# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_16631.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABD99837.1  [L=586]
Description: lsal0 cydC GIB00337CH01 "Transport ATP-binding protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    3.6e-21   78.4   0.0      9e-21   77.1   0.0    1.7  1  PF00005  ABC transporter
    2.4e-05   26.4   0.7     0.0013   20.7   0.0    2.2  2  PF02463  RecF/RecN/SMC N terminal domain
    4.2e-05   25.8   8.9    4.2e-05   25.8   6.2    2.6  2  PF00664  ABC transporter transmembrane region
  ------ inclusion threshold ------
      0.025   16.4   0.1      0.052   15.4   0.0    1.5  1  PF03193  Protein of unknown function, DUF258
      0.095   15.2   1.0       0.18   14.3   0.1    1.9  1  PF01935  Domain of unknown function DUF87
        0.5   12.5   0.0       0.82   11.8   0.0    1.3  1  PF01580  FtsK/SpoIIIE family
        2.1   10.8   0.3        4.7    9.6   0.0    1.8  1  PF00350  Dynamin family
          4    9.6   0.2         14    7.8   0.0    1.9  1  PF04643  Motilin/ghrelin-associated peptide
        4.6    8.7   0.2         12    7.3   0.0    1.7  1  PF00931  NB-ARC domain
        6.1    8.5   1.4         17    7.1   0.2    2.1  1  PF04548  AIG1 family
        6.8    8.8   0.1         20    7.3   0.0    1.8  1  PF10662  Ethanolamine utilisation - propanediol utilisation
        7.4    8.7   0.0         15    7.6   0.0    1.4  1  PF00158  Sigma-54 interaction domain
        8.1    8.7   0.0         19    7.5   0.0    1.6  1  PF05729  NACHT domain
         10    7.8   0.2         22    6.7   0.1    1.4  1  PF06414  Zeta toxin
         12    8.2   0.2         23    7.3   0.1    1.6  1  PF03266  Protein of unknown function, DUF265
         13    7.8   0.0         72    5.4   0.0    2.1  1  PF01695  IstB-like ATP binding protein
         13    8.1   0.0         42    6.5   0.0    1.8  1  PF04077  DsrH like protein
         13    8.2   0.0         36    6.8   0.0    1.7  1  PF03205  Molybdopterin guanine dinucleotide synthesis protei
         14    7.1   0.0         24    6.3   0.0    1.4  1  PF00437  Type II/IV secretion system protein
         14    8.5   0.4         45    6.9   0.0    2.1  1  PF00910  RNA helicase
         14    8.8   0.1         39    7.4   0.0    1.8  1  PF08477  Miro-like protein
         19    6.8   0.1         37    5.8   0.0    1.4  1  PF00735  Septin
         26    6.1   1.7         51    5.1   1.2    1.4  1  PF06898  Putative stage IV sporulation protein YqfD
         28    6.1   0.0         51    5.2   0.0    1.4  1  PF03308  ArgK protein
         29    6.9   0.1         61    5.9   0.0    1.5  1  PF01583  Adenylylsulphate kinase
         30    6.8   0.0    1.3e+02    4.7   0.0    1.9  1  PF12038  Domain of unknown function (DUF3524)
         40    5.9   0.0         67    5.2   0.0    1.3  1  PF01078  Magnesium chelatase, subunit ChlI
         45    6.4   0.0      1e+02    5.2   0.0    1.5  1  PF02732  ERCC4 domain
         47    5.3   0.1         89    4.4   0.1    1.4  1  PF05049  Interferon-inducible GTPase (IIGP)
         54    6.7   0.1    6.2e+02    3.4   0.0    2.7  1  PF10362  Cytidylyltransferase C-terminal domain (DUF2432)
         58    6.1   0.1      2e+02    4.4   0.1    2.2  1  PF01926  GTPase of unknown function
         75    5.7   0.1    1.7e+02    4.5   0.1    1.6  1  PF07728  AAA domain (dynein-related subfamily)
         81    6.2   0.0    2.7e+02    4.6   0.0    1.8  1  PF08158  NUC130/3NT domain
         90    4.8   0.0    1.7e+02    3.8   0.0    1.4  1  PF04670  Gtr1/RagA G protein conserved region
      1e+02    6.3   0.0    2.1e+02    5.3   0.0    1.5  1  PF03413  Peptidase propeptide and YPEB domain
      1e+02    4.9   0.0    1.9e+02    4.0   0.0    1.4  1  PF00071  Ras family
    1.1e+02    4.9   0.1    2.4e+02    3.8   0.1    1.5  1  PF00485  Phosphoribulokinase / Uridine kinase family
    1.2e+02    4.7   0.0    2.1e+02    3.9   0.0    1.3  1  PF00006  ATP synthase alpha/beta family, nucleotide-binding 
    1.4e+02    4.4   0.1    2.4e+02    3.6   0.1    1.4  1  PF11643  Vasodilator-stimulated phosphoprotein VASP
    1.6e+02    4.6   0.9    2.5e+02    4.0   0.2    1.6  1  PF04740  Bacillus transposase protein
    1.8e+02    4.0   0.2    3.2e+02    3.2   0.2    1.5  1  PF03821  Golgi 4-transmembrane spanning transporter
      2e+02    3.9   4.9         23    7.0   0.0    1.9  1  PF12534  Leucine-rich repeat containing protein 8
    2.3e+02    3.6   0.2      5e+02    2.5   0.1    1.5  1  PF06175  tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)
    2.3e+02    3.4   0.0    5.2e+02    2.3   0.0    1.5  1  PF02404  Stem cell factor
    2.4e+02    4.7   0.0    4.6e+02    3.8   0.0    1.4  1  PF04526  Protein of unknown function (DUF568)
    2.4e+02    2.2   0.6    3.6e+02    1.7   0.4    1.2  1  PF01601  Coronavirus S2 glycoprotein
    2.7e+02    4.0  10.7    8.3e+02    2.4   0.0    3.4  3  PF11023  Protein of unknown function (DUF2614)
    2.9e+02    2.9   0.0      7e+02    1.6   0.0    1.5  1  PF07693  KAP family P-loop domain
    3.6e+02    2.6   0.0    6.5e+02    1.8   0.0    1.3  1  PF01573  Bromovirus movement protein
    3.9e+02    2.6   1.1    4.9e+02    2.2   0.1    1.5  1  PF00503  G-protein alpha subunit
    4.3e+02    3.6   0.2    9.2e+02    2.5   0.2    1.5  1  PF00638  RanBP1 domain
    4.5e+02    2.9   0.0    7.9e+02    2.1   0.0    1.3  1  PF03029  Conserved hypothetical ATP binding protein
    4.6e+02    2.7   5.0      4e+02    2.9   1.9    1.9  1  PF03303  WTF protein
    5.1e+02    3.4   3.1    1.7e+03    1.7   2.1    1.9  1  PF07589  PEP-CTERM motif
    5.2e+02    3.1   1.9    4.5e+02    3.4   0.1    1.8  1  PF10917  Protein of unknown function (DUF2708)
    5.7e+02    2.7   0.0    9.9e+02    1.9   0.0    1.3  1  PF01331  mRNA capping enzyme, catalytic domain
    5.9e+02    2.7   7.3    1.4e+02    4.7   2.1    2.1  1  PF06624  Ribosome associated membrane protein RAMP4
      1e+03    1.8   0.2    2.9e+03    0.2   0.1    1.6  1  PF04030  D-arabinono-1,4-lactone oxidase
    2.1e+03    0.6   5.1    4.6e+03   -0.5   3.5    1.4  1  PF06417  Protein of unknown function (DUF1077)
    2.3e+03    1.5   1.7    2.4e+03    1.4   0.1    1.8  1  PF04728  Repeated sequence found in lipoprotein LPP
    3.7e+03    0.9   7.8    1.1e+04   -0.6   5.4    1.8  1  PF07850  Renin receptor-like protein
    3.9e+03    0.1   8.0         93    5.3   0.1    2.3  1  PF09976  Uncharacterized protein conserved in bacteria (DUF2


Domain and alignment annotation for each model:
>> PF00005  ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   77.1   0.0   5.6e-24     9e-21       1     117 [.     389     512 ..     389     513 .. 0.91

  Alignments for each domain:
  == domain 1    score: 77.1 bits;  conditional E-value: 5.6e-24
                 HHHHHHHTTSS------EEE-...--BGGGB-HHHHH..EEEE-------.--BHHHHHH----S---HHHHHHHHHH---HHHH--..........-- CS
                 xxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..........xx RF
     PF00005   1 STLlklltgelkptegeievdn.drkdlesdkleklr..igyipqdpllfpeltvrenldmakeekktdkrieevlekvgldelldk..........sr 86 
                 STL++l+ g    teg i++++ d+ ++ +    ++   ig+i q p lf + t+ +nl+++ ee+ t +++ +vle+vgl++ ++           + 
  ABD99837.1 389 STLANLIRGDRVATEGAITINGiDVSKVGD----QISnyIGVIHQTPYLF-NTTILNNLRIGNEEA-TIEQVWQVLERVGLKDMVKAlpqgletmvdEA 481
                 9********************545533332....33345***********.**************9.****************99999*********99 PP

                 --------HHHHHHHHHHTT--SEEEEESTT CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005  87 vstLSgGqkqrvalArallkkpklllLDEPt 117
                 +  +SgG++ r+alAr llk++++++LDEPt
  ABD99837.1 482 GMRFSGGERHRMALARILLKDAPIIILDEPT 512
                 ******************************9 PP

>> PF02463  RecF/RecN/SMC N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.2      0.12     2e+02      28      42 ..     379     393 ..     366     396 .. 0.83
   2 !   20.7   0.0   8.1e-07    0.0013     110     211 ..     441     555 ..     418     561 .. 0.92

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.12
                 EE--------HHHHH CS
                 xxxxxxxxxxxxxxx RF
     PF02463  28 aivGpNGSGKsnvld 42 
                 ai+G+ GSGKs + +
  ABD99837.1 379 AILGRSGSGKSTLAN 393
                 89*********9876 PP

  == domain 2    score: 20.7 bits;  conditional E-value: 8.1e-07
                 EEEE---EE-HHHHHHHHHCTT--TT.................G-----HHHHHHHHHHHHHTSS--SEEEESSTTTT--HHHHHHHHHHHHHH-BTBE CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxx.................xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463 110 eykingkevtkkevaellesagiske.................lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQ 191
                 + +i ++e+t ++v ++le++g++                    +SgGe+  +ala +      k ap+ +lDe    LD    ++v ++++++ k+  
  ABD99837.1 441 NLRIGNEEATIEQVWQVLERVGLKDMvkalpqgletmvdeagmRFSGGERHRMALARI----LLKDAPIIILDEPTVGLDPLTEQEVISIFNRELKDKT 535
                 6789999999999999****999999999*************99*******9999988....489********************************** PP

                 EEEE-S-HHHHTT-SEEE-- CS
                 xxxxxxxxxxxxxxxxxxxx RF
     PF02463 192 fivislreemlekadklvgv 211
                 +i i+++ + +e +d+++ +
  ABD99837.1 536 LIWITHHLQGVEAMDQVIFI 555
                 **************999866 PP

>> PF00664  ABC transporter transmembrane region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.8   6.2   2.6e-08   4.2e-05       8     174 ..      32     204 ..      25     215 .. 0.65
   2 ?    0.1   0.3       1.8   2.8e+03     234     256 ..     262     284 ..     246     299 .. 0.71

  Alignments for each domain:
  == domain 1    score: 25.8 bits;  conditional E-value: 2.6e-08
                 HHHHHHHHHHHHHH---HHHH..-SCCHHH..HHHHHHHHHHH.H---HHHHHHHHHHHHHH--HHHHHHHHHHHHHHCC...C-HHHHCS...SS--- CS
     PF00664   8 lilagvtalvfplllgrllds..vsdgnde..ersslyslail.liavgvlivlllqgsfyllertgqrirkrlfrallr...kilglfdsffdknsvG 98 
                 ++l+++t ++     + +++s  +++ + +  e+  l+++ i+   a+gv++  + +   +++++++ ++ ++l+ +l++   k+  +f s   k + G
  ABD99837.1  32 IFLGILTFFC---AGALMFNSgyLISRSATrpENILLVYVPIVlTRAFGVGRPVFHYLERLTSHNWVFKMTSDLRVKLYKaleKDAVFFKS---KYQLG 124
                 3333333333...222222223333333331133333333333333444444444444444488888888888888877522255555555...9**** PP

                 -HHHHHHHHHHHHH-----HHH....HHHHHHHHH----HHHHH---THHHHHHHHHHHHHHH---HHHHHHHHHHHHHH CS
     PF00664  99 ellsrltnDvskirdglgdklg....lffqslatfvgglivmfylgwkltlvllailpllilvsavlakilkslqkkeqk 174
                 ++l +l++D++ i+++   +++     +  ++++++g+ i++ ++g  ++l++ ++l+ + + s++++   ++++kk ++
  ABD99837.1 125 DVLGLLSEDINHIQNLYLRTIFptfvAWGLYVFIVIGVGIFSIWMGLLMLLMIGIMLVAFPIWSVIVNGARQEYEKKIKN 204
                 ***************976655511116669************************99999999999999999999998765 PP

  == domain 2    score: 0.1 bits;  conditional E-value: 1.8
                 HHHHHHHHHHH---TGSCGTSST CS
     PF00664 234 isylsyalalwfgtflsvisgel 256
                 ++++++ ++lw gt+l++ +g +
  ABD99837.1 262 FMLVVVSFILWGGTYLGGSNGVY 284
                 45566688888888884444443 PP

>> PF03193  Protein of unknown function, DUF258
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.4   0.0   3.2e-05     0.052      34      66 ..     373     406 ..     347     424 .. 0.80

  Alignments for each domain:
  == domain 1    score: 15.4 bits;  conditional E-value: 3.2e-05
                 TT.SBEEEE-------HHHHHHH--------S-- CS
     PF03193  34 kd.ktsvlvGqSGvGKSsLinallpeldlkvgev 66 
                 ++ +  +++G+SG GKS+L n ++++  +  g++
  ABD99837.1 373 SSgDKLAILGRSGSGKSTLANLIRGDRVATEGAI 406
                 44467789****************9987776666 PP

>> PF01935  Domain of unknown function DUF87
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.3   0.1   0.00011      0.18      25      43 ..     377     395 ..     363     408 .. 0.85

  Alignments for each domain:
  == domain 1    score: 14.3 bits;  conditional E-value: 0.00011
     PF01935  25 HlAilgsTGsGKSntvavL 43 
                  lAilg++GsGKS+++ ++
  ABD99837.1 377 KLAILGRSGSGKSTLANLI 395
                 68**************998 PP

>> PF01580  FtsK/SpoIIIE family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.0   0.00051      0.82      27      56 ..     364     393 ..     325     397 .. 0.76

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00051
                 -----EEEGGGS-SEEEE-----------H CS
     PF01580  27 sgkplvadlvkaphlLiaGatgsGKStflr 56 
                 + k + +d+++   l+i+G++gsGKSt  +
  ABD99837.1 364 ILKGINLDISSGDKLAILGRSGSGKSTLAN 393
                 4455566777777*************9754 PP

>> PF00350  Dynamin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.0    0.0029       4.7       2      29 ..     379     406 ..     378     460 .. 0.89

  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 0.0029
                 EEE--TT---HHHHHHH----------- CS
     PF00350   2 avvGsqSaGKSSllnaLlgedilprgpg 29 
                 a++G   +GKS+l+n + g ++   g +
  ABD99837.1 379 AILGRSGSGKSTLANLIRGDRVATEGAI 406
                 799*****************98766654 PP

>> PF04643  Motilin/ghrelin-associated peptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0     0.009        14      12      26 ..     334     348 ..     328     351 .. 0.90

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.009
     PF04643  12 eeeeleiklnAPveI 26 
                 eee+ eikl AP +I
  ABD99837.1 334 EEEKSEIKLIAPYDI 348
                 89************8 PP

>> PF00931  NB-ARC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.0    0.0077        12      22      40 ..     378     396 ..     364     406 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.0077
                 EEEE-------HHHHHHHH CS
     PF00931  22 vglvGmgGvGKttlakqvl 40 
                 +++ G+ G+GK+tla+ + 
  ABD99837.1 378 LAILGRSGSGKSTLANLIR 396
                 789************8775 PP

>> PF04548  AIG1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.2      0.01        17       3      28 ..     378     403 ..     376     447 .. 0.65

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.01
                 EEEE-------HHHHHHH-----SS- CS
     PF04548   3 ivlvGktgnGkSaTgNsilgkkaFes 28 
                 + ++G++g+GkS+ +N i g+++ + 
  ABD99837.1 378 LAILGRSGSGKSTLANLIRGDRVATE 403
                 6689************9988887443 PP

>> PF10662  Ethanolamine utilisation - propanediol utilisation
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.0     0.012        20       3      28 ..     377     402 ..     375     414 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.012
     PF10662   3 killiGkvgaGKTtLtqalkgeelky 28 
                 k+ ++G++g+GK tL++ ++g+++  
  ABD99837.1 377 KLAILGRSGSGKSTLANLIRGDRVAT 402
                 77899**************9988765 PP

>> PF00158  Sigma-54 interaction domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.0    0.0094        15      15      46 ..     368     399 ..     356     415 .. 0.73

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0094
                 HHHHHTS-S-EEEE-------HHHHHHHHHHS CS
     PF00158  15 ikkvaktdltvlitGesGtGKellAraiheas 46 
                 i+  +++  ++ i+G sG+GK++lA++i   +
  ABD99837.1 368 INLDISSGDKLAILGRSGSGKSTLANLIRGDR 399
                 555556667889**************997654 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.5   0.0     0.012        19       3      18 ..     378     393 ..     376     398 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.5 bits;  conditional E-value: 0.012
     PF05729   3 vilqGeaGsGKTtLlq 18 
                 +++ G +GsGK+tL+ 
  ABD99837.1 378 LAILGRSGSGKSTLAN 393
                 6899**********97 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.1     0.014        22      23      50 ..     382     410 ..     373     418 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.014
     PF06414  23 GqpGAGKtslaellleela.agnivrida 50 
                 G  G+GK++la+l++++   ++++++i++
  ABD99837.1 382 GRSGSGKSTLANLIRGDRVaTEGAITING 410
                 899************98767999999885 PP

>> PF03266  Protein of unknown function, DUF265
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.3   0.1     0.014        23       2     105 ..     378     482 ..     377     537 .. 0.63

  Alignments for each domain:
  == domain 1    score: 7.3 bits;  conditional E-value: 0.014
                 EEEE-------HHHHHHHHH.H-....---EE--EEE-----------EEE--.---EEE---TT---SS--------HHH....HHHHHHHHHHHHHH CS
     PF03266   2 vfiTGppgvGKtTlvkkvle.llkse.gvkvgGfyteevreggrrigfdivdlasgergilarvkgkreprvgkyvvnlee....feelalpalrnale 94 
                 ++i G++g+GK+Tl + +   +++ e  ++++G+ +++v   g +i+  i  +   ++ +l +++  ++ r+g+   ++e+    +e+++l+ + +al 
  ABD99837.1 378 LAILGRSGSGKSTLANLIRGdRVATEgAITINGIDVSKV---GDQISNYIGVI--HQTPYLFNTTILNNLRIGNEEATIEQvwqvLERVGLKDMVKALP 471
                 6789**********9988641333332566777655554...55555555555..33344444444566666666666655444455556666666555 PP

                 HH-EEEE---- CS
     PF03266  95 eadviviDEiG 105
                 +    ++DE G
  ABD99837.1 472 QGLETMVDEAG 482
                 55556666666 PP

>> PF01695  IstB-like ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.044        72      44      65 ..     372     393 ..     344     406 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.044
     PF01695  44 veqaenlvllGpsGvGKthlAi 65 
                 + + + l++lG sG GK+ lA 
  ABD99837.1 372 ISSGDKLAILGRSGSGKSTLAN 393
                 5667889*************96 PP

>> PF04077  DsrH like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.026        42      13      52 ..     543     582 ..     537     584 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.026
                 HHH-----EEEE-----GGGB---TTHHHHHH---EEEE- CS
     PF04077  13 lrlleegdsvLLieDgVyaalkgnrflalleeakvklyaL 52 
                 l+ +e+ d+v++ieDg + ++ + ++l++ +e+ +kl a+
  ABD99837.1 543 LQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLKAI 582
                 6678899**************9999999988877777766 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0     0.022        36       3      75 ..     378     438 ..     377     459 .. 0.74

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.022
                 EEEE-E-----HHHHHHHHHHHHH----EEEEEE-SS.-TTSS----CCHHH.H---EEEEEESSCEEEEEEE- CS
     PF03205   3 vlvvGpkdsGKTTliekllnilkergyrvavvkhldvGqgeidkpGkDtwrl.kagadlvlvsieeplalvtgv 75 
                 +++ G ++sGK+Tl   +      rg rva    ++   g i++ G D  ++  + ++++ v  + p ++ t++
  ABD99837.1 378 LAILGRSGSGKSTLANLI------RGDRVA----TE---GAITINGIDVSKVgDQISNYIGVIHQTPYLFNTTI 438
                 5799**********9877......677777....33...36777777777777766666666666666666666 PP

>> PF00437  Type II/IV secretion system protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.015        24     124     158 ..     354     395 ..     304     427 .. 0.73

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.015
     PF00437 124 k.......kklaevlrqavqargnilvsGgTgSGKttllnal 158
                 +       +++ + ++  +++   + + G  gSGK+tl+n +
  ABD99837.1 354 HfryengsREILKGINLDISSGDKLAILGRSGSGKSTLANLI 395
                 04444444888888999999999999************9976 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.028        45       3      18 ..     380     395 ..     378     412 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.028
     PF00910   3 lyGpsgeGKStlakeL 18 
                 + G+sg GKStla+ +
  ABD99837.1 380 ILGRSGSGKSTLANLI 395
                 78***********985 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0     0.024        39       1      25 [.     377     400 ..     377     453 .. 0.76

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.024
                 EEEEE--TT---HHHHHHHH----- CS
     PF08477   1 kvvvvGdkgvGKssllsqlvgeefp 25 
                 k++++G +g+GKs+l + l++++++
  ABD99837.1 377 KLAILGRSGSGKSTL-ANLIRGDRV 400
                 789*********997.455555555 PP

>> PF00735  Septin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.023        37       7      84 ..     378     456 ..     375     464 .. 0.72

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.023
     PF00735   7 lmvvGesglGkttlintlfetdlieeeeeleeaseekkktveikkkkaeieedgvklnltvidtpgfGdaidn.skswk 84 
                 l + G+sg Gk+tl n +   ++ +e   + +  + +k   +i+++  +i++    +n t+++    G++    ++ w+
  ABD99837.1 378 LAILGRSGSGKSTLANLIRGDRVATEGAITINGIDVSKVGDQISNYIGVIHQTPYLFNTTILNNLRIGNEEATiEQVWQ 456
                 6689************888888877755444555566667778888888887777777777777777765433355555 PP

>> PF06898  Putative stage IV sporulation protein YqfD
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   1.2     0.032        51      89     128 ..     166     206 ..     152     210 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.032
     PF06898  89 glvlGillf.villyllSnliWkidiktakneaeeeirkkL 128
                 ++ +G+l+  +i ++l+   iW++ +++a++e e++i+++L
  ABD99837.1 166 SIWMGLLMLlMIGIMLVAFPIWSVIVNGARQEYEKKIKNEL 206
                 56777765415667777788******************998 PP

>> PF03308  ArgK protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.032        51      14      50 ..     360     396 ..     351     416 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.032
                 HHHHHHHHHGGG----EEE--B-------HHHHHH-- CS
     PF03308  14 eakellrkilpkaGralvvGltGvPGaGkstlvekli 50 
                  ++e+l+ i  +      + + G  G+Gkstl + + 
  ABD99837.1 360 GSREILKGINLDISSGDKLAILGRSGSGKSTLANLIR 396
                 6899999999999999***************987654 PP

>> PF01583  Adenylylsulphate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.038        61       7      25 ..     380     398 ..     375     428 .. 0.73

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.038
                 EE-ETT---HHHHHHHHHH CS
     PF01583   7 ltGlsgsGKstiavalekk 25 
                 + G sgsGKst+a+ +   
  ABD99837.1 380 ILGRSGSGKSTLANLIRGD 398
                 6799*********998644 PP

>> PF12038  Domain of unknown function (DUF3524)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0      0.08   1.3e+02     112     140 ..     104     132 ..      96     146 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.08
     PF12038 112 vnltsaLaadavvFNsafnrdsflealre 140
                 v+l+ aL  dav+F s+++  + l  l+e
  ABD99837.1 104 VKLYKALEKDAVFFKSKYQLGDVLGLLSE 132
                 789***************98887766655 PP

>> PF01078  Magnesium chelatase, subunit ChlI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.042        67      14      42 ..     367     395 ..     357     420 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.042
     PF01078  14 aleiaaaGgHnlllvGppGsGKtmlakrl 42 
                  +++ ++ g +l ++G +GsGK+ la+ +
  ABD99837.1 367 GINLDISSGDKLAILGRSGSGKSTLANLI 395
                 5566677788999*************876 PP

>> PF02732  ERCC4 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.063     1e+02     105     170 ..      84     136 ..      80     141 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.063
                 EEEEEEEHHHHHHHH..........................H---HHHHHHHHHH.H.-.....SE CS
     PF02732 105 liverkeladlvasltkalaeapykkkredslaeakkvksgkdgryreqlqqltrvsaaiAaaiva 170
                 + +er ++ ++v  +t++l    yk +              kd  +++ ++ql  v ++ ++ i +
  ABD99837.1  84 HYLERLTSHNWVFKMTSDLRVKLYKAL-------------EKDAVFFKSKYQLGDVLGLLSEDINH 136
                 568999*******************99.............56667999999999988888888777 PP

>> PF05049  Interferon-inducible GTPase (IIGP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.1     0.055        89      37      57 ..     377     397 ..     362     415 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.055
                 EEEEE-------HHHHHHH-- CS
     PF05049  37 kiavtGdsGnGkssFinaLRl 57 
                 k+a+ G sG+Gks+  n +R+
  ABD99837.1 377 KLAILGRSGSGKSTLANLIRG 397
                 689**************9997 PP

>> PF10362  Cytidylyltransferase C-terminal domain (DUF2432)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.38   6.2e+02       4      19 ..     415     432 ..     413     432 .. 0.74

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.38
     PF10362   4 lVPpeIldY..IlneglY 19 
                  V+++I++Y  ++ +++Y
  ABD99837.1 415 KVGDQISNYigVIHQTPY 432
                 699******555566666 PP

>> PF01926  GTPase of unknown function
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.1      0.12     2e+02       1      17 [.     387     403 ..     387     563 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.12
                 --HHHHHHHHCSTTEEE CS
     PF01926   1 GKStLinaltgkakakv 17 
                 GKStL n + g+++a  
  ABD99837.1 387 GKSTLANLIRGDRVATE 403
                 9**********655444 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.1       0.1   1.7e+02       3      19 ..     379     395 ..     377     397 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.1
     PF07728   3 lLvGppGtgKselaerl 19 
                  ++G +G+gKs+la ++
  ABD99837.1 379 AILGRSGSGKSTLANLI 395
                 589**********9876 PP

>> PF08158  NUC130/3NT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0      0.17   2.7e+02      29      43 ..      94     110 ..      86     110 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.17
     PF08158  29 s..vLdsdLRekivksL 43 
                     ++sdLR k+ k+L
  ABD99837.1  94 WvfKMTSDLRVKLYKAL 110
                 25579**********98 PP

>> PF04670  Gtr1/RagA G protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.11   1.7e+02       1      25 [.     377     401 ..     377     423 .. 0.80

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.11
     PF04670   1 klLLmGksgsGKtSmrsiiFsnyla 25 
                 kl ++G+sgsGK+++ + i  + +a
  ABD99837.1 377 KLAILGRSGSGKSTLANLIRGDRVA 401
                 67789*********99988655555 PP

>> PF03413  Peptidase propeptide and YPEB domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0      0.13   2.1e+02       2      27 ..     518     543 ..     517     560 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.13
     PF03413   2 iseeqAlsiAlkalpgkkleveledd 27 
                 ++e++ +si+ ++l++k l+++++ +
  ABD99837.1 518 LTEQEVISIFNRELKDKTLIWITHHL 543
                 89*******************98765 PP

>> PF00071  Ras family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.11   1.9e+02       1      32 [.     377     408 ..     377     421 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.11
                 EEEEE--TT---HHHHHHHHHSSSSTTSTTTS CS
     PF00071   1 KlvlvGdsavGKtslllrfvedkFkeeyesTi 32 
                 Kl ++G s+ GK++l +    d+  +e   Ti
  ABD99837.1 377 KLAILGRSGSGKSTLANLIRGDRVATEGAITI 408
                 899************88766666666666665 PP

>> PF00485  Phosphoribulokinase / Uridine kinase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.1      0.15   2.4e+02       3      20 ..     379     396 ..     378     415 .. 0.87

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.15
                 EE---------THHHHHH CS
     PF00485   3 gvagsSGaGkttvarkle 20 
                 ++ g SG+Gk+t+a+ ++
  ABD99837.1 379 AILGRSGSGKSTLANLIR 396
                 789*********998775 PP

>> PF00006  ATP synthase alpha/beta family, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.13   2.1e+02      13      35 ..     373     395 ..     369     459 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.13
                 xxxxxxxxxxxxxxxxxxxxxxx RF
     PF00006  13 vqGqttlipGafgcGktvisqsl 35 
                   G + +i G +g Gk++++  +
  ABD99837.1 373 SSGDKLAILGRSGSGKSTLANLI 395
                 6799**************98655 PP

>> PF11643  Vasodilator-stimulated phosphoprotein VASP
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.1      0.15   2.4e+02       2      16 ..     278     292 ..     277     293 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.15
     PF11643   2 ggesgglsGLAAALA 16 
                 gg++g+ +GLA  +A
  ABD99837.1 278 GGSNGVYTGLANWIA 292
                 799********7777 PP

>> PF04740  Bacillus transposase protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.2      0.15   2.5e+02     144     167 ..     230     253 ..     197     261 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.15
     PF04740 144 keqlqkakkkiedtlekLeefDqe 167
                  + ++++++k+ d+ ekL+ fDq 
  ABD99837.1 230 VKLHEQNEEKLMDVQEKLHHFDQI 253
                 55678999**************95 PP

>> PF03821  Golgi 4-transmembrane spanning transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.2       0.2   3.2e+02     133     173 ..     229     269 ..     145     312 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.2
     PF03821 133 ylefksmnhmnylPskedllaldfiklllivsvafivvlil 173
                 y + +++n+++ +  +e l + d i+  l+ +v+++vv+ +
  ABD99837.1 229 YVKLHEQNEEKLMDVQEKLHHFDQIRDYLLQLVFMLVVVSF 269
                 66677888888999999999999998888888877777655 PP

>> PF12534  Leucine-rich repeat containing protein 8
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0     0.014        23      12      46 ..     238     272 ..     229     275 .. 0.83

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.014
     PF12534  12 enqvayrllkPWwdvffdYLvllmllvavlagtlq 46 
                 e+ +  +  ++ +d   dYL+ l +++ v++  l+
  ABD99837.1 238 EKLMDVQEKLHHFDQIRDYLLQLVFMLVVVSFILW 272
                 666667778999******************99888 PP

>> PF06175  tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.31     5e+02     110     124 ..     243     257 ..     224     268 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.31
     PF06175 110 ikeelehfeqvlell 124
                 ++e l+hf q+++ l
  ABD99837.1 243 VQEKLHHFDQIRDYL 257
                 699********9987 PP

>> PF02404  Stem cell factor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.32   5.2e+02      61      88 ..      86     113 ..      80     137 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.32
     PF02404  61 mdvlpshcwlremveelsvsltnlldkf 88 
                 ++ l sh w+ +m ++l v l + l+k 
  ABD99837.1  86 LERLTSHNWVFKMTSDLRVKLYKALEKD 113
                 56799******************99984 PP

>> PF04526  Protein of unknown function (DUF568)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.29   4.6e+02      53      74 ..     436     457 ..     399     468 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.29
     PF04526  53 vtifatlklpsnstkvnqvWqv 74 
                  ti  +l++ +++ +++qvWqv
  ABD99837.1 436 TTILNNLRIGNEEATIEQVWQV 457
                 5788999999***********7 PP

>> PF01601  Coronavirus S2 glycoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.4      0.22   3.6e+02     538     571 ..     144     177 ..      99     211 .. 0.79

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 0.22
                 ---------------------------------- CS
     PF01601 538 nrvetyiKWpWyvWLaiilalvalvllllfills 571
                   + t++ W  yv+++i++++  + + ll++l++
  ABD99837.1 144 TIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMI 177
                 567799************9988877766665543 PP

>> PF11023  Protein of unknown function (DUF2614)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.4   0.0      0.51   8.3e+02      31      67 ..      20      56 ..      15      60 .. 0.84
   2 ?    1.3   2.9       1.1   1.8e+03       5      57 ..     131     183 ..     129     196 .. 0.65
   3 ?    2.1   0.0      0.65     1e+03       8      28 ..     250     270 ..     244     310 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.4 bits;  conditional E-value: 0.51
     PF11023 31 lfkeseiilvillllglllviastvvyfwigllstka 67
                ++k+ +  lv+++ lg+l+   + ++ f  g l  ++
  ABD99837.1 20 FLKKYKKTLVLAIFLGILTFFCAGALMFNSGYLISRS 56
                7889999999999********9999999999876664 PP

  == domain 2    score: 1.3 bits;  conditional E-value: 1.1
     PF11023   5 sskinkirtfalslvfvgllvmyvgilfkeseiilvillllglllviastvvy 57 
                 s+ in+i+++ l  +f  ++   + +++     i++i + l +ll+i    v 
  ABD99837.1 131 SEDINHIQNLYLRTIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMIGIMLVA 183
                 56799999999999998887766666665555555555555444444444443 PP

  == domain 3    score: 2.1 bits;  conditional E-value: 0.65
     PF11023   8 inkirtfalslvfvgllvmyv 28 
                  ++ir + l+lvf+ ++v ++
  ABD99837.1 250 FDQIRDYLLQLVFMLVVVSFI 270
                 6799*********99887664 PP

>> PF07693  KAP family P-loop domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.43     7e+02      30      41 ..     385     396 ..     371     437 .. 0.90

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.43
     PF07693  30 GsGKssllnlle 41 
                 GsGKs+l nl++
  ABD99837.1 385 GSGKSTLANLIR 396
                 9*********98 PP

>> PF01573  Bromovirus movement protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.0       0.4   6.5e+02      78      95 ..      61      78 ..      57      85 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.4
     PF01573 78 avIyllYiPvILktTsav 95
                 +I l+Y+P++L  + +v
  ABD99837.1 61 ENILLVYVPIVLTRAFGV 78
                5899********998886 PP

>> PF00503  G-protein alpha subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.1      0.31   4.9e+02      29      46 ..     376     393 ..     361     399 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.31
                 EEEEEE-------HHHHH CS
     PF00503  29 vklLLLGagesGKsTivK 46 
                  kl +LG + sGKsT+  
  ABD99837.1 376 DKLAILGRSGSGKSTLAN 393
                 5999***********975 PP

>> PF00638  RanBP1 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.2      0.57   9.2e+02       2      25 ..     230     253 ..     229     256 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.57
                 ---S-TTEEEEEEE--EEEEEETT CS
     PF00638   2 vksgEEdEevlfkqraKLfrfdae 25 
                 vk  E +Ee l  ++ KL +fd+ 
  ABD99837.1 230 VKLHEQNEEKLMDVQEKLHHFDQI 253
                 6788*****************986 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.49   7.9e+02       1      14 [.     380     393 ..     380     401 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.49
     PF03029   1 vvGpaGsGKttfvg 14 
                 ++G  GsGK+t+ +
  ABD99837.1 380 ILGRSGSGKSTLAN 393
                 6899*******976 PP

>> PF03303  WTF protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   1.9      0.25     4e+02     113     205 ..     113     206 ..     102     223 .. 0.64

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.25
     PF03303 113 kavFkkyaakewvlfGlwcl.icllllilllyfyEtWtkavkvtvivigvGlknirkklvviiwllwlilclilfgavksgdlnlnkalllsrl 205
                 +avF k   +   ++Gl +  i+ +  + l +++ t++     + ivigvG+++i   l + +++ ++++ + +  ++ +g+ +  ++++ ++l
  ABD99837.1 113 DAVFFKSKYQLGDVLGLLSEdINHIQNLYLRTIFPTFVAWGLYVFIVIGVGIFSIWMGLLMLLMIGIMLVAFPIWSVIVNGARQEYEKKIKNEL 206
                 5555555554445677766668877777777777777776677889*********966555555544455555555555555555555555544 PP

>> PF07589  PEP-CTERM motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   2.1       1.1   1.7e+03       8      20 ..     172     184 ..     170     188 .. 0.83

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 1.1
     PF07589   8 laLlglGLaglga 20 
                 l+Ll++G++++++
  ABD99837.1 172 LMLLMIGIMLVAF 184
                 89********999 PP

>> PF10917  Protein of unknown function (DUF2708)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.1      0.28   4.5e+02       8      31 ..     261     285 ..     258     289 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.28
     PF10917   8 vFavLaissvsggGkrCgggng.YG 31 
                 vF   ++s+   gG   gg+ng Y 
  ABD99837.1 261 VFMLVVVSFILWGGTYLGGSNGvYT 285
                 9*********************995 PP

>> PF01331  mRNA capping enzyme, catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.61   9.9e+02     138     192 .]     526     580 ..     517     580 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.61
                 SSEEEE---EECCGHHHHHHHCCHHHTTS-B---EEEESSS-------TTEEE-- CS
     PF01331 138 pfkvrlksfilllalekllskkkikklsheiDGLIfqsvdtpYvagrdknllKWK 192
                  f+  lk+  l++ +++l   + ++++++  DG I ++    Y+ ++++   K+K
  ABD99837.1 526 IFNRELKDKTLIWITHHLQGVEAMDQVIFIEDGTIEMQGSPDYLRKTNERYQKLK 580
                 6777889999999999999*****************999999***9999988887 PP

>> PF06624  Ribosome associated membrane protein RAMP4
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   2.1     0.086   1.4e+02      43      57 ..     153     167 ..     148     171 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.086
     PF06624  43 glFiFVViGSaifqi 57 
                 gl++F+ViG  if i
  ABD99837.1 153 GLYVFIVIGVGIFSI 167
                 9************98 PP

>> PF04030  D-arabinono-1,4-lactone oxidase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.1       1.8   2.9e+03     220     244 ..     231     255 ..     226     257 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.8
     PF04030 220 KnftltaeeleelYpdlkeflkvRk 244
                 K + +++e+l ++ ++l++f ++R+
  ABD99837.1 231 KLHEQNEEKLMDVQEKLHHFDQIRD 255
                 99**********************7 PP

>> PF06417  Protein of unknown function (DUF1077)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.5   3.5       2.8   4.6e+03      27      51 ..     166     190 ..     161     193 .. 0.89

  Alignments for each domain:
  == domain 1    score: -0.5 bits;  conditional E-value: 2.8
     PF06417  27 slpMnlfmmYmsGnslqIfsimmvl 51 
                 s+ M l+m+ m G +l  f+i  v+
  ABD99837.1 166 SIWMGLLMLLMIGIMLVAFPIWSVI 190
                 799******************8775 PP

>> PF04728  Repeated sequence found in lipoprotein LPP
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.1       1.5   2.4e+03       5       9 ..     418     422 ..     417     422 .. 0.97

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 1.5
     PF04728   5 DQLSn 9  
                 DQ+Sn
  ABD99837.1 418 DQISN 422
                 9***9 PP

>> PF07850  Renin receptor-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   5.4       6.8   1.1e+04      54      79 ..     164     189 ..     157     192 .. 0.94

  Alignments for each domain:
  == domain 1    score: -0.6 bits;  conditional E-value: 6.8
     PF07850  54 iFniilwlvvilvlalivisvalasm 79 
                 iF+i+++l++ l + ++++++ ++s+
  ABD99837.1 164 IFSIWMGLLMLLMIGIMLVAFPIWSV 189
                 9**********************985 PP

>> PF09976  Uncharacterized protein conserved in bacteria (DUF2133)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.1     0.057        93       7      28 ..      18      39 ..      17      40 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.057
     PF09976  7 kawWkryGkwiivgavlalagv 28
                k ++k+y k+++ ++ l+++ +
  ABD99837.1 18 KPFLKKYKKTLVLAIFLGILTF 39
                6699**************9976 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (586 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       736  (0.0617864); expected 238.2 (0.02)
Passed bias filter:                      399  (0.0334956); expected 238.2 (0.02)
Passed Vit filter:                        64  (0.00537273); expected 11.9 (0.001)
Passed Fwd filter:                        64  (0.00537273); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              62  [number of targets reported over threshold]
# CPU time: 0.42u 0.10s 00:00:00.52 Elapsed: 00:00:01
# Mc/sec: 3012.18
//