# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_16637.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABE00427.1  [L=248]
Description: lsal0 ABE00427.1 GIB00337CH01 "Amino acid ABC transporter, ATP-binding protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
      2e-24   88.9   0.1    4.9e-24   87.6   0.0    1.6  1  PF00005  ABC transporter
    1.2e-08   37.2   0.7      1e-07   34.1   0.5    2.0  1  PF02463  RecF/RecN/SMC N terminal domain
    0.00021   23.7   1.3    0.00023   23.6   0.2    1.5  1  PF01637  Archaeal ATPase
    0.00023   23.0   0.0    0.00035   22.4   0.0    1.3  1  PF03193  Protein of unknown function, DUF258
  ------ inclusion threshold ------
      0.028   17.2   0.0       0.32   13.8   0.0    2.2  2  PF00910  RNA helicase
       0.13   14.3   0.5        5.9    8.9   0.0    2.7  2  PF01695  IstB-like ATP binding protein
       0.18   13.7   0.1         11    7.9   0.0    2.2  2  PF04665  Poxvirus A32 protein
        0.2   12.9   0.0        8.1    7.6   0.0    2.3  2  PF09818  Predicted ATPase of the ABC class
       0.25   13.6   0.1       0.75   12.1   0.0    1.8  1  PF05729  NACHT domain
       0.31   13.1   2.5        1.5   10.8   0.1    2.5  2  PF00625  Guanylate kinase
       0.32   13.5   0.4         64    6.0   0.1    2.3  2  PF04851  Type III restriction enzyme, res subunit
       0.39   12.8   0.1       0.75   11.8   0.0    1.4  1  PF00488  MutS domain V
       0.43   12.9   0.1        1.8   10.9   0.0    2.0  1  PF07728  AAA domain (dynein-related subfamily)
       0.44   12.7   0.3        1.6   10.8   0.1    1.9  1  PF01580  FtsK/SpoIIIE family
       0.56   11.6   0.0       0.96   10.8   0.0    1.4  1  PF03215  Rad17 cell cycle checkpoint protein
       0.57   12.6   0.0        1.4   11.4   0.0    1.7  1  PF03205  Molybdopterin guanine dinucleotide synthesis protei
        0.7   12.0   0.0        1.3   11.1   0.0    1.5  1  PF02492  CobW/HypB/UreG, nucleotide-binding domain
        1.1   11.0   0.0        1.8   10.3   0.0    1.3  1  PF06414  Zeta toxin
        1.5   10.4   0.0        2.1    9.9   0.0    1.2  1  PF00735  Septin
        1.5   12.0   0.0        3.7   10.7   0.0    1.6  1  PF08477  Miro-like protein
          2   10.1   0.2         29    6.3   0.0    2.0  2  PF00503  G-protein alpha subunit
        2.3   10.4   0.0        4.3    9.5   0.0    1.5  1  PF03029  Conserved hypothetical ATP binding protein
        2.4    9.6   0.1        4.7    8.7   0.1    1.4  1  PF00437  Type II/IV secretion system protein
        2.4    9.9   0.0        5.1    8.9   0.0    1.6  1  PF01078  Magnesium chelatase, subunit ChlI
        2.6   10.4   0.0        4.1    9.7   0.0    1.2  1  PF04338  Protein of unknown function, DUF481
        3.1    9.6   0.0         11    7.8   0.0    1.8  1  PF02562  PhoH-like protein
        3.2   10.6   0.1         24    7.8   0.0    2.2  2  PF00004  ATPase family associated with various cellular acti
        5.3    9.1   0.0         11    8.1   0.0    1.5  1  PF05272  Virulence-associated protein E
        5.6    8.2   0.0         12    7.2   0.0    1.5  1  PF08298  PrkA AAA domain
        6.4    8.0   0.0        9.7    7.4   0.0    1.2  1  PF10412  Type IV secretion-system coupling protein DNA-bindi
          7    8.8   0.0         15    7.7   0.0    1.5  1  PF10662  Ethanolamine utilisation - propanediol utilisation
        7.1    8.2   0.0         15    7.1   0.0    1.5  1  PF10236  Mitochondrial ribosomal death-associated protein 3
        7.7    8.6   0.0         15    7.7   0.0    1.4  1  PF00158  Sigma-54 interaction domain
        8.6    7.8   0.0         19    6.7   0.0    1.6  1  PF00931  NB-ARC domain
        8.7    7.9   0.2         57    5.2   0.0    2.1  1  PF05673  Protein of unknown function (DUF815)
         11    7.2   0.0         20    6.3   0.0    1.4  1  PF02456  Adenovirus IVa2 protein
         12    7.6   0.2         62    5.3   0.0    2.2  1  PF04548  AIG1 family
         13    7.9   0.0         24    7.0   0.0    1.3  1  PF00006  ATP synthase alpha/beta family, nucleotide-binding 
         13    8.1   0.0         30    6.9   0.0    1.5  1  PF02367  Uncharacterised P-loop hydrolase UPF0079
         15    8.0   0.1         43    6.5   0.0    1.7  1  PF00350  Dynamin family
         16    7.3   0.0         36    6.2   0.0    1.6  1  PF09439  Signal recognition particle receptor beta subunit
         19    6.4   0.0         38    5.4   0.0    1.4  1  PF00519  Papillomavirus helicase
         19    7.8   0.3    1.8e+02    4.7   0.0    2.5  1  PF08140  Crustacean cuticle protein repeat
         27    6.1   0.0         48    5.3   0.0    1.4  1  PF03308  ArgK protein
         28    6.6   0.0         52    5.8   0.0    1.4  1  PF11101  Protein of unknown function (DUF2884)
         29    6.4   0.2         58    5.4   0.1    1.5  1  PF04670  Gtr1/RagA G protein conserved region
         34    6.6   0.0         49    6.0   0.0    1.4  1  PF00485  Phosphoribulokinase / Uridine kinase family
         36    6.0   0.0         81    4.9   0.0    1.5  1  PF06745  KaiC
         39    6.4   0.0         67    5.6   0.0    1.5  1  PF01443  Viral (Superfamily 1) RNA helicase
         42    7.2   0.4    1.1e+02    6.0   0.0    1.9  1  PF02415  Chlamydia polymorphic membrane protein (Chlamydia_P
         43    4.6   0.0         68    3.9   0.0    1.2  1  PF07781  Reovirus minor core protein Mu-2
         48    6.0   0.0         90    5.1   0.0    1.4  1  PF00448  SRP54-type protein, GTPase domain
         49    6.7   0.0         90    5.8   0.0    1.4  1  PF11655  Protein of unknown function (DUF2589)
         50    5.9   0.0         62    5.6   0.0    1.2  1  PF00848  Ring hydroxylating alpha subunit (catalytic domain)
         68    4.2   0.0      1e+02    3.6   0.0    1.2  1  PF04184  ST7 protein
         69    5.7   0.0    1.3e+02    4.9   0.0    1.4  1  PF01583  Adenylylsulphate kinase
         70    5.0   0.0    1.6e+02    3.8   0.0    1.6  1  PF03668  P-loop ATPase protein family
         83    4.0   0.1    1.3e+02    3.3   0.0    1.2  1  PF04130  Spc97 / Spc98 family
         88    5.4   0.3    1.8e+02    4.4   0.0    1.6  1  PF03266  Protein of unknown function, DUF265
         99    4.1   0.0    1.8e+02    3.2   0.0    1.3  1  PF01328  Peroxidase, family 2
    1.1e+02    5.1   0.2    2.2e+02    4.1   0.1    1.5  1  PF02344  Myc leucine zipper domain
    1.1e+02    4.9   0.0    2.2e+02    4.0   0.0    1.3  1  PF09005  Domain of unknown function (DUF1897)
    1.4e+02    4.8   0.1    4.1e+02    3.3   0.1    1.7  1  PF01935  Domain of unknown function DUF87
    1.9e+02    4.0   0.0    3.6e+02    3.1   0.0    1.4  1  PF00071  Ras family
    2.2e+02    3.6   0.1    4.6e+02    2.6   0.1    1.4  1  PF06048  Domain of unknown function (DUF927)
    2.3e+02    3.9   0.0    4.3e+02    3.1   0.0    1.3  1  PF07931  Chloramphenicol phosphotransferase-like protein
    2.4e+02    3.7   0.0    4.6e+02    2.8   0.0    1.4  1  PF04846  Herpesvirus pp38 phosphoprotein
    2.5e+02    3.7   0.0    5.7e+02    2.5   0.0    1.5  1  PF02800  Glyceraldehyde 3-phosphate dehydrogenase, C-termina
    2.8e+02    3.3   0.0    4.8e+02    2.5   0.0    1.2  1  PF05571  Protein of unknown function (DUF766)
    3.6e+02    2.8   0.0    5.9e+02    2.1   0.0    1.3  1  PF07760  Protein of unknown function (DUF1616)
    4.3e+02    2.3   0.0    7.1e+02    1.6   0.0    1.2  1  PF11602  ATPase P4 of dsRNA bacteriophage phi-12
    5.4e+02    3.6   0.4    1.4e+03    2.2   0.2    1.6  1  PF01473  Putative cell wall binding repeat
    5.6e+02    2.2   0.0    6.6e+02    1.9   0.0    1.2  1  PF11991  Tryptophan dimethylallyltransferase
      7e+02    2.5   0.0    9.2e+02    2.1   0.0    1.1  1  PF08648  Protein of unknown function (DUF1777)


