hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_16633.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABE00071.1
Accession:      [none]
Description:    lsal0 proC GIB00337CH01 "Pyrroline-5-carboxylate reductase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0051797  NAD(P)-binding Rossmann-fold domains           120.2    1.1e-34   1
0050910  NAD(P)-binding Rossmann-fold domains           114.8    2.9e-33   1
0050909  6-phosphogluconate dehydrogenase C-terminal    100.1    1.4e-27   1
0051796  6-phosphogluconate dehydrogenase C-terminal     97.5      2e-27   1
0042866  NAD(P)-binding Rossmann-fold domains            78.9    8.6e-24   1
0050269  NAD(P)-binding Rossmann-fold domains            80.9    2.1e-23   1
0047550  NAD(P)-binding Rossmann-fold domains            63.4    5.4e-18   1
0048755  NAD(P)-binding Rossmann-fold domains            54.6    3.2e-17   1
0052837  NAD(P)-binding Rossmann-fold domains            58.7    1.2e-16   1
0051873  NAD(P)-binding Rossmann-fold domains            60.6    1.1e-15   1
0052329  NAD(P)-binding Rossmann-fold domains            54.2    4.8e-15   1
0048416  NAD(P)-binding Rossmann-fold domains            51.2    1.1e-13   1
0047032  NAD(P)-binding Rossmann-fold domains            34.4    3.8e-10   1
0050443  NAD(P)-binding Rossmann-fold domains            36.2      2e-09   1
0048102  NAD(P)-binding Rossmann-fold domains            32.8    4.3e-09   1
0048454  NAD(P)-binding Rossmann-fold domains            34.0    9.8e-09   1
0047294  NAD(P)-binding Rossmann-fold domains            32.5    1.5e-08   1
0051235  NAD(P)-binding Rossmann-fold domains            31.8    6.8e-08   1
0047516  NAD(P)-binding Rossmann-fold domains            27.2    2.7e-07   1
0035535  NAD(P)-binding Rossmann-fold domains            27.8    3.2e-07   1
0044044  NAD(P)-binding Rossmann-fold domains            24.6    3.8e-06   1
0050938  NAD(P)-binding Rossmann-fold domains            22.8      6e-06   1
0042180  NAD(P)-binding Rossmann-fold domains            20.5    6.8e-06   1
0046357  NAD(P)-binding Rossmann-fold domains            21.7    1.4e-05   1
0048757  NAD(P)-binding Rossmann-fold domains            21.7    1.8e-05   1
0045243  NAD(P)-binding Rossmann-fold domains            19.0    5.3e-05   1
0050914  NAD(P)-binding Rossmann-fold domains            19.4    6.8e-05   1
0051285  NAD(P)-binding Rossmann-fold domains            18.4    0.00014   1
0049730  NAD(P)-binding Rossmann-fold domains            16.2    0.00023   1
0042534  NAD(P)-binding Rossmann-fold domains            16.1    0.00061   1
0047510  NAD(P)-binding Rossmann-fold domains            15.1    0.00073   1
0051575  NAD(P)-binding Rossmann-fold domains            14.9    0.00076   1
0036785  NAD(P)-binding Rossmann-fold domains            16.3    0.00087   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0035535    1/1       1   157 [.     1   184 []    27.8  3.2e-07
0036785    1/1       1   115 [.     1   119 [.    16.3  0.00087
0042180    1/1       1   108 [.     1   171 []    20.5  6.8e-06
0042534    1/1       1   108 [.     1   154 []    16.1  0.00061
0042866    1/1       1   180 [.     1   226 []    78.9  8.6e-24
0044044    1/1       1    80 [.     1    81 [.    24.6  3.8e-06
0045243    1/1       1   129 [.     1   197 []    19.0  5.3e-05
0046357    1/1       1   156 [.     1   196 []    21.7  1.4e-05
0047032    1/1       1   134 [.     1   159 []    34.4  3.8e-10
0047294    1/1       1    84 [.     1    80 [.    32.5  1.5e-08
0047510    1/1       1   115 [.     1   197 []    15.1  0.00073
0047516    1/1       1   130 [.     1   133 []    27.2  2.7e-07
0047550    1/1       1   194 [.     1   212 []    63.4  5.4e-18
0048102    1/1       1   156 [.     1   189 []    32.8  4.3e-09
0048416    1/1       1   154 [.     1   167 []    51.2  1.1e-13
0048454    1/1       1   183 [.     1   158 []    34.0  9.8e-09
0048755    1/1       1   174 [.     1   178 []    54.6  3.2e-17
0048757    1/1       1    69 [.     1    75 [.    21.7  1.8e-05
0049730    1/1       1    98 [.     1   107 [.    16.2  0.00023
0050269    1/1       1   161 [.     1   161 []    80.9  2.1e-23
0050443    1/1       1   163 [.     1   186 []    36.2    2e-09
0050910    1/1       1   160 [.     1   152 []   114.8  2.9e-33
0050914    1/1       1    83 [.     1   126 []    19.4  6.8e-05
0050938    1/1       1    79 [.     1    81 [.    22.8    6e-06
0051285    1/1       1    75 [.     1    97 [.    18.4  0.00014
0051797    1/1       1   161 [.     1   152 []   120.2  1.1e-34
0051873    1/1       1   159 [.     1   242 []    60.6  1.1e-15
0052329    1/1       1   161 [.     1   156 []    54.2  4.8e-15
0052837    1/1       1   156 [.     1   171 []    58.7  1.2e-16
0051235    1/1       2   126 ..     1   116 []    31.8  6.8e-08
0051575    1/1       2    79 ..     1    86 [.    14.9  0.00076
0050909    1/1     160   266 .]     1   111 []   100.1  1.4e-27
0051796    1/1     162   265 ..     1   104 []    97.5    2e-27

Alignments of top-scoring domains:
0035535: domain 1 of 1, from 1 to 157: score 27.8, E = 3.2e-07
                   *->GkkvaviGlGsmGlalAallaaaGh...eVlvwdrdpekveelaelg
                       +k+++iG G+m  a+ + l ++G++++++ +++ + +  e   ++ 
  ABE00071.1     1    -MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYSQET 46   

                   apvakylpglellgrlrattdleealadaDvvilavptpavrsvl.aela
                   +  a              + + +e+++++Dvv+lav   +v++vl++   
  ABE00071.1    47 GVSA--------------CESNSEVIEKSDVVFLAVKPIVVEKVLkEVKD 82   

                   pllkpgaivvdlstglvgtieallaallegvlalagldvldaplsgpefl
                   ++l  + ++v++ t   g   a+l  +l+ ++++++  +       p++ 
  ABE00071.1    83 SVLTHDPVLVSVVT---GVSVAELEDILGSKDVKIVRTM-------PNVN 122  

                   aeggalllvanvlltpivvgggdeealelalelleaigkrpkgkkvlviGaGgiGralaraLaeaGa...evtvadrslekaealaae
                        +k++ iG G +++a+++ L ++G++++++ + + ++++ e   +e
  ABE00071.1     1    --MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYSQE 45   

                   lggveavelDvtdeasldaalgdaDvvinaapvglh...aeiveaaleag
                     gv a        +s  +++++ Dvv+ a+ +  ++++   v++ +   
  ABE00071.1    46 T-GVSAC-------ESNSEVIEKSDVVFLAVKPIVVekvLKEVKDSVLTH 87   

                   khvvdenplaaetralleaakeagvgriDgigavsllkrllvdlpgkkvlvlGaGgiGralalalaaaga...ev
                                        +k+  +G G +++a+++ l+++g++++++
  ABE00071.1     1    ------------------MKIGFIGVGNMAKAIIEGLMSKGVeakNI 29   

                   vvvnrtlekaeelaeelgaqgdvsdleeleealggaDivvnatgaglpgl
                    + +   ++ e   +e g    vs  e+  e++++ D+v+ a+ +    +
  ABE00071.1    30 FIHSAHKSNYEVYSQETG----VSACESNSEVIEKSDVVFLAVKP----I 71   

                   llelllellkpggvvvdvayppllttallplararglgrivdglsmlvlq
                   ++e +l+ +k  ++  d ++ +                 +v g+s++ l+
  ABE00071.1    72 VVEKVLKEVKDSVLTHDPVLVS-----------------VVTGVSVAELE 104  

                   gapgfelytgskaavevitkalakelglsmvlkgkkvaviGaGliGlalalllallgl..geVvlyDinpekle
                             +k++ iG G++  a+   l+++g++++++ ++  +++  e
  ABE00071.1     1    -------MKIGFIGVGNMAKAIIEGLMSKGVeaKNIFIHSAHKSNYE 40   

                   glaadladilelllvkgrirattdlyealkgaDvviiavgvprkpgliae
                      ++             ++a+++  e+++ +Dvv++av    +++++ e
  ABE00071.1    41 VYSQETG-----------VSACESNSEVIEKSDVVFLAVKPIVVEKVLKE 79   

                   l....lkrgdllvtnasilv.diiealaklapdaivlvvsnPvdimtlva
                   +++ +l+ + +lv++++++++  +e++++                     
  ABE00071.1    80 VkdsvLTHDPVLVSVVTGVSvAELEDILG--------------------- 108  

                   lklsglpsrrvigtmfltlnvrelliklkllrlggleellvlalvyydddadlellkgkki
                                                                  +ki
  ABE00071.1     1    --------------------------------------------MKI 3    

                   aviGyGsmGlaiAlnLrdsgl...dVvlydrnevglrkgssslekaeelg
                   ++iG+G+m+ ai+ +L  +g+++++++ ++ ++      s+   + +e g
  ABE00071.1     4 GFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHK------SNYEVYSQETG 47   

                   villvltvadlaeavagADlvilavpdeatadvlee.iapllkpgail.s
                   v     ++ ++ e+++++D+v+lav++ ++++vl+e+  + l+ + +l+s
  ABE00071.1    48 VS----ACESNSEVIEKSDVVFLAVKPIVVEKVLKEvKDSVLTHDPVLvS 93   

                   fahGisidelalagillpadvdVimvaPklpgllvrs........efvgg
                   ++ G+s+ el+  +il  +dv++++++P+    + +++++ ++++ + ++
  ABE00071.1    94 VVTGVSVAELE--DILGSKDVKIVRTMPNVNVEIGEGmtalhkndNVSDE 141  

                   hpillggvpglvavhvdaseealdlalalakaigsgpagvleplrigivGlGrigqkahlpalaalpg.velvavvdrdpekaealael
                       ++ig++G+G++++ a+++ l++ + +++ + +++ +++  e + ++
  ABE00071.1     1    -MKIGFIGVGNMAK-AIIEGLMSKGVeAKNIFIHSAHKSNYEVYSQE 45   

                   lgvpvydsldelladvdaViiatptqlhaelalaatisvaelalalllalarnlpgaapllragiwrasdllglelkgktvg
                                                                 +++g
  ABE00071.1     1    -------------------------------------------MKIG 4    

                   viGlGriGlalarllaalGa...kVivydrspekleel....dglgvdsl
                   +iG G++ +a+++ l + G++++++ +++ +++  e   +++++  ++s 
  ABE00071.1     5 FIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYsqetGVSACESN 54   

                   eellkeaDvvilavpltpetkglinaellallkpgailv...nvarggvv
                    e+++++Dvv+lav      k ++ +++l+ +k+ ++  + + v+ +  v
  ABE00071.1    55 SEVIEKSDVVFLAV------KPIVVEKVLKEVKDSVLTHdpvLVSVVTGV 98   

                   deaallealkeggiagagldvfepeplppghavpdlllndgvvipllalp
                     a+l ++l ++ +                               ++ +p
  ABE00071.1    99 SVAELEDILGSKDVK-----------------------------IVRTMP 119  

                   nvvltphiagmKiaviGaGyvGlelAavla.lgheVtlvdinpeklealnegllpil
                      mKi+ iG G++  ++ + l  +g+e + + i+ ++            
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMsKGVEAKNIFIHSAHKSNY-------- 39   

                   elgldelveell..gnltattdleealkdaDlviiavgtplkdgdgrpdl
                           e+  ++ +++a  +  e+++++D+v++av+            
  ABE00071.1    40 --------EVYSqeTGVSACESNSEVIEKSDVVFLAVKP----------- 70   

                   divnavaeeiakll.gpdtivvsstvpvgtteylatpll.gidvlssPef
                     v++v++e+++ +   d ++vs+ ++v+++e+     ++++ ++     
  ABE00071.1    71 IVVEKVLKEVKDSVlTHDPVLVSVVTGVSVAELEDILGSkDVKIV----- 115  

                   lregaallhllnpdrvvvgs..........lspeaaerlralyesllkad
                           +++    v +g+ +++ ++++++s+e+ +++++l+e+++k+ 
  ABE00071.1   116 --------RTMPNVNVEIGEgmtalhkndnVSDEDYQLVKELFEKIGKV- 156  

                   vpilvtdligaelgllGdntdglgavellerlggdlkgktvlviGaGgiGravaralaaaG
                                              +++++iG G++++a+++ l+++G
  ABE00071.1     1    ------------------------MKIGFIGVGNMAKAIIEGLMSKG 23   

                   a..krvvvanrtpekaeelaeelggeavsldelaealaeaDivinatpag
                   +++k++ +++ + ++ e   +e g  + ++++  e+++++D+v++a++  
  ABE00071.1    24 VeaKNIFIHSAHKSNYEVYSQETG--VSACESNSEVIEKSDVVFLAVK-- 69   

                   lpvitlellepglllallkkgalvidlaypplvdellaeaka...vglyv
                    p+++ ++l++ +  + l  + ++++++++  v el + + +++++++++
  ABE00071.1    70 -PIVVEKVLKE-VKDSVLTHDPVLVSVVTGVSVAELEDILGSkdvKIVRT 117  

                   vdglgmlveqaaeafelmkiGliGfGevgqalasdlrergvev..laalklrsedlrelaaelg
                      mkiG+iG G +++a+ ++l ++gve +++  +  ++++ + + +e g
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMSKGVEAknIFIHSAHKSNYEVYSQETG 47   

                   velvss..elvlesdlvlsavtasaalevakslapvlsepiadtvlvlilnllrdllgarqrlsagllrlkpllglelkgkkvv
                                                                 +k++
  ABE00071.1     1    -------------------------------------------MKIG 4    

                   iiGaGnvGralakvlralGa...evtvydidesrleel....dgrvvdsl
                    iG+Gn+++a++  l + G+++++++++  ++s +e   ++++++ + s 
  ABE00071.1     5 FIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYsqetGVSACESN 54   

                   edllkdaDvviiatplnlstegllndeilkklkegailinvsrgglvdtk
                    ++++ +Dvv++a++ ++ +e++l++   ++l+++ +l+ v +g  v + 
  ABE00071.1    55 SEVIEKSDVVFLAVK-PIVVEKVLKEVKDSVLTHDPVLVSVVTGVSVAEL 103  

                   allealtkgnirgagldvfepeplleghaleslansdeivrdllevpnvi
                   + +   ++ +i+                                      
  ABE00071.1   104 EDILGSKDVKIV-------------------------------------- 115  

                   ltPhvaahgkkvgiiGlGniGkavakllkgfgmevlaydrrpke..........
                        +k+g+iG Gn+ ka+++ l++ g+e   + ++ + + +++++ ++
  ABE00071.1     1    --MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIHSAHