hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_16625.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABD99261.1
Accession:      [none]
Description:    lsal0 fabH.1 GIB00337CH01 "3-oxoacyl-[acyl-carrier-protein] synthase III"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0044181  Thiolase-like                                  201.2    2.8e-56   2
0049604  Thiolase-like                                  176.8    3.8e-52   1
0049764  Thiolase-like                                  148.3    1.9e-44   2
0036930  Thiolase-like                                  144.1      5e-43   1
0047209  Thiolase-like                                  148.8      1e-42   1
0049762  Thiolase-like                                  137.9    2.6e-42   1
0049717  Thiolase-like                                  150.5      1e-41   1
0038812  Thiolase-like                                  148.9      1e-41   2
0044256  Thiolase-like                                  148.6      2e-41   1
0035563  Thiolase-like                                  140.0      3e-39   1
0047210  Thiolase-like                                  131.9    7.1e-39   1
0041153  Thiolase-like                                  130.6    3.5e-37   2
0044182  Thiolase-like                                  123.8    2.3e-35   1
0036931  Thiolase-like                                  128.5      2e-34   1
0035564  Thiolase-like                                  120.7    8.1e-34   1
0044257  Thiolase-like                                  126.1    1.1e-33   1
0041154  Thiolase-like                                  124.7    2.9e-33   1
0049763  Thiolase-like                                  113.4    1.4e-32   1
0049939  Thiolase-like                                  108.6    3.7e-32   1
0048944  Thiolase-like                                  102.4    1.1e-30   1
0038813  Thiolase-like                                  114.8    2.5e-30   1
0049718  Thiolase-like                                   69.2    1.1e-19   1
0039353  Thiolase-like                                   52.4    6.7e-14   1
0036364  Thiolase-like                                   33.1    3.5e-08   1
0044093  Thiolase-like                                   26.4      1e-06   1
0035033  Thiolase-like                                   25.4    1.3e-06   1
0035032  Thiolase-like                                   22.1    5.3e-06   1
0042062  Thiolase-like                                   20.8    5.2e-05   1
0042745  Thiolase-like                                   19.3     0.0002   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0035563    1/1       1   171 [.     1   235 []   140.0    3e-39
0036364    1/1       1   171 [.     1   253 []    33.1  3.5e-08
0038812    1/2       1   174 [.     1   184 []   114.3  8.7e-32
0039353    1/1       1   171 [.     1   249 []    52.4  6.7e-14
0041153    1/2       1   174 [.     1   181 []   122.1  1.1e-34
0042062    1/1       1   171 [.     1   256 []    20.8  5.2e-05
0049604    1/1       1   326 [.     1   372 []   176.8  3.8e-52
0049764    1/2       1   171 [.     1   225 []   146.0  9.9e-44
0036930    1/1       2   172 ..     1   216 []   144.1    5e-43
0044093    1/1       2   160 ..     1   216 []    26.4    1e-06
0047209    1/1       2   174 ..     1   174 []   148.8    1e-42
0049762    1/1       2   178 ..     1   233 []   137.9  2.6e-42
0049717    1/1       3   171 ..     1   166 []   150.5    1e-41
0044181    1/2       4   170 ..     1   200 []   133.2    1e-36
0044256    1/1       4   175 ..     1   172 []   148.6    2e-41
0035032    1/1      19   143 ..     1   132 [.    22.1  5.3e-06
0048944    1/1      31   298 ..     1   265 []   102.4  1.1e-30
0049939    1/1      31   302 ..     1   273 []   108.6  3.7e-32
0038813    1/1     152   326 ..     1   148 []   114.8  2.5e-30
0041154    1/1     152   326 ..     1   153 []   124.7  2.9e-33
0044257    1/1     152   326 ..     1   149 []   126.1  1.1e-33
0036931    1/1     157   326 ..     1   160 []   128.5    2e-34
0035564    1/1     173   326 ..     1   154 []   120.7  8.1e-34
0047210    1/1     177   326 ..     1   143 []   131.9  7.1e-39
0044182    1/1     185   326 ..     1   148 []   123.8  2.3e-35
0049763    1/1     198   326 ..     1   156 []   113.4  1.4e-32
0042745    1/1     202   327 ..     1   124 []    19.3   0.0002
0044181    2/2     202   326 ..    52   200 .]    67.9  3.8e-18
0035033    1/1     203   324 ..     1   124 []    25.4  1.3e-06
0049764    2/2     208   304 ..    76   176 ..     2.3      4.5
0049718    1/1     212   326 ..    25   221 .]    69.2  1.1e-19
0038812    2/2     214   304 ..     1   143 [.    34.6    6e-09
0041153    2/2     214   288 ..     1   125 [.     8.5     0.14

Alignments of top-scoring domains:
0035563: domain 1 of 1, from 1 to 171: score 140.0, E = 3e-39
                   *->MlvllliryalrapgpvyilgigtalPplvvtneelaelldtvtlll
                      M              ++ i  ++ ++Pp v++n+ l e++dt     
  ABD99261.1     1    M-------------ENIEISYTARYVPPEVIDNQRLTEFMDT----- 29   

                   ldlelleflerilertgikertlvlpeeilledpelfllllpslgerlal
                          ++e+i +rtgik+r++ l+                        
  ABD99261.1    30 -------SDEWISQRTGIKKRHISLN------------------------ 48   

                   aleeavdlaveAarkaleragidpsdidlvivatstgdd.tpslaalvan
                     e ++dla+++a+k+l ++g++p+++dl+ivat++++  tp++aa+v+ 
  ABD99261.1    49 --ESTADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNSfTPATAAIVQG 96   

                   llglrgdvrafdlngmgCsaglaalrlAkdllragpgarvLVvgaEllsl
                   ++ +++ +++fd++ ++Cs+ +++l++  ++lr+   +r++++g+E+ls+
  ABD99261.1    97 RISADN-AVCFDIS-AACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSK 144  

                   lldggdrstlsmlvgnalfGdGAaAvllsadpgagrlgkmervaivgmgvrtPgg.lsleelwdlllagrsgireipafrldglyv
                      me++ i   + + P  + +++ l +++ +++++i+ ++ +       
  ABD99261.1     1    MENIEISYTARYVPPEvIDNQRLTEFMDTSDEWISQRTGIK------ 41   

                   rvagfldfdaaffisprearamdpqqrlaleaarealedagldpeelddg
                                  +r++ + +++++la  +a ++l  +g++p++ld  
  ABD99261.1    42 ---------------KRHISLNESTADLAKKVAEKLLTKSGWNPNSLDL- 75   

                   srtGvivGsvlggylllnlarlaallaglpesvspylltglllnvlagrv
                       +iv++++++  ++++a +++ + ++ +++                 
  ABD99261.1    76 ----IIVATMSPNSFTPATAAIVQGRISA-DNA----------------- 103  

                   syllglrGpaltvdtacaSslvAihlAaqairsGeadvalaGGveslspl
                            ++ +++ac++ ++++ +   ++r+   + a+  G e ls l
  ABD99261.1   104 --------VCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKL 145  

                   plvgfsalgalsltlnddpdgacrpfdadadgfvlgeGaaalvLerledA
                   +                        ++++   +++g+Gaa  ++e  ed 
  ABD99261.1   146 ID-----------------------WNDRSTAVLFGDGAAGALIELKED- 171  

                   largakimslllllllmrrvvivgigvylPlgvvtneeladllggssgkilert
                               m+++ i  ++ y+P+ v++n+ l +++++s+++i +rt
  ABD99261.1     1    ---------MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRT 38   

                   gigsrrgalvferavdlaaeaarealedagldpedidgvivgtatggilg
                   gi++r++   +e+++dla ++a+++l ++g++p+++d++iv+t+++   +
  ABD99261.1    39 GIKKRHIS-LNESTADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNSFT 87   

                   pslaaavalrlglpgvpavtvstaCasglaalplAadlirsgradvvlvv
                   p++aa+v+ r+ +++++++++s+aC++ +++l +  +++r+   ++++++
  ABD99261.1    88 PATAAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLI 137  

                   gaeamslprdfddardgslfgdGAaalvlesleharrmervaIvgmgvrtPggv.glgelwdlllagrsgireipafrldglyv
                      me++ I   + + P  v++++ l +++ +++++i++++++       
  ABD99261.1     1    MENIEISYTARYVPPEViDNQRLTEFMDTSDEWISQRTGIK------ 41   

                   rvggfldfdaaffisprearamdpqqrlaleaareAledagldpedldgv
                                  +r++   +++++la  +a ++l ++g++p++ld +
  ABD99261.1    42 ---------------KRHISLNESTADLAKKVAEKLLTKSGWNPNSLDLI 76   

                   rvGvvvgsglggylarlaallaglprgprrvspylltgtllnvlagrisy
                   +v+++ + ++ + +a +++ ++ ++                         
  ABD99261.1    77 IVATMSPNSFTPATAAIVQGRISAD------------------------- 101  

                   llgltgpaltvdtacsSglvAlhlAaqairsGeadvalagGvesmssppl
                       +  ++++++acs+ +++l +   ++r+   + a+ +G+e +s  + 
  ABD99261.1   102 ----NAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLID 147  

                   lagfsamgalselvadpdgasrpfdedadgfvlgeGaaalvLesledAla
                   +                        ++ +++++g+Gaa  ++e  ed   
  ABD99261.1   148 WN-----------------------DRSTAVLFGDGAAGALIELKED--- 171  

                   rGallllllmrpvaIvgigvylPggvvsneelwellgtsdefiavrtgig
                            m+++ I  ++ y+P+ v++n+ l e+++tsde+i +rtgi+
  ABD99261.1     1    ------MENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIK 41   

                   errgaladepavdlaleaarealedagldpedidgvivgtvtgdyalpsl
                   +r +   +e+++dla  +a+++l ++g++p+++d++iv+t+++  ++p++
  ABD99261.1    42 KR-HISLNESTADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNSFTPAT 90   

                   aarvalllglpgvpafdvdtaCasglaalalAadlirsgeadvvLvvgve
                   aa+v+ ++ ++++++fd+++aC++++++l +  +++r+   ++++ +g+e
  ABD99261.1    91 AAIVQGRISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSE 140  

                   lmsrprdfddaadgslfgdGAaavvlesledareeslldlmmepvaIvgmgvrtPgg.lgleefwelllagrsgireipaf
                             me++ I   + + P  +++ + + e++ ++ ++i+  +  
  ABD99261.1     1    -------MENIEISYTARYVPPEvIDNQRLTEFMDTSDEWISQRT-- 38   

                   rldglyvrvggflddfdaffgisprearamdpqqrlaleaawealedagl
                                       gi +r++ + +  + la  +a  +l ++g+
  ABD99261.1    39 --------------------GIKKRHISLNESTADLAKKVAEKLLTKSGW 68   

                   dpeeldgvrvGvvvgsglggylarlaallaglpkgpelvspylltgtlln
                   +p++ld ++v+++ + ++ + +a +++ ++ ++                 
  ABD99261.1    69 NPNSLDLIIVATMSPNSFTPATAAIVQGRISAD----------------- 101  

                   vlagrvsyllglrgpaltvdtacsSslvAihlAaqairsGeadvalaGGv
                               +  ++ +++acs+  + + +   ++r+   + a+  G 
  ABD99261.1   102 ------------NAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGS 139  

                   esmlspptllgfsalgalstnddpdgacrpfdadadGfvlgeGaaalvLe
                   e ++  +                       ++++  +  +g+Gaa  ++e
  ABD99261.1   140 ENLSKLID----------------------WNDRSTAVLFGDGAAGALIE 167  

                   rledAlarGalllelsrdepvaivegmgcrfPglavsleefwelllegrdaiseipa
                                                                  +++
  ABD99261.1     1    --------------------------------------------MEN 3    

                   vrilllgsylpdryvtnggl...lddvdefdaartgispreaalmdeaqr
                   ++i +++ y+p+++++n+ l++ +d++de++ +rtgi++r++ l + +++
  ABD99261.1     4 IEISYTARYVPPEVIDNQRLtefMDTSDEWISQRTGIKKRHISLNESTAD 53   

                   laleaarealedagldpedidgvivgtvt.gallpslaarvalllglppn
                   la  +a+++l ++g++p+++d++iv+t++ + ++p++aa+v+ ++ ++ n
  ABD99261.1    54 LAKKVAEKLLTKSGWNPNSLDLIIVATMSpNSFTPATAAIVQGRISAD-N 102  

                   gpaftvdtagCssglvAlhlAaqlirsgeadvaLvggvelmsraldpegf
                   + +f++++a Cs+ +++l +  +++r+   ++a+ +g+e++s  +d++++
  ABD99261.1   103 AVCFDISAA-CSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLIDWNDR 151  

                   aslvalsalfgdgacavfltaadgsvlgegagavvlkslsdalrdgdril
                   ++ v    lfgdga+ ++++  ++             + s+ +   ++ +
  ABD99261.1   152 STAV----LFGDGAAGALIELKED-------------TDSKFISSDLKTI 184  

                   avirgsavngd....................glgkgvpapagegqarair
                   +  + + ++g ++  ++  + + + ++++ ++ g++v+ +a + +++ i 
  ABD99261.1   185 GNEAEFLTAGItdplekfpdldsirkyttfkMDGRRVYTFATREVPQSIL 234  

                   kaleragldpddidyveahgtgtalgdaiekalgldpekvnvsgsvksni
                   +a ++a+l+++didy+++h+++ +++ +++k+l+ d+ek++++   ++ +
  ABD99261.1   235 RAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPIN---IDSF 281  

                   GhtlgAsgalalilllregrlppgldrvlllafGgGltaaalllrvvde<
                   G+t++As +l+l++l+++g +++g  ++ l +fGgGlt+++ ++++    
  ABD99261.1   282 GNTSAASEPLLLDELIENGTVKRG-MTLALSGFGGGLTVGTHIIKY---  326  

                   -*
                     
  ABD99261.1     -    -    

0049764: domain 1 of 2, from 1 to 171: score 146.0, E = 9.9e-44
                   *->llrrpmpvyilgigtalPervvtneelaellgtltdslldeellell
                          + ++ i  ++ ++P+ v++n+ l e+++t+            +
  ABD99261.1     1    ----MENIEISYTARYVPPEVIDNQRLTEFMDTS------------D 31   

                   erilertgikeRhvalpeetllpdpllllpllpsleerldialeeavdla
                   e+i +rtgik+Rh+ l+                          e+++dla
  ABD99261.1    32 EWISQRTGIKKRHISLN--------------------------ESTADLA 55   

                   veAarkaLeeagldpsdidllivatstgd.atpslaallanllglrpdvr
                   +++a+k+L ++g++p+++dl+ivat++++ +tp++aa+++ ++ +++ ++
  ABD99261.1    56 KKVAEKLLTKSGWNPNSLDLIIVATMSPNsFTPATAAIVQGRISADN-AV 104  

                   afdlggmgCsaglaaLrlAkdlleagpgarvLVvaaEllsllldlgdrst
                   +fd+ +++Cs+++++L+++  +l++   +r++++++E+ls+l+d++drst
  ABD99261.1   105 CFDI-SAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLIDWNDRST 153  

                   ldnlvgnalfGdGAaAvvlsadpgllglegpvyilgigtalPenvvtneelaelldtstkftdllelleflerile
                       ++ i  ++ ++P+ v++n+ l e++dts            +e+i +
  ABD99261.1     2    ENIEISYTARYVPPEVIDNQRLTEFMDTS------------DEWISQ 36   

                   rtgigerhialpdeillpppslfdlllpslserlalaleeavdlaveAar
                   rtgi++rhi l+                          e+++dla+++a+
  ABD99261.1    37 RTGIKKRHISLN--------------------------ESTADLAKKVAE 60   

                   kaledagldpsdidllivatstgdd.tpslaalvanllglrgdvaraflv
                   k+l ++g++p+++dl+ivat++++  tp++aa+v+ ++ +++  a++f++
  ABD99261.1    61 KLLTKSGWNPNSLDLIIVATMSPNSfTPATAAIVQGRISADN--AVCFDI 108  

                   gagCsgglaaLdlAkdlleagpgarvLVvgaEllsllldfgdrstlsmlv
                   +a+Csg++++L++   +l++   +r++++g+E+ls+l+d++drst     
  ABD99261.1   109 SAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLIDWNDRST----- 153  

                   gnalfgdGAaAvllsadpddervaIvGmgvrtPggngleefwelllagrsgireipafrldrfggfl
                      e++ I   + + P                         +  r+  f+
  ABD99261.1     2    ENIEISYTARYVPPE---------------------VIDNQRLTEFM 27   

                   agvvpfdaaffgisprearamdpqqrlaleaareAledagldpeeldgvr
                   +  ++++  ++gi +r++   + ++ la  +a  +l  +g++p++ld ++
  ABD99261.1    28 DTSDEWISQRTGIKKRHISLNESTADLAKKVAEKLLTKSGWNPNSLDLII 77   

                   vGvvvgsglggylaleaallallpkglllellprrvspylltgtlpnvla
                   v+++ + ++ + +a  ++ ++  ++                         
  ABD99261.1    78 VATMSPNSFTPATAAIVQGRISADN------------------------- 102  

                   grvsyllglrgpaltvdtaCsSglvAihlAaqairsGeadvalaGGvelm
                               ++ +++aCs+  +++ +   ++r+   + a+ +G+e +
  ABD99261.1   103 ----------AVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENL 142  

                   lspltlagfsalgalspdGepvgIlgigvylPelvvtneelaellgtsderilartgikerrvalp
                      e++ I  ++ y+P+ v++n+ l e+++tsde+i +rtgik+r++ l 
  ABD99261.1     2    ENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISL- 47   

                   dedasdlaleAareaLedagldpddidlvivgtvtgdyllpslaarvaal
                   +e+++dla ++a+++L ++g++p+++dl+iv+t+++  ++p++aa+v+ +
  ABD99261.1    48 NESTADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNSFTPATAAIVQGR 97   

                   lglrgapafdvnaaCasglaALalAaqlirsgladraLvvgaellslgld
                   + +++a++fd++aaC++++++L +  +++r+   +ra+++g+e+ls+++d
  ABD99261.1    98 ISADNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLID 147  

                   fddrltgalfgdGAaavvlerdeeeglsllllllllradepvaivgigtalPggvvsqeelldllaeltdalsl
                                                                     
  ABD99261.1     -    ----------------------------------------------- -    

                   vplkrllkrildgsgipkryvvldelfllldtsldwilertgiserraaa
                       + +++ +++ ++p +++ +++l  ++dts++wi +rtgi+ r++  
  ABD99261.1     2 ----ENIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISL 47   

                   ldeaadlaleAarkaLeragidpsdidllivatstgd.llpslaarvanl
                    + +adla ++a+k+L ++g++p+++dl+ivat++++ ++p++aa+v+++
  ABD99261.1    48 NESTADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNsFTPATAAIVQGR 97   

                   lglrgnvvafdlagaGCsgglvaLrlAadllragpakrvLvvgaellsll
                   + ++ n+v+fd+++a Csg++++L ++ ++lr+   kr++++g+e+ls+l
  ABD99261.1    98 ISAD-NAVCFDISAA-CSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKL 145  

                   lrgpdgrdrdtlvsnalfGdGAaAvlleadpedglr..envgIlgigvylPelvvtneelaellgtsdekilertgikerrvalpd
                      n+ I  ++ y+P+ v++n+ l e+++tsde+i +rtgik+r++ l +
  ABD99261.1     3    NIEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISL-N 48   

                   edasdlaveAarkale..gidpsdidllivatespddllpstaalvqnll
                   e+++dla ++a+k+l++ g++p+++dl+ivat+sp  ++p+taa+vq+++
  ABD99261.1    49 ESTADLAKKVAEKLLTksGWNPNSLDLIIVATMSPNSFTPATAAIVQGRI 98   

                   glspnalafdlnaaCsgglaalrlAadliesgpakrvLvvgaeilsllld
                    + +na++fd++aaCsg++++l +  +++++   kr++++g+e+ls+l+d
  ABD99261.1    99 SA-DNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLID 147  

                   lgdr...vlfGdGAaAvllgadpevyilgigtylPprvvtneelaellgilsfllgsdgklerilertgig
                      + i  ++ y+Pp v++n+ l e+++++         +e+i +rtgi+
  ABD99261.1     4    IEISYTARYVPPEVIDNQRLTEFMDTS---------DEWISQRTGIK 41   

                   srtialpeeilltdplltmrgrevfeeavelaaeaarealeeagldpedi
                   +r+i l+e                   +++la ++a+++l ++g++p+ +
  ABD99261.1    42 KRHISLNE------------------STADLAKKVAEKLLTKSGWNPNSL 73   

                   dllivatstgdl.tphqanllikrlglppdvvafdlgntgcasgplALdl
                   dl+ivat++++  tp++a++++ r+ +  ++v+fd+  ++c++++++L++
  ABD99261.1    74 DLIIVATMSPNSfTPATAAIVQGRISA-DNAVCFDI-SAACSGYIYGLSI 121  

                   aadllragpgdrvlvvgaEllsllldpgdrdlsnlvtnalfGdGaaAvll
                     ++lr+   +r++++g+E+ls+l+d++dr+     t++lfGdGaa++l+
  ABD99261.1   122 VEAMLRNMNLKRAMLIGSENLSKLIDWNDRS-----TAVLFGDGAAGALI 166  

                   radpvvIlglgsylPegvvtneeleklldtsdewilartgilerrialkde
                      + I  ++ y+P++v++n+ l +++dtsdewi +rtgi++r+i l +e
  ABD99261.1     4    IEISYTARYVPPEVIDNQRLTEFMDTSDEWISQRTGIKKRHISL-NE 49   

                   ttsdlalaaarealedagldpedidlvivgtvtpdyllpataalvalrlg
                   +t+dla ++a+++l ++g++p+++dl+iv+t++p  ++pataa+v+ r+ 
  ABD99261.1    50 STADLAKKVAEKLLTKSGWNPNSLDLIIVATMSPNSFTPATAAIVQGRIS 99   

                   l.ngpafdvnaaCasglyAlalAaalirsgladvvLvggaealsrlldfd
                   ++n+++fd++aaC++++y+l +  a++r    ++++++g+e ls+l+d++
  ABD99261.1   100 AdNAVCFDISAACSGYIYGLSIVEAMLRNMNLKRAMLIGSENLSKLIDWN 149  

                   drrtgflfGdGAgavvLeeleedsgllllllggfmddvvivgfdrtpfgksprgalamdpaqdlaleaareal
                         +l  fmd    ++++  + g+++r    + +++dla  +a ++l
  ABD99261.1    19    DNQRLTEFMDTS--DEWISQRTGIKKRHISLNESTADLAKKVAEKLL 63   

                   edaplslgldpeevddvivGvvlgaglggniarraallaglpvsgpaltv
                    ++    g++p+ +d +iv+++ + ++++++a+++  +  ++ +  ++++
  ABD99261.1    64 TKS----GWNPNSLDLIIVATMSPNSFTPATAAIVQGRISAD-NAVCFDI 108  

                   ntaCsSglvAihlAaqairaGeadvalAgGvesmsdvvivdaartpigkrrgaladdpaadlaaeaarealeragldpedvd
                      d++i    rt+i kr+++  ++++adla  +a ++l ++g++p+++d
  ABD99261.1    31    DEWISQ--RTGIKKRHIS-LNESTADLAKKVAEKLLTKSGWNPNSLD 74   

                   dvivGvvlgagqgpniarrvalalglpvggpaftvnraCaSglqAialAa
                   ++iv+++ + +  p++a++v+ ++ ++ ++ +f++++aC++ ++++ +  
  ABD99261.1    75 LIIVATMSPNSFTPATAAIVQGRISAD-NAVCFDISAACSGYIYGLSIVE 123  

                   qairsGeadvvlagGvesmsrapllldrrtgalfgdgarafdlea....d
                    ++r    + ++ +G e +s  +++ dr+t++lfgdga+  ++e ++++d
  ABD99261.1   124 AMLRNMNLKRAMLIGSENLSKLIDWNDRSTAVLFGDGAAGALIELkedtD 173  

                   glvlgegaglmgltaeelalrygisredqdafalrshiraaaagaagffd
                      ++  +   g +ae l     ++ e +  +               +f+
  ABD99261.1   174 SKFISSDLKTIGNEAEFLTAGITDPLEKFPDLDSIRKYT--------TFK 215  

                   geivpvtvpdgkgqarvirdalaragltledldylkpvfanhgtvtagn.
                   ++++ v+ ++ + ++  i +a  +a+l+led+dy+++++an ++++ +++
  ABD99261.1   216 MDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAk 265  

                   .............dslendGAAavllaseeaakelGdvvivgaartpigkrrgaladvsasdLaaeaarealeragldpedid
                      d++i    rt+i+kr+++  ++s++dLa  +a ++l ++g++p+++d
  ABD99261.1    31    DEWISQ--RTGIKKRHIS-LNESTADLAKKVAEKLLTKSGWNPNSLD 74   

                   lvivGtvlpdglqgpnlarlaalalglplgvpaftvnraCsSglvAlhlA
                   l+iv+t++p+++  p++a +++ ++ ++ ++ +f++++aCs+ +++l + 
  ABD99261.1    75 LIIVATMSPNSF-TPATAAIVQGRISAD-NAVCFDISAACSGYIYGLSIV 122  

                   aqairsGeadvvlagGvesmsrvpllldr...alfgdgagavllf...da
                    +++r+   ++++ +G e +s+ +++ dr +++lfgdga ++l++ ++d+
  ABD99261.1   123 EAMLRNMNLKRAMLIGSENLSKLIDWNDRstaVLFGDGAAGALIElkeDT 172  

                   ladgl............llaeglgdpvlkrlmgataenvaekygisreeq
                   + +++  + +++ +++++l  g++dp+ k +     + +   ++++++ +
  ABD99261.1   173 DSKFIssdlktigneaeFLTAGITDPLEKFPDLDSIRKYT-TFKMDGRRV 221  

                   dafavkshrraaaaikaglfkaeivpvdvpdrkgdvvvahdegirigttl
                     fa +++   +    ++ +ka++  +d+     d+++ h+++ ri+  +
  ABD99261.1   222 YTFATREVPQSI---LRAVQKANLSLEDI-----DYFILHQANSRIIRQV 263  

                   ekllklkpvfvpdgtvtagnasgisdGAAavllaseeaakelglgdgflfgdGAaavvLesleaaralglrilaviv..............
                       +++lfgdGAa +++e  e+       ++  ++ ++++  ++ +++ 
  ABD99261.1   152    STAVLFGDGAAGALIELKEDTDSKFISSDLKTIgneaefltagitdp 198  

                   ..............glamdgrevpapavealaeairkalekagltpddid
                    ++  + + + +++ + mdgr+v+ +a++ ++++i +a +ka+l+++did
  ABD99261.1   199 lekfpdldsirkytTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDID 248  

                   yvelhqagtrildavekklglppekvkvntghplGntgaaslplallall
                   y++lhqa+ ri+ +v+kkl+ ++ek++ ++++ +Gnt+aas pl+l++l+
  ABD99261.1   249 YFILHQANSRIIRQVAKKLKQDEEKFP-INIDSFGNTSAASEPLLLDELI 297  

                   regrlkpgdrvlllgfGaGltngalvlewgnaslfgDGAaAvvleseeda.rglgllplatig.............
                       +a+lfgDGAa +++e +ed + +++   l tig++++  ++ +++ 
  ABD99261.1   152    STAVLFGDGAAGALIELKEDTdSKFISSDLKTIGneaefltagitdp 198  

                   ..............llamlgrdvpklavaalvpairkalekagltlddid
                    ++  + + + +++ + m+gr+v+++a++ +++ i +a +ka+l+l+did
  ABD99261.1   199 lekfpdldsirkytTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDID 248  

                   lfvlhqagarildavakklglppekvnvlgliayGntssAsiplalaell
                   +f+lhqa+ ri+ +vakkl+ ++ek+ +++++ +Gnts+As pl+l+el+
  ABD99261.1   249 YFILHQANSRIIRQVAKKLKQDEEKF-PINIDSFGNTSAASEPLLLDELI 297  

                   regrlkggdlglllafGaGltvaaavlrvldrvegnaslfgdGAaAvllesdeg..aralglrplarg.............
                       +a+lfgdGAa +l+e +e+++ ++++  + + g++++  ++ +++ 
  ABD99261.1   152    STAVLFGDGAAGALIELKEDtdSKFISSDLKTIGneaefltagitdp 198  

                   ..............llvalgrdvpklaltalveairealekagltpddid
                    ++  + + + +++++ ++gr+v+++a++ +++ i +a++ka+l+++did
  ABD99261.1   199 lekfpdldsirkytTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDID 248  

                   lfvlhqanaaildavakklglppekvrvnlhpyGntgaasiplalaellr
                   +f+lhqan +i+ +vakkl+ ++ek+++n++ +Gnt+aas pl+l+el++
  ABD99261.1   249 YFILHQANSRIIRQVAKKLKQDEEKFPINIDSFGNTSAASEPLLLDELIE 298  

                   rgrlkpgdrvlllafGsGltagaavlrvldlFGdGAaAvllgadp............lllpdgegallllldedg...
                      FGdGAa++l++ +++++ + +  + ++++++ e + ++++d+ ++  
  ABD99261.1   157    FGDGAAGALIELKEdtdskfissdlkTIGNEAEFLTAGITDPLEkfp 203  

                   .........llvmlgrevfklavkalaevlkellekaglslddidffvlH
                   + + + +++++ m+gr+v+ +a++ +++++ ++++ka+lsl+did+f+lH
  ABD99261.1   204 dldsirkytTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILH 253  

                   qagrrildavakkLglpeekvlasravLaeyGNtssasvplaLdellrkg
                   qa+ ri+++vakkL+ +eek+ ++   ++ +GNts+as pl+Ldel+++g
  ABD99261.1   254 QANSRIIRQVAKKLKQDEEKFPIN---IDSFGNTSAASEPLLLDELIENG 300  

                   leeglltrlkggdlvlllafGaGltvgsvllrwlrlllfgilstalgadgdsedlltldlde.............dgllvmlgr
                        +++s+ l ++g+ +++lt  +++  ++  + + + +   + m+gr
  ABD99261.1   173    DSKFISSDLKTIGNEAEFLTAGITDplekfpdldsirkYTTFKMDGR 219  

                   evfklavdalpkvlkellekaglslddidffvpHqanrrildavakkLgl
                   +v+++a++ +p+++ ++++ka+lsl+did+f++Hqan ri+++vakkL+ 
  ABD99261.1   220 RVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQ 269  

                   ppekvvasrdvLaeyGNtssasiplaLdellrkgleeglatrlkkgdlvl
                   ++ek++++   ++ +GNts+as pl+Ldel+++g       ++k+g ++ 
  ABD99261.1   270 DEEKFPIN---IDSFGNTSAASEPLLLDELIENG-------TVKRGMTLA 309  

                   llafGpGltwgsallrwvellgtallsdgsgadlltldaggfrrp.......dgglllvmdgrevfk
                      +++ l ++g+ a++lt ++ +      + + ++ + +++mdgr+v+ 
  ABD99261.1   177    ISSDLKTIGNEAEFLTAGITDPLEKfpdldsiRKYTTFKMDGRRVYT 223  

                   lavklvpeaikellekaglsledidlfvphqanrrildavakklglppek
                   +a++ vp++i ++ +ka+lsledid+f++hqan ri+++vakkl+ ++ek
  ABD99261.1   224 FATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEK 273  

                   vrvvldeyGNtssasiplaLdelleegrlkpGdrvlllafGaGltwgaal
                   +++++d +GNts+as pl Ldel+e+g +k+G +++l +fG+Glt+g+ +
  ABD99261.1   274 FPINIDSFGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHI 323  

                   lrvkpllellaagslllpdsedligldlrdtgltmvgrkvfplavklvap
                      ++ +e l+ag +   +  + ++  ++ t ++m+gr+v+ +a++ v++
  ABD99261.1   185    GNEAEFLTAGITDPLEKFPDLDSIRKYTTFKMDGRRVYTFATREVPQ 231  

                   alkellekaglsledidlfvpHqanarildavakklglppekvvasrgvl
                    + ++++ka+lsledid+f++Hqan ri+++vakkl+ ++ek+ ++   +
  ABD99261.1   232 SILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPIN---I 278  

                   aeyGNtssAsiplaLdellekgrlkkgdrvlllafGpGltwgaallrwls
                   + +GNts+As pl Ldel+e+g +k+g +++l +fG+Glt+g+ ++++  
  ABD99261.1   279 DSFGNTSAASEPLLLDELIENGTVKRGMTLALSGFGGGLTVGTHIIKY-- 326  

                   aPllelvralstllpdsedaigldlddlgllvmlgkevpklavkalpk
                      Pl +  +  s+             +++  + m+g++v+ +a++ +p+
  ABD99261.1   198    PLEKFPDLDSI-------------RKYTTFKMDGRRVYTFATREVPQ 231  

                   lleellekaglsledidffvlHpggrrildavekkLglppekllasrevl
                   ++ ++++ka+lsledid+f+lH+++ ri+ +v+kkL+ ++ek++++   +
  ABD99261.1   232 SILRAVQKANLSLEDIDYFILHQANSRIIRQVAKKLKQDEEKFPIN---I 278  

                   reyGNtssasvplvLdellrkgrleglattgkggdlvlllafGpGltwgs
                   + +GNts+as pl+Ldel+++g +       k+g ++ l +fG+Glt+g+
  ABD99261.1   279 DSFGNTSAASEPLLLDELIENGTV-------KRGMTLALSGFGGGLTVGT 321  

                   allrwlrlllkplarivgyavagda....palmglgpvlAirkaleraglspddid
                      ++ l  i+ y +   +   +  + ++ + ++i +a ++a+ls++did
  ABD99261.1   202    FPDLDSIRKYTTFKMDgrrvYTFATREVPQSILRAVQKANLSLEDID 248  

                   lvelheaftaqdlaelealglgrlpvnvsGgaialGhplgAsGarllvtl
                   ++ lh a + + + +++ l+ + +++ ++  +   G++ +As  +ll +l
  ABD99261.1   249 YFILHQANSRIIRQVAKKLKQDEEKFPINIDSF--GNTSAASEPLLLDEL 296  

                   llalrgrggrralatlcggggqgaalvlerlalpeeilltdplltmrgrevfeeavelaaeaarealeeagldpedid
                      +++ +  +++ ++ m+gr v+ +a++ +++ + +a ++a+l++edid
  ABD99261.1   202    FPDLDSIRKYTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDID 248  

                   llivatstgdltphqanlli.....krlglppdvvafdl...gntgcasg
                   ++i         +hqan +i+ +++k+l+ +++++ ++++  gnt++as 
  ABD99261.1   249 YFI---------LHQANSRIirqvaKKLKQDEEKFPINIdsfGNTSAASE 289  

                   plALdlaadllragpgdrvlvvgaEllsllldpgdrdlsnlvtnalfGdG
                   pl Ld++++ + +++g ++ + g                       fG+G
  ABD99261.1   290 PLLLDELIENGTVKRGMTLALSG-----------------------FGGG 316  

                   ..aaAvllradprglkplarivgyavagdd.palmglgpvlAirkalekaglspddidl
                       +l+ + +++ + + g ++  + ++ + ++i +a +ka+ls++did+
  ABD99261.1   203    PDLDSIRKYTTFKMDGRRvYTFATREVPQSILRAVQKANLSLEDIDY 249  

                   ielheafaaqvlaalealgldle..kvnvsGgalalGhplgasGarllve
                   + lh+a+++++  ++++l+ d+e+ ++n+++        +g + a+    
  ABD99261.1   250 FILHQANSRIIRQVAKKLKQDEEkfPINIDS--------FGNTSAASEPL 291  

                   lllqL.rgg..alglavlciggGfgganvvevllpllpsleerldialeeavdlaveAarkaLeeagldpsdidllivat
                      ++ ++++++ ++ ++  a++ + + +++a+++a+l+ +did+ i   
  ABD99261.1   208    IRKYTTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFI--- 251  

                   stgd.atpslaallanllglrpdvrafdlggmgCsaglaaLrlAkdllea
                      ++a+  +  ++a++l+ +++ + +++ + g  +++    l ++l+e+
  ABD99261.1   252 --LHqANSRIIRQVAKKLKQDEEKFPINIDSFGNTSAASEPLLLDELIEN 299  

                   gpgareypvvdgklslkcyldaldeaykeylekaglslddfdylvfHqPftk
                      ++  +dg+ +++++ + +++ + ++ +ka+lsl+d+dy++ Hq++ +
  ABD99261.1   212    TTFKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSR 258  

                   lvlkalrrllltlleaiaelleekvepsllylrrvGNtytaSlylaLasl
                   ++              +a+ l+++ e++ ++++ +GNt++aS +l L +l
  ABD99261.1   259 II------------RQVAKKLKQDEEKFPINIDSFGNTSAASEPLLLDEL 296  

                   lengdllaGdrillfsyGsGlaseffsltvtdgieeildaldlkelLdsr
                   +eng +++G +++l ++G+Gl+ + ++++                     
  ABD99261.1   297 IENGTVKRGMTLALSGFGGGLTVGTHIIKY-------------------- 326  

                   tllsveeYekllklrekvdfeplgslldldpgtfyLtgiddlyRryyark
                                                                     
  ABD99261.1     - -------------------------------------------------- -    

                   mslllllllmrrvvivgigvylPlgvvtneeladllggssgkilert
                                                                     
  ABD99261.1     -    ----------------------------------------------- -    

                   gigsrrgalvferavdlaaeaarealedagldpedidgvivgtatggilg
                     +++ g++v+ +a++ + + + +a+++a+l++edid++i+++a+ +i+ 
  ABD99261.1   214 --FKMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFILHQANSRIIR 261  

                   pslaaavalrlglp.gvpavtvstaCasglaalplAadl.irsgradvllllllmrpvaIvgigvylPggvvsneelwellgtsdefiavrtgig
                                                                     
  ABD99261.1   214    ----------------------------------------------F 214  

                   errgaladepavdlaleaarealedagldpedidgvivgtvtgdyalpsl
                   ++ g+++   a++   + + +a+++a+l+ edid++i      ++a++++
  ABD99261.1   215 KMDGRRVYTFATREVPQSILRAVQKANLSLEDIDYFI-----LHQANSRI 259  

                   aarvalllglpg.vpafdvdtaCasglaa