6.5       2      31 ..      11      39 ..      10      85 .. 0.76

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0027
     PF00764  2 LaysGGlDtsviikllkeklgeeviavavd 31
                +  sGG+D sv   llk+++ ++v+ v + 
  ABD99672.1 11 VGMSGGVDSSVSAYLLKQQG-YDVVGVFMK 39
                678********988887776.****99775 PP

>> PF12483  E3 Ubiquitin ligase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.013        32     104     137 ..     131     166 ..     125     168 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.013
     PF12483 104 easrdedgtvriqk..Pseggqpfivsekseeelie 137
                 +++rdedg v + +   ++++q +++s+ s+e+l++
  ABD99672.1 131 QLRRDEDGRVHLLRgaDDNKDQTYFLSQLSQEQLQK 166
                 6788999977775422678899***********986 PP

>> PF10788  Protein of unknown function (DUF2603)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.056   1.4e+02      35      59 ..     251     275 ..     247     291 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.056
     PF10788  35 gslekeepwfvidengelhvlvslk 59 
                 g+ +++epwfvi ++ ++ +l+  +
  ABD99672.1 251 GDGKSNEPWFVIGKDLKTNTLLVGQ 275
                 667899***********99998655 PP

>> PF01507  Phosphoadenosine phosphosulfate reductase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.1     0.024        58       2      33 ..       9      40 ..       8     191 .. 0.60

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.024
                EEEE--.--TCHHHHHHHHHHTTT-EEEEEE- CS
     PF01507  2 lvvsvsgGkdslVllhLalkafkpvpvvfvdt 33
                +vv +sgG ds+V   L+ +  ++v  vf++ 
  ABD99672.1  9 VVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKN 40
                68999***************999988887754 PP

>> PF04422  Coenzyme F420 hydrogenase/dehydrogenase, beta subunit N-term
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0      0.03        73      16      64 ..      11      60 ..       2      73 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.03
     PF04422 16 kaqdGGiVTallayaLeeglvDgvivvarkkeepwkpepvlvt.tpeell 64
                 + +GG+ +++ ay+L+++  D v v  ++ +++ +  ++ vt + ++++
  ABD99672.1 11 VGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTeDYQDVA 60
                5789********************88887777777665554441555555 PP

>> PF05295  Luciferase/LBP N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.035        85      11      43 ..      13      45 ..       4      68 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.035
     PF05295 11 neakvDqkvvayvtkqlklesvsDfanywtsse 43
                  + vD++v ay+ kq  ++ v  f + w  ++
  ABD99672.1 13 MSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKN 45
                5688************************97665 PP

>> PF07833  Copper amine oxidase N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.065   1.6e+02      12      53 ..     314     355 ..     310     360 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.065
     PF07833  12 iaealGakvewdeetktvtiskgdktiklkigsneatvngke 53 
                   +  G++v+++e++ +v++  ++    +++g+ +++++g+e
  ABD99672.1 314 RQKDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVFYDGEE 355
                 556789******************************999986 PP

>> PF01113  Dihydrodipicolinate reductase, N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0      0.05   1.2e+02       4      43 ..       9      48 ..       7      72 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.05
                EEB--------HHHHHHHH----EE-EEB-----TT---B CS
     PF01113  4 avvGasGrmGkevikaieeaedlelvaavdrkeselegkd 43
                +vvG+sG + ++v   + +++++ +v+++ ++  +++++ 
  ABD99672.1  9 VVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSG 48
                699**************************99874444333 PP

>> PF03388  Legume-like lectin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.061   1.5e+02     151     177 ..     306     332 ..     270     340 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.061
                 -EE---CTESSEEEEEEEEE---EEEC CS
     PF03388 151 sCtadfrnkdyptrikikYdknvltvl 177
                  Cta+fr ++ +t + +k+++++ +v 
  ABD99672.1 306 HCTAKFRYRQKDTGVTVKFNEDRTKVE 332
                 4*******************9998875 PP

>> PF06742  Protein of unknown function (DUF1214)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.078   1.9e+02      31      67 ..     121     156 ..     113     168 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.078
     PF06742  31 ldryslgsrsglkknadGsltiylqpeapkgkesnwl 67 
                  d +++g+  +l++++dG++ ++ ++++  ++++ +l
  ABD99672.1 121 ADYIAMGHYAQLRRDEDGRVHLLRGADDN-KDQTYFL 156
                 56778888999***************977.4555555 PP

>> PF01599  Ribosomal protein S27a
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.14   3.5e+02      29      47 .]      35      53 ..      33      53 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.14
     PF01599 29 GvFmAehkdRqyCGkCglt 47
                GvFm +  d+   G C  t
  ABD99672.1 35 GVFMKNWDDKNDSGVCTVT 53
                9***************876 PP

>> PF11629  C terminal SARAH domain of Mst1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.2   0.0     0.099   2.4e+02       4      22 ..     155     173 ..     152     184 .. 0.75

  Alignments for each domain:
  == domain 1    score: 4.2 bits;  conditional E-value: 0.099
     PF11629   4 fLkslsveeLeqrlasLDp 22 
                 fL++ls+e+L++ +  + +
  ABD99672.1 155 FLSQLSQEQLQKVMFPIGH 173
                 9**********98766655 PP

>> PF11552  Protein of unknown function (DUF3230)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0      0.15   3.7e+02      46      75 ..     310     339 ..     304     352 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.15
                 EEEEEE----EEEEEEETT---EEEEE-SS CS
     PF11552  46 kfdlinnqgkvtlkfsqensktvievDlav 75 
                 kf   +++  vt+kf+++++k+++ +D +v
  ABD99672.1 310 KFRYRQKDTGVTVKFNEDRTKVEVIFDEPV 339
                 6778889999**************999765 PP

>> PF01910  Domain of unknown function DUF77
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.16   3.9e+02      27      64 ..     316     353 ..     308     362 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.16
                 CTSSSEEE------EEEESHHHHHHHHHHHHHHHHCT- CS
     PF01910  27 kesglkyelgpmgTtiEgeldevmevvkkaheavfeaG 64 
                 k++g++ + +   T +E+ +de ++++   +e+vf +G
  ABD99672.1 316 KDTGVTVKFNEDRTKVEVIFDEPVRAITPGQEVVFYDG 353
                 67899***************************999876 PP

>> PF06326  Vesiculovirus matrix protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.13   3.2e+02     185     225 ..     160     197 ..     155     200 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.13
                 S-----BGGGGS...-GGGGGGTTT-------EEE-S---- CS
     PF06326 185 tkkrgkpildllesengskepefqevleifglelkkkadke 225
                 +++++++++ ++    + +++e++ ++e++gl ++kk+d +
  ABD99672.1 160 SQEQLQKVMFPI---GHLQKSEVRRIAEEAGLATAKKKDST 197
                 678888899999...9*********************9987 PP

>> PF06202  Amylo-alpha-1,6-glucosidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.13   3.2e+02     202     236 ..      72     106 ..      39     124 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.13
     PF06202 202 kesfekkFwnakreilaDvlksskekdlslRpNfl 236
                   +fek++w+   +++ D +k+ ++ +  + +N  
  ABD99672.1  72 SVNFEKEYWDRVFTYFLDEYKNGRTPNPDIMCNKE 106
                 469*******************9999999999975 PP

>> PF01266  FAD dependent oxidoreductase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.13   3.2e+02       3      28 ..       9      36 ..       8      65 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.13
                EEE-..------HHHHHHHHTT-EEEEE CS
     PF01266  3 viiG..gGivGlstAyeLarrglkVtll 28
                v++G  gG+  +  Ay L+++g++V+ +
  ABD99672.1  9 VVVGmsGGVDSSVSAYLLKQQGYDVVGV 36
                8999999999***************976 PP

>> PF06129  Chordopoxvirus G3 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.17   4.2e+02      69     103 ..     310     344 ..     294     345 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.17
     PF06129  69 klyydsrsktvtvasknkklvfrlddeedvrtLlP 103
                 k +y+ +   vtv++++++   ++ ++e vr++ P
  ABD99672.1 310 KFRYRQKDTGVTVKFNEDRTKVEVIFDEPVRAITP 344
                 67899999**********************99877 PP

>> PF03395  Poxvirus P4A protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.0   0.0      0.16   3.8e+02     780     825 ..      86     132 ..      81     136 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.0 bits;  conditional E-value: 0.16
     PF03395 780 ytlerlfnirisd.dvkielleKykaisdisssLYndliiietikal 825
                 y l+  +n r  + d+  + + K+ka+ d  +s+ +d i++ +  +l
  ABD99672.1  86 YFLDEYKNGRTPNpDIMCNKEVKFKAFLDYAMSIDADYIAMGHYAQL 132
                 5567777777654399999**********************987776 PP

>> PF03905  Coronavirus non-structural protein NS4
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0       0.2     5e+02      20      35 ..       5      20 ..       1      24 [. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.2
     PF03905 20 vsttVyLGssiGiDTS 35
                + ++V  G s G+D S
  ABD99672.1  5 SQIRVVVGMSGGVDSS 20
                789***********99 PP

>> PF02817  e3 binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.1      0.26   6.4e+02       9      19 ..     179     189 ..     179     193 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.26
                 HHHHHHHTT-- CS
     PF02817   9 aRkLAaekgid 19 
                 +R++A+e+g+ 
  ABD99672.1 179 VRRIAEEAGLA 189
                 8********95 PP

>> PF08035  Opioids neuropeptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0      0.27   6.5e+02       4      11 ..      37      44 ..      35      46 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.27
     PF08035  4 FMkswdEr 11
                FMk wd+ 
  ABD99672.1 37 FMKNWDDK 44
                ******85 PP

>> PF04245  37-kD nucleoid-associated bacterial protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.22   5.3e+02     287     312 ..     312     337 ..     308     343 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.22
     PF04245 287 kfsGsggglslsFdsellgervvYDe 312
                 ++  ++ g++++F+++ +  +v++De
  ABD99672.1 312 RYRQKDTGVTVKFNEDRTKVEVIFDE 337
                 7889999******************8 PP

>> PF02775  Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.36   8.8e+02      80     127 ..      27      74 ..      20      90 .. 0.78

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.36
                 E-SB-..HHHHHHHH-SS-.GGGBB-------HHHHHHH---EEEEES CS
     PF02775  80 nNegygmtggqqepfggkrksgpdgkklkpvdfaklaealGakgarve 127
                   +gy  +g  ++ + +k+ sg+   +++  d+ak+a ++G++ ++v+
  ABD99672.1  27 KQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPYYSVN 74 
                 5677777777777888888888877777777***********988765 PP

>> PF10018  Vitamin-D-receptor interacting Mediator subunit 17t
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.2   0.0      0.54   1.3e+03      78      93 ..     104     119 ..      86     121 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.2 bits;  conditional E-value: 0.54
     PF10018  78 krevsseeLLkYArrI 93 
                 ++ev+++  L+YA+ I
  ABD99672.1 104 NKEVKFKAFLDYAMSI 119
                 799**********988 PP

>> PF01408  Oxidoreductase family, NAD-binding Rossmann fold
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.43     1e+03       4      67 ..       9      72 ..       8      88 .. 0.83

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.43
                EEE----HHHHTHHHHCCHCTTEEEEEEESSSHHHHHHHHHHTTCEEESSHHHHHT-TTECEEE CS
     PF01408  4 givGaGkigsrhlrplnesqrreelvalvdpdperaeavaesfgveaysdleelledpkidavi 67
                ++vG+       + ++  +q+++++v+++ ++ +   +    ++ e y+d+++++++  i +++
  ABD99672.1  9 VVVGMSGGVDSSVSAYLLKQQGYDVVGVFMKNWDDKNDSGVCTVTEDYQDVAKVASQIGIPYYS 72
                688886666666678888999***********99999999999999999999998866665555 PP

>> PF12399  Branched-chain amino acid ATP-binding cassette transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.73   1.8e+03       3      16 ..     124     137 ..     124     137 .. 0.93

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.73
     PF12399   3 IAeGtPeEvrndPr 16 
                 IA G +++ r+d++
  ABD99672.1 124 IAMGHYAQLRRDED 137
                 9***********85 PP

>> PF00487  Fatty acid desaturase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.3   0.0         1   2.5e+03     212     224 ..     269     281 ..     257     281 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.3 bits;  conditional E-value: 1
     PF00487 212 nllsgnlnyHieH 224
                 n l  + +yH+eH
  ABD99672.1 269 NTLLVGQGYHNEH 281
                 778999******* PP

>> PF01839  FG-GAP repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.5   0.4       2.8   6.9e+03      18      33 .]       9      24 ..       9      24 .. 0.85

  Alignments for each domain:
  == domain 1    score: -0.5 bits;  conditional E-value: 2.8
                EEEEEECTCE--EEEE CS
     PF01839 18 lavGmpgahnGavyvy 33
                ++vGm+g+ + +v+ y
  ABD99672.1  9 VVVGMSGGVDSSVSAY 24
                6999****99998876 PP

>> PF08249  Mastoparan protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.5   0.6       3.1   7.7e+03       7      12 ..     188     193 ..     186     193 .. 0.92

  Alignments for each domain:
  == domain 1    score: 0.5 bits;  conditional E-value: 3.1
                 CCCCCC CS
     PF08249   7 AAlAKK 12 
                 +A+AKK
  ABD99672.1 188 LATAKK 193
                 7****9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (375 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       342  (0.0287105); expected 238.2 (0.02)
Passed bias filter:                      302  (0.0253526); expected 238.2 (0.02)
Passed Vit filter:                        42  (0.00352586); expected 11.9 (0.001)
Passed Fwd filter:                        42  (0.00352586); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              41  [number of targets reported over threshold]
# CPU time: 0.29u 0.04s 00:00:00.32 Elapsed: 00:00:00
# Mc/sec: 2791.68
//