Domain and alignment annotation for each model:
>> PF00005  ABC transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.6   0.0   3.6e-27   4.9e-24       1     118 []      41     169 ..      41     169 .. 0.90

  Alignments for each domain:
  == domain 1    score: 87.6 bits;  conditional E-value: 3.6e-27
                 HHHHHHHTTSS------EEE-......--BGGGB-HHHHH..EEEE-------.--BHHHHHH----S--.......-HHHHHHHHHH---HHHH---- CS
                 xxxxxxxxxxxxxxxxxxxxxx....xxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxx.......xxxxxxxxxxxxxxxxxxxxxx RF
     PF00005   1 STLlklltgelkptegeievdn....drkdlesdkleklr..igyipqdpllfpeltvrenldmakeekk.......tdkrieevlekvgldelldksr 86 
                 ST l+ l  ++ p++g+ ++d+     +k+++++++ ++r   ++++q+ +lfp+ltv +n+  + + +        ++kr++e+l+kvgl +++d  +
  ABE00427.1  41 STMLRSLNLLEMPESGKYYFDDleldFKKGISKKEILEVRreTEMVFQNYNLFPHLTVLKNIIEG-PVHVlkedkesATKRAYELLKKVGLADKADA-Y 137
                 9********************77997666777899999999*****************9998533.33236777789********************.* PP

                 --------HHHHHHHHHHTT--SEEEEESTTT CS
                 xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00005  87 vstLSgGqkqrvalArallkkpklllLDEPtn 118
                 +++LSgGq+qrva+Ar+l+ +p+ +lLDEPt+
  ABE00427.1 138 PQQLSGGQAQRVAIARSLAMNPRYILLDEPTS 169
                 ******************************96 PP

>> PF02463  RecF/RecN/SMC N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   34.1   0.5   7.5e-11     1e-07      16     207 ..      18     209 ..       9     218 .. 0.71

  Alignments for each domain:
  == domain 1    score: 34.1 bits;  conditional E-value: 7.5e-11
                 -EE------.SEEEE--------HHHHHHHHHH------.-------TTSS--..--------EEEEEEEEE----E.......EEEEEEEE----EEE CS
                 xxxxxxxxx.xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx..xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF02463  16 ktvilpfsk.sftaivGpNGSGKsnvldAilFvLGeksakklrseklsdlihk..skskakvksaeveitfdnedkelvieeeevsitrrvkrkgesey 111
                 k +++ f++ + t++vGp GSGKs +l ++  +L   ++ k   ++l+   +k  sk++    + e e++f+n +       +++++ +++ +    ++
  ABE00427.1  18 KDITTTFENnQTTVLVGPSGSGKSTMLRSL-NLLEMPESGKYYFDDLELDFKKgiSKKEILEVRRETEMVFQNYNLF-----PHLTVLKNIIEGPV-HV 109
                 566677765156789***************.5666666655555555544444444455555566788899998887.....77777777776555.55 PP

                 EE---EE-HHHHHHHHHCTT--TT......G-----HHHHHHHHHHHHHTSS--SEEEESSTTTT--HHHHHHHHHHHHHH-BTBEE.EEE-S-HHHHT CS
                 xxxxxxxxxxxxxxxxxxxxxxxx......xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx.xxxxxxxxxxx RF
     PF02463 112 kingkevtkkevaellesagiske......lLSgGektLvalaLlfAiqkvkpaplyllDeidaaLDeknvskvaellkeksknaQf.ivislreemle 203
                   ++ke   k   ell+++g+  +      +LSgG+ + va+a  +A++        llDe  +aLD +   +v ++l +  k+ Q  i+++++  + +
  ABE00427.1 110 LKEDKESATKRAYELLKKVGLADKadaypqQLSGGQAQRVAIARSLAMNPR----YILLDEPTSALDPELELEVLKVLLQLAKEKQSlIIVTHNLAFAQ 204
                 555666666666789999998777777777*************99998643....4589**********999999999999999886155566655555 PP

                 T-.SE CS
                 xx.xx RF
     PF02463 204 ka.dk 207
                 k+ dk
  ABE00427.1 205 KVaDK 209
                 43354 PP

>> PF01637  Archaeal ATPase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.6   0.2   1.7e-07   0.00023       7     114 ..      16     126 ..      14     134 .. 0.65

  Alignments for each domain:
  == domain 1    score: 23.6 bits;  conditional E-value: 1.7e-07
                 HHHHHHHHHHH..-SEEEEE--TT---HHHHHHHHHH-..---HHHHH------HHHHHHHH....HHHS-SHHHH............HHHHT....-- CS
     PF01637   7 ELkeleeilerepnsiiviyGprrsGKTaLlkeileelkekgkrvvyyinlreefeskleefieeeeekkklakal............gialpkaelee 93 
                 +Lk + +  e+  n+ +v+ Gp +sGK+++l+ +l+ l+ ++  + y+++l+ +f++ ++++ e  e++++ +  +            ++ +       
  ABE00427.1  16 ALKDITTTFEN--NQTTVLVGPSGSGKSTMLR-SLNLLEMPESGKYYFDDLELDFKKGISKK-EILEVRRETEMVFqnynlfphltvlKNII------- 103
                 67888888888..899*************998.68999999******************999.43333333333334444544433332222....... PP

                 ---....TS-GG.G--HHHHHHHHH CS
     PF01637  94 ilk....kksklvflaleellealk 114
                   +      +++ ++a ++++e lk
  ABE00427.1 104 --EgpvhVLKEDKESATKRAYELLK 126
                 ..12332333333444444444444 PP

>> PF03193  Protein of unknown function, DUF258
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   22.4   0.0   2.6e-07   0.00035      25      56 ..      16      48 ..       5      86 .. 0.86

  Alignments for each domain:
  == domain 1    score: 22.4 bits;  conditional E-value: 2.6e-07
                T-HHHHHHCTT.SBEEEE-------HHHHHHH- CS
     PF03193 25 gleelaellkd.ktsvlvGqSGvGKSsLinall 56
                +l+++++++++ +t+vlvG+SG GKS+++ +l+
  ABE00427.1 16 ALKDITTTFENnQTTVLVGPSGSGKSTMLRSLN 48
                567888889888*****************9986 PP

>> PF00910  RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   13.8   0.0   0.00024      0.32       2      52 ..      31      76 ..      30     114 .. 0.85
   2 ?    0.9   0.0       2.4   3.2e+03      18      46 ..     202     230 ..     197     236 .. 0.86

  Alignments for each domain:
  == domain 1    score: 13.8 bits;  conditional E-value: 0.00024
     PF00910  2 wlyGpsgeGKStlakeLakallkklklkkkdsvysrnpeddfwdgYtgqev 52
                +l+Gpsg GKSt+ ++     l+ l++++++++y+   e df +g +++e+
  ABE00427.1 31 VLVGPSGSGKSTMLRS-----LNLLEMPESGKYYFDDLELDFKKGISKKEI 76
                689*************.....444578999999999999999888887766 PP

  == domain 2    score: 0.9 bits;  conditional E-value: 2.4
     PF00910  18 Lakallkklklkkkdsvysrnpeddfwdg 46 
                 +a+++++k+ + +++++ +++p+ddf+++
  ABE00427.1 202 FAQKVADKILFVEDGQILFQGPKDDFFNS 230
                 67889999999999************975 PP

>> PF01695  IstB-like ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0044       5.9      45      64 ..      25      44 ..      16      60 .. 0.84
   2 ?    2.4   0.0      0.43   5.8e+02     108     153 ..     158     204 ..     122     209 .. 0.71

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0044
     PF01695 45 eqaenlvllGpsGvGKthlA 64
                e+++  vl+GpsG GK+ + 
  ABE00427.1 25 ENNQTTVLVGPSGSGKSTML 44
                678999**********9765 PP

  == domain 2    score: 2.4 bits;  conditional E-value: 0.43
     PF01695 108 kvdllilDdlgllplseeeakllfellskryerrsi.iltsnlpfse 153
                 + + + lD+ + +   e e ++l  ll+ + e++s+ i+t nl+f++
  ABE00427.1 158 NPRYILLDEPTSALDPELELEVLKVLLQLAKEKQSLiIVTHNLAFAQ 204
                 44667778776554444455555556677888888615688998875 PP

>> PF04665  Poxvirus A32 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.9   0.0    0.0081        11      16      33 ..      30      47 ..      20      61 .. 0.81
   2 ?    3.8   0.0      0.14   1.9e+02     179     238 ..     177     238 ..     163     241 .. 0.77

  Alignments for each domain:
  == domain 1    score: 7.9 bits;  conditional E-value: 0.0081
     PF04665 16 lalvggsGsGKttyLlsl 33
                 +lvg sGsGK t L+sl
  ABE00427.1 30 TVLVGPSGSGKSTMLRSL 47
                689************998 PP

  == domain 2    score: 3.8 bits;  conditional E-value: 0.14
     PF04665 179 lkvvsllrsae.kkrkvliiedsv.faegelricydsaDesviakkldlsillkqfshmkkk 238
                 l+v+++l +   +k+ ++i+  ++ fa++ +  ++ ++D + + +    + + ++  ++k+ 
  ABE00427.1 177 LEVLKVLLQLAkEKQSLIIVTHNLaFAQKVADKILFVEDGQILFQGPKDDFFNSDNQRIKNF 238
                 67888887776466667777666449999999999999999999988888888887777765 PP

>> PF09818  Predicted ATPase of the ABC class
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.0      0.15     2e+02     247     265 ..      30      48 ..      24      51 .. 0.90
   2 ?    7.6   0.0     0.006       8.1     321     352 ..     139     170 ..     130     217 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.15
     PF09818 247 tlIvGggyhGKsTLLeAle 265
                 t++vG    GKsT+L++l+
  ABE00427.1  30 TVLVGPSGSGKSTMLRSLN 48 
                 899*************986 PP

  == domain 2    score: 7.6 bits;  conditional E-value: 0.006
     PF09818 321 edASGStsqAanimealeagakllLiDEDtsA 352
                 ++ SG   q ++i+++l ++ +++L+DE tsA
  ABE00427.1 139 QQLSGGQAQRVAIARSLAMNPRYILLDEPTSA 170
                 6779***************************9 PP

>> PF05729  NACHT domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   12.1   0.0   0.00055      0.75       2      20 ..      29      47 ..      28      53 .. 0.90

  Alignments for each domain:
  == domain 1    score: 12.1 bits;  conditional E-value: 0.00055
     PF05729  2 tvilqGeaGsGKTtLlqkl 20
                t +l+G++GsGK+t+l++l
  ABE00427.1 29 TTVLVGPSGSGKSTMLRSL 47
                789*************998 PP

>> PF00625  Guanylate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.8   0.1    0.0011       1.5       3      22 ..      28      47 ..      26      57 .. 0.85
   2 ?    1.8   0.1      0.67   9.1e+02      50      73 ..      57      81 ..      51      91 .. 0.75

  Alignments for each domain:
  == domain 1    score: 10.8 bits;  conditional E-value: 0.0011
                --EEEE------HHHHHHHH CS
     PF00625  3 rpivlvGpsgvGkstlkkaL 22
                ++ vlvGpsg+Gkst+   L
  ABE00427.1 28 QTTVLVGPSGSGKSTMLRSL 47
                689*************9876 PP

  == domain 2    score: 1.8 bits;  conditional E-value: 0.67
                -EEE-.-HHHHHHHHHTT-ECEEEE CS
     PF00625 50 dYfFv.skeelekdisaneflEaae 73
                 Y+F   +  ++k is++e+lE  +
  ABE00427.1 57 KYYFDdLELDFKKGISKKEILEVRR 81
                4777725558************865 PP

>> PF04851  Type III restriction enzyme, res subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.048        64      11      44 ..      16      46 ..       6     134 .. 0.88
   2 ?    6.0   0.1     0.047        64      45      80 ..     202     235 ..     183     246 .. 0.77

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.048
                HHHHHT.......TTT---EEE------HHHHHH CS
     PF04851 11 aienllesiekedekkrglivmaTGtGKTlvaas 44
                a++++   +e++   +  ++v + G+GK+ ++ s
  ABE00427.1 16 ALKDITTTFENN---QTTVLVGPSGSGKSTMLRS 46
                667777777777...999***********99876 PP

  == domain 2    score: 6.0 bits;  conditional E-value: 0.047
                 HHHHH-S-EEEEESSHHHHHHHHHH------T...T CS
     PF04851  45 liarlarkflflvprkelleqaleefkkfeskkief 80 
                 +++++a k+lf+ ++++l +  +++f  f+s++  +
  ABE00427.1 202 FAQKVADKILFVEDGQILFQGPKDDF--FNSDNQRI 235
                 5556666*******************..55554443 PP

>> PF00488  MutS domain V
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.8   0.0   0.00055      0.75      30      65 ..      15      50 ..       4      58 .. 0.81

  Alignments for each domain:
  == domain 1    score: 11.8 bits;  conditional E-value: 0.00055
                ---EEEEECTTSS.EEEEE--TT---HHHHHHHHHH CS
     PF00488 30 fvaNdveleeeksrlllitGpNmgGKStylrqvali 65
                    d++ + e+++ +++ Gp  +GKSt+lr+  l+
  ABE00427.1 15 LALKDITTTFENNQTTVLVGPSGSGKSTMLRSLNLL 50
                55567888888889*****************98876 PP

>> PF07728  AAA domain (dynein-related subfamily)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.9   0.0    0.0014       1.8       3      19 ..      31      47 ..      29      58 .. 0.90

  Alignments for each domain:
  == domain 1    score: 10.9 bits;  conditional E-value: 0.0014
     PF07728  3 lLvGppGtgKselaerl 19
                +LvGp+G+gKs++ ++l
  ABE00427.1 31 VLVGPSGSGKSTMLRSL 47
                8************9987 PP

>> PF01580  FtsK/SpoIIIE family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.8   0.1    0.0012       1.6      35      58 ..      24      47 ..       7      52 .. 0.81

  Alignments for each domain:
  == domain 1    score: 10.8 bits;  conditional E-value: 0.0012
                GGGS-SEEEE-----------HHH CS
     PF01580 35 lvkaphlLiaGatgsGKStflrtL 58
                + ++  ++ +G +gsGKSt+lr+L
  ABE00427.1 24 FENNQTTVLVGPSGSGKSTMLRSL 47
                4555568899************98 PP

>> PF03215  Rad17 cell cycle checkpoint protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.8   0.0   0.00071      0.96      41      66 ..      25      48 ..      15      80 .. 0.80

  Alignments for each domain:
  == domain 1    score: 10.8 bits;  conditional E-value: 0.00071
     PF03215 41 esakkrillltGPsGcgKsTtvkvls 66
                e++  +   l GPsG+gKsT ++ l 
  ABE00427.1 25 ENN--QTTVLVGPSGSGKSTMLRSLN 48
                444..456789**********99886 PP

>> PF03205  Molybdopterin guanine dinucleotide synthesis protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.4   0.0     0.001       1.4       4      20 ..      31      47 ..      28      69 .. 0.87

  Alignments for each domain:
  == domain 1    score: 11.4 bits;  conditional E-value: 0.001
                EEE-E-----HHHHHHH CS
     PF03205  4 lvvGpkdsGKTTliekl 20
                + vGp++sGK+T++++l
  ABE00427.1 31 VLVGPSGSGKSTMLRSL 47
                68*************98 PP

>> PF02492  CobW/HypB/UreG, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   11.1   0.0   0.00094       1.3       2      20 ..      29      47 ..      28      87 .. 0.92

  Alignments for each domain:
  == domain 1    score: 11.1 bits;  conditional E-value: 0.00094
                EEEEE-------HHHHHHH CS
     PF02492  2 vtvltGflGsGKTtLlekl 20
                +tvl+G+ GsGK+t+l++l
  ABE00427.1 29 TTVLVGPSGSGKSTMLRSL 47
                699*************976 PP

>> PF06414  Zeta toxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.3   0.0    0.0014       1.8      12      36 ..      22      47 ..      14      58 .. 0.79

  Alignments for each domain:
  == domain 1    score: 10.3 bits;  conditional E-value: 0.0014
     PF06414 12 eq.ekpkavllgGqpGAGKtslaell 36
                ++ e+ +  +l+G+ G+GK+++++ l
  ABE00427.1 22 TTfENNQTTVLVGPSGSGKSTMLRSL 47
                344888999************98876 PP

>> PF00735  Septin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.9   0.0    0.0016       2.1       6      36 ..      29      59 ..      25     106 .. 0.67

  Alignments for each domain:
  == domain 1    score: 9.9 bits;  conditional E-value: 0.0016
     PF00735  6 tlmvvGesglGkttlintlfetdlieeeeel 36
                t ++vG sg Gk+t++++l   ++ e+ + +
  ABE00427.1 29 TTVLVGPSGSGKSTMLRSLNLLEMPESGKYY 59
                66899**************888877775333 PP

>> PF08477  Miro-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.7   0.0    0.0027       3.7       3      26 ..      31      60 ..      30      99 .. 0.66

  Alignments for each domain:
  == domain 1    score: 10.7 bits;  conditional E-value: 0.0027
                EEE--TT---HHHHHHHH-----....... CS
     PF08477  3 vvvGdkgvGKssllsqlvgeefp......k 26
                v+vG +g+GKs++l++l   e+p       
  ABE00427.1 31 VLVGPSGSGKSTMLRSLNLLEMPesgkyyF 60
                799**************9999994443331 PP

>> PF00503  G-protein alpha subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.021        29      22      51 ..      21      50 ..       7      52 .. 0.81
   2 ?    2.5   0.0       0.3     4e+02     142     182 ..      50      88 ..      45      97 .. 0.78

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.021
                HHHHHEEEEEEEE-------HHHHHHHHHH CS
     PF00503 22 kkkekkevklLLLGagesGKsTivKQmkii 51
                 ++ +++    L G + sGKsT+++ + ++
  ABE00427.1 21 TTTFENNQTTVLVGPSGSGKSTMLRSLNLL 50
                556677777889************998876 PP

  == domain 2    score: 2.5 bits;  conditional E-value: 0.3
                 ST--TCHHHCHCCCCCHT-TT----HHHHHH--------EE CS
     PF00503 142 fqlldsakYfldnldriseedYiPteqDiLrsRvkttgive 182
                 +++ +s kY++d+l+   ++    +++ iL +R +t+ +++
  ABE00427.1  50 LEMPESGKYYFDDLELDFKKG--ISKKEILEVRRETEMVFQ 88 
                 67899********98544444..478999999999988775 PP

>> PF03029  Conserved hypothetical ATP binding protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.5   0.0    0.0032       4.3       2      17 ..      33      48 ..      32      66 .. 0.84

  Alignments for each domain:
  == domain 1    score: 9.5 bits;  conditional E-value: 0.0032
     PF03029  2 vGpaGsGKttfvgals 17
                vGp GsGK+t++++l+
  ABE00427.1 33 VGPSGSGKSTMLRSLN 48
                8***********9986 PP

>> PF00437  Type II/IV secretion system protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.1    0.0035       4.7     136     158 ..      25      47 ..       6      58 .. 0.74

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0035
     PF00437 136 qargnilvsGgTgSGKttllnal 158
                 ++ ++ ++ G+ gSGK+t+l +l
  ABE00427.1  25 ENNQTTVLVGPSGSGKSTMLRSL 47 
                 455667778**********9764 PP

>> PF01078  Magnesium chelatase, subunit ChlI
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.9   0.0    0.0038       5.1      25      46 ..      30      51 ..       9      95 .. 0.83

  Alignments for each domain:
  == domain 1    score: 8.9 bits;  conditional E-value: 0.0038
     PF01078 25 lllvGppGsGKtmlakrlpsll 46
                 +lvGp+GsGK+ + + l+ l 
  ABE00427.1 30 TVLVGPSGSGKSTMLRSLNLLE 51
                689***********99998774 PP

>> PF04338  Protein of unknown function, DUF481
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.7   0.0     0.003       4.1      85     166 ..     152     231 ..     145     234 .. 0.90

  Alignments for each domain:
  == domain 1    score: 9.7 bits;  conditional E-value: 0.003
     PF04338  85 ratlgaGlGyrlidtektklsveaGpgyryekytdgdedeeevalrasldfeykisdnvsftqdlevevsleggsntrlnse 166
                   +l++ + y l+d+++++l+ e+ + + +  ++  +e+++ +++  +l f +k+ d++ f +d +++   +g ++  +ns+
  ABE00427.1 152 ARSLAMNPRYILLDEPTSALDPELELEVLKVLLQLAKEKQSLIIVTHNLAFAQKVADKILFVEDGQILF--QGPKDDFFNSD 231
                 56788999****************************99***************************9988..77777777765 PP

>> PF02562  PhoH-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0    0.0084        11      11      35 ..      19      43 ..      10      58 .. 0.82

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.0084
     PF02562 11 eylealkkndivfaiGpaGtGKTyl 35
                 + +++++n+ ++++Gp+G+GK+ +
  ABE00427.1 19 DITTTFENNQTTVLVGPSGSGKSTM 43
                55667789**************865 PP

>> PF00004  ATPase family associated with various cellular activities (AAA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.8   0.0     0.018        24       2      18 ..      31      47 ..      30      99 .. 0.78
   2 ?    0.0   0.0       4.6   6.2e+03      47      96 ..     146     192 ..     116     212 .. 0.63

  Alignments for each domain:
  == domain 1    score: 7.8 bits;  conditional E-value: 0.018
                EEE-------HHHHHHH CS
     PF00004  2 llyGppGtGKTllakav 18
                +l+Gp G GK+++ +++
  ABE00427.1 31 VLVGPSGSGKSTMLRSL 47
                69***********9987 PP

  == domain 2    score: 0.0 bits;  conditional E-value: 4.6
                 HHHHHHHHHTS..SEEEEEETGGGTSHHHS..TCHHHHHHHHHHHHHHHSCS CS
     PF00004  47 relfkeakeka..psvlfiDEidalaksrgseseeeervvnqLlteldglkk 96 
                 ++ +  a++ a  p  +++DE  +    +      e +v++ Ll+  +++++
  ABE00427.1 146 AQRVAIARSLAmnPRYILLDEPTSALDPE-----LELEVLKVLLQLAKEKQS 192
                 44455555555557778888866665555.....555666666665555555 PP

>> PF05272  Virulence-associated protein E
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.1   0.0    0.0081        11      52      73 ..      27      48 ..      19      84 .. 0.74

  Alignments for each domain:
  == domain 1    score: 8.1 bits;  conditional E-value: 0.0081
     PF05272 52 DevliLqGeqgigKstflkkLg 73
                 + ++L+G+ g+gKst+l+ L 
  ABE00427.1 27 NQTTVLVGPSGSGKSTMLRSLN 48
                5679*************99874 PP

>> PF08298  PrkA AAA domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0086        12      86     109 ..      25      48 ..      17      61 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0086
     PF08298  86 erkqilyllGPvggGksslverlk 109
                 e+ q   l+GP g+Gks++  +l 
  ABE00427.1  25 ENNQTTVLVGPSGSGKSTMLRSLN 48 
                 5678889************99885 PP

>> PF10412  Type IV secretion-system coupling protein DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0    0.0072       9.7      14      35 ..      26      47 ..      15      56 .. 0.86

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0072
     PF10412 14 etqhilivGttGtGKtqalrel 35
                ++q +++vG  G+GK+++lr+l
  ABE00427.1 26 NNQTTVLVGPSGSGKSTMLRSL 47
                467899*************987 PP

>> PF10662  Ethanolamine utilisation - propanediol utilisation
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0     0.011        15       3      26 ..      29      52 ..      27      58 .. 0.87

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.011
     PF10662  3 killiGkvgaGKTtLtqalkgeel 26
                  +l+G++g+GK t+ ++l+  e+
  ABE00427.1 29 TTVLVGPSGSGKSTMLRSLNLLEM 52
                5789**************997766 PP

>> PF10236  Mitochondrial ribosomal death-associated protein 3
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0     0.011        15      22      40 ..      26      44 ..      14      49 .. 0.84

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.011
     PF10236 22 kakrvvltGekgsGKSvlL 40
                +++  vl G+ gsGKS++L
  ABE00427.1 26 NNQTTVLVGPSGSGKSTML 44
                567789************9 PP

>> PF00158  Sigma-54 interaction domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0     0.011        15      12      43 ..      17      48 ..      12      60 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.011
                HHHHHHHHTS-S-EEEE-------HHHHHHHH CS
     PF00158 12 leqikkvaktdltvlitGesGtGKellAraih 43
                l+ i+++ +++ t++++G sG+GK+++ r++ 
  ABE00427.1 17 LKDITTTFENNQTTVLVGPSGSGKSTMLRSLN 48
                5677888899999999*********9987765 PP

>> PF00931  NB-ARC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.014        19      17      39 ..      25      47 ..      14      64 .. 0.81

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.014
                SSSEEEEEE-------HHHHHHH CS
     PF00931 17 eelkvvglvGmgGvGKttlakqv 39
                e+ +   lvG  G+GK+t++++ 
  ABE00427.1 25 ENNQTTVLVGPSGSGKSTMLRSL 47
                56777789**********99876 PP

>> PF05673  Protein of unknown function (DUF815)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.043        57      54      73 ..      28      47 ..      14      56 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.043
     PF05673 54 nnvLLwGarGtGKSslvkal 73
                +  +L+G  G+GKS+++++l
  ABE00427.1 28 QTTVLVGPSGSGKSTMLRSL 47
                45789***********9987 PP

>> PF02456  Adenovirus IVa2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.015        20      89     107 ..      29      47 ..       9      61 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.015
     PF02456  89 igvvygptgsGksqllrnl 107
                  +v++gp+gsGks +lr+l
  ABE00427.1  29 TTVLVGPSGSGKSTMLRSL 47 
                 46789************76 PP

>> PF04548  AIG1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.046        62       2      19 ..      29      46 ..      28      86 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.046
                EEEEE-------HHHHHH CS
     PF04548  2 tivlvGktgnGkSaTgNs 19
                t vlvG +g+GkS+   s
  ABE00427.1 29 TTVLVGPSGSGKSTMLRS 46
                679**********86655 PP

>> PF00006  ATP synthase alpha/beta family, nucleotide-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0     0.018        24       7      35 ..      19      47 ..      15      59 .. 0.90

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.018
                xxxxxxxxxxxxxxxxxxxxxxxxxxxxx RF
     PF00006  7 DslfPivqGqttlipGafgcGktvisqsl 35
                D+ +++ + qtt+++G++g Gk++++ sl
  ABE00427.1 19 DITTTFENNQTTVLVGPSGSGKSTMLRSL 47
                778888999****************9987 PP

>> PF02367  Uncharacterised P-loop hydrolase UPF0079
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.0     0.022        30       8      35 ..      20      47 ..      14      55 .. 0.86

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.022
                HHHHHSS-EEEEEE-------HHHH--- CS
     PF02367  8 laellkagdvvlLsGdlGaGKTtlvkgl 35
                ++ + ++++  +L G+ G+GK t+++ l
  ABE00427.1 20 ITTTFENNQTTVLVGPSGSGKSTMLRSL 47
                66777889999**************987 PP

>> PF00350  Dynamin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0     0.032        43       2      18 ..      31      47 ..      30      58 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.032
                EEE--TT---HHHHHHH CS
     PF00350  2 avvGsqSaGKSSllnaL 18
                ++vG   +GKS++l +L
  ABE00427.1 31 VLVGPSGSGKSTMLRSL 47
                79************998 PP

>> PF09439  Signal recognition particle receptor beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.2   0.0     0.026        36       2      24 ..      26      48 ..      25      59 .. 0.85

  Alignments for each domain:
  == domain 1    score: 6.2 bits;  conditional E-value: 0.026
                ---BEEEE--TT---HHHHHHHH CS
     PF09439  2 skpavllvGlsdsGKTslftrLt 24
                ++++ +lvG+s sGK +++  L 
  ABE00427.1 26 NNQTTVLVGPSGSGKSTMLRSLN 48
                567889************99886 PP

>> PF00519  Papillomavirus helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.028        38     251     282 ..      16      47 ..       2      52 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.028
     PF00519 251 alkkflkgipkknclvivGppdtGkslfcmsl 282
                 alk++  +   +++ v+vGp+ +Gks++  sl
  ABE00427.1  16 ALKDITTTFENNQTTVLVGPSGSGKSTMLRSL 47 
                 67888888889999*************99998 PP

>> PF08140  Crustacean cuticle protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0      0.13   1.8e+02      15      29 ..      24      37 ..      21      38 .. 0.82

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.13
     PF08140 15 fthgvanivliGpSG 29
                f   + + vl+GpSG
  ABE00427.1 24 FENNQ-TTVLVGPSG 37
                55667.99******9 PP

>> PF03308  ArgK protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.3   0.0     0.036        48      19      50 ..      17      48 ..       5      58 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.3 bits;  conditional E-value: 0.036
                HHHHGGG----EEE--B-------HHHHHH-- CS
     PF03308 19 lrkilpkaGralvvGltGvPGaGkstlvekli 50
                l+ i+++  + +   l G  G+Gkst++  l 
  ABE00427.1 17 LKDITTTFENNQTTVLVGPSGSGKSTMLRSLN 48
                66777777788888899**********99886 PP

>> PF11101  Protein of unknown function (DUF2884)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.038        52       7      57 ..     191     241 ..     188     244 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.038
     PF11101   7 ndviiepqklevveksgeklqidedgqLfvdgkkveLsadqqqaleeYseg 57 
                 + +ii + +l + +k ++k+++ edgq++++g k +  +++ q+++++ ++
  ABE00427.1 191 QSLIIVTHNLAFAQKVADKILFVEDGQILFQGPKDDFFNSDNQRIKNFLSA 241
                 678999999************************************999765 PP

>> PF04670  Gtr1/RagA G protein conserved region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.1     0.043        58       3      16 ..      31      44 ..      29      52 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.043
     PF04670  3 LLmGksgsGKtSmr 16
                +L+G+sgsGK++m 
  ABE00427.1 31 VLVGPSGSGKSTML 44
                79**********95 PP

>> PF00485  Phosphoribulokinase / Uridine kinase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0     0.036        49       4      20 ..      32      48 ..      30     127 .. 0.83

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.036
                E---------THHHHHH CS
     PF00485  4 vagsSGaGkttvarkle 20
                + g SG+Gk+t+ r l+
  ABE00427.1 32 LVGPSGSGKSTMLRSLN 48
                579*********99986 PP

>> PF06745  KaiC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0      0.06        81      16      35 ..      24      43 ..      16      49 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.06
     PF06745 16 ipegrvvlitGepGtGKtif 35
                + +++++ ++G +G+GK+++
  ABE00427.1 24 FENNQTTVLVGPSGSGKSTM 43
                778999************98 PP

>> PF01443  Viral (Superfamily 1) RNA helicase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0      0.05        67       5      18 ..      34      47 ..      30      87 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.05
     PF01443  5 GvpGcGKStlirkl 18
                G  G+GKSt++r+l
  ABE00427.1 34 GPSGSGKSTMLRSL 47
                667********987 PP

>> PF02415  Chlamydia polymorphic membrane protein (Chlamydia_PMP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.0   0.0      0.08   1.1e+02       2      13 ..      22      33 ..      21      56 .. 0.84

  Alignments for each domain:
  == domain 1    score: 6.0 bits;  conditional E-value: 0.08
     PF02415  2 itFsnNtatvsf 13
                +tF+nN++tv +
  ABE00427.1 22 TTFENNQTTVLV 33
                79******8876 PP

>> PF07781  Reovirus minor core protein Mu-2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0      0.05        68     410     433 ..      31      54 ..      19      59 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.05
     PF07781 410 glvlPKGSfKStiikvLtsleilg 433
                  lv P GS KSt+++ L+ le+++
  ABE00427.1  31 VLVGPSGSGKSTMLRSLNLLEMPE 54 
                 5777**************999876 PP

>> PF00448  SRP54-type protein, GTPase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.067        90       3      19 ..      29      45 ..      27      58 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.067
                EEEEE-------TTTHC CS
     PF00448  3 villvGlqGaGKTTtla 19
                 ++lvG+ G+GK T l 
  ABE00427.1 29 TTVLVGPSGSGKSTMLR 45
                579***********875 PP

>> PF11655  Protein of unknown function (DUF2589)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.067        90       2      38 ..      99     134 ..      98     157 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.067
     PF11655   2 lddLiggplqAaieAqqmlaqqtvdflqqfff.dkddd 38 
                 l+++i+gp +   e ++++ ++ +++l+++++ d  ++
  ABE00427.1  99 LKNIIEGPVHVLKEDKESATKRAYELLKKVGLaD--KA 134
                 899****************************842..32 PP

>> PF00848  Ring hydroxylating alpha subunit (catalytic domain)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.046        62     123     153 ..      72     102 ..      10     122 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.046
                 HHHH---HHHHHHTSB-EEEETTTEEEES-- CS
     PF00848 123 akkrlGevraraamlqrnltiFPtlsfldgi 153
                  kk++ evr++++m+ +n ++FP l++l+ i
  ABE00427.1  72 SKKEILEVRRETEMVFQNYNLFPHLTVLKNI 102
                 4788999******************999855 PP

>> PF04184  ST7 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.6   0.0     0.077     1e+02     351     408 ..      64     121 ..      53     133 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.6 bits;  conditional E-value: 0.077
     PF04184 351 eaairrGlstaelnaveaihravefnphvpkyllelkslilppehilkrGdseavaya 408
                 e  +++G+s  e+  v   +  v  n  + ++l  lk +i  p h+lk     a   a
  ABE00427.1  64 ELDFKKGISKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPVHVLKEDKESATKRA 121
                 56789***********999999999999********************8766665544 PP

>> PF01583  Adenylylsulphate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.093   1.3e+02       4      23 ..      29      48 ..      26      63 .. 0.81

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.093
                EEEEE-ETT---HHHHHHHH CS
     PF01583  4 vvwltGlsgsGKstiavale 23
                +  l G sgsGKst+   l+
  ABE00427.1 29 TTVLVGPSGSGKSTMLRSLN 48
                56789*********987765 PP

>> PF03668  P-loop ATPase protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0      0.12   1.6e+02       5      22 ..      31      48 ..      28      79 .. 0.78

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.12
     PF03668  5 ivsGlsGaGksvalrale 22
                ++ G sG+Gks+ lr+l+
  ABE00427.1 31 VLVGPSGSGKSTMLRSLN 48
                6789***********986 PP

>> PF04130  Spc97 / Spc98 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.098   1.3e+02     304     322 ..      84     102 ..      72     103 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.098
     PF04130 304 kllleeqdllehlralkny 322
                 ++++++++l+ hl +lkn+
  ABE00427.1  84 EMVFQNYNLFPHLTVLKNI 102
                 689**************98 PP

>> PF03266  Protein of unknown function, DUF265
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0      0.13   1.8e+02       3      18 ..      31      46 ..      29      56 .. 0.85

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.13
                EEE-------HHHHHH CS
     PF03266  3 fiTGppgvGKtTlvkk 18
                ++ Gp+g+GK+T+++ 
  ABE00427.1 31 VLVGPSGSGKSTMLRS 46
                678*********9875 PP

>> PF01328  Peroxidase, family 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.14   1.8e+02     273     315 ..     133     175 ..     115     176 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.14
                 --SS------------------TT--------------TTTT- CS
     PF01328 273 tedslPeGalevgaeavglafastytPallvlnapyyaqdptl 315
                   d+ P+   +  a+ v++a + +++P    l+ p  a dp+l
  ABE00427.1 133 KADAYPQQLSGGQAQRVAIARSLAMNPRYILLDEPTSALDPEL 175
                 5677788777789***************************986 PP

>> PF02344  Myc leucine zipper domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.1      0.17   2.2e+02       5      18 ..      69      82 ..      66      83 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.17
     PF02344  5 kLIaEKdlLRkRRE 18
                k I+ K+ L  RRE
  ABE00427.1 69 KGISKKEILEVRRE 82
                67***********9 PP

>> PF09005  Domain of unknown function (DUF1897)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   0.0      0.16   2.2e+02      20      35 ..     126     141 ..     125     143 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.16
     PF09005  20 rqiGdheeAeaveqqi 35 
                 +++G  ++A+a+ qq+
  ABE00427.1 126 KKVGLADKADAYPQQL 141
                 578**********996 PP

>> PF01935  Domain of unknown function DUF87
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.1       0.3   4.1e+02      29      43 ..      33      47 ..      28      50 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.3
     PF01935 29 lgsTGsGKSntvavL 43
                +g +GsGKS+  ++L
  ABE00427.1 33 VGPSGSGKSTMLRSL 47
                6889******99987 PP

>> PF00071  Ras family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.26   3.6e+02       3      17 ..      31      45 ..      29      55 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.26
                EEE--TT---HHHHH CS
     PF00071  3 vlvGdsavGKtslll 17
                vlvG s+ GK+++l 
  ABE00427.1 31 VLVGPSGSGKSTMLR 45
                9***********986 PP

>> PF06048  Domain of unknown function (DUF927)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1      0.34   4.6e+02     194     210 ..      29      45 ..      17      46 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.34
     PF06048 194 gfhlvgeSstGKttalk 210
                  + lvg S++GK+t+l+
  ABE00427.1  29 TTVLVGPSGSGKSTMLR 45 
                 56799**********97 PP

>> PF07931  Chloramphenicol phosphotransferase-like protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.0      0.32   4.3e+02       5      22 ..      31      48 ..      28      54 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.32
                EE-----------HHHHH CS
     PF07931  5 lLnGgsssGKsslaralq 22
                +L G s sGKs++ r l 
  ABE00427.1 31 VLVGPSGSGKSTMLRSLN 48
                789**********99875 PP

>> PF04846  Herpesvirus pp38 phosphoprotein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.34   4.6e+02      32      51 ..      31      50 ..      28      52 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.34
     PF04846 32 vLiGkavkvqttacnkvgLl 51
                vL+G ++ +++t+  + +Ll
  ABE00427.1 31 VLVGPSGSGKSTMLRSLNLL 50
                8***************9997 PP

>> PF02800  Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.42   5.7e+02       4      34 ..     179     209 ..     177     216 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.42
                 HHHHHHHHCEEEEEEEEEEEESSTTSBSSS. CS
     PF02800   4 lakvlndkfgiekglmttvhaytadQklvDg 34 
                 ++kvl +  + ++ l+ + h  +  Qk+ D+
  ABE00427.1 179 VLKVLLQLAKEKQSLIIVTHNLAFAQKVADK 209
                 789**************************96 PP

>> PF05571  Protein of unknown function (DUF766)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.36   4.8e+02     169     204 ..      72     107 ..      67     110 .. 0.87

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.36
     PF05571 169 lvkkilekseklkslyaalyflPiltllhavasGli 204
                   k+ile+  +++ +++   ++P lt+l+ +  G +
  ABE00427.1  72 SKKEILEVRRETEMVFQNYNLFPHLTVLKNIIEGPV 107
                 5678999**********************9988855 PP

>> PF07760  Protein of unknown function (DUF1616)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.44   5.9e+02     179     202 ..     128     151 ..     108     160 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.44
     PF07760 179 lgpegkaenYPtevtlgeeqtviv 202
                 +g  +ka+ YP++++ g+ q+v +
  ABE00427.1 128 VGLADKADAYPQQLSGGQAQRVAI 151
                 56778*************999987 PP

>> PF11602  ATPase P4 of dsRNA bacteriophage phi-12
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0      0.52   7.1e+02     114     129 ..      30      45 ..      23      51 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.52
                 EEEE-------H---- CS
     PF11602 114 vvvvGktgsGkskaLn 129
                 +v+vG +gsGks +L 
  ABE00427.1  30 TVLVGPSGSGKSTMLR 45 
                 79**********8875 PP

>> PF01473  Putative cell wall binding repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.2       1.1   1.4e+03       9      15 ..      56      62 ..      55      62 .. 0.80

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 1.1
                EEEEBST CS
     PF01473  9 nWYYfds 15
                + YYfd+
  ABE00427.1 56 GKYYFDD 62
                57***96 PP

>> PF11991  Tryptophan dimethylallyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.0      0.49   6.6e+02     326     361 .]     106     141 ..      40     141 .. 0.82

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.49
     PF11991 326 pvrkygrnDakvaeglaeflerlgwkelaksYkdvl 361
                 pv+ + ++ ++++++  e l++ g ++ a++Y ++l
  ABE00427.1 106 PVHVLKEDKESATKRAYELLKKVGLADKADAYPQQL 141
                 7777789999999*******************9876 PP

>> PF08648  Protein of unknown function (DUF1777)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.68   9.2e+02     108     138 ..     103     133 ..      66     156 .. 0.73

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.68
     PF08648 108 vdgvkeikeedlegksedevemmklmGfsgF 138
                 ++g+  + +ed+e+ ++ + e +k +G++  
  ABE00427.1 103 IEGPVHVLKEDKESATKRAYELLKKVGLADK 133
                 788999999******************9765 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (248 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       475  (0.0398758); expected 238.2 (0.02)
Passed bias filter:                      395  (0.0331598); expected 238.2 (0.02)
Passed Vit filter:                        74  (0.00621222); expected 11.9 (0.001)
Passed Fwd filter:                        74  (0.00621222); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              74  [number of targets reported over threshold]
# CPU time: 0.26u 0.05s 00:00:00.31 Elapsed: 00:00:00
# Mc/sec: 2059.26
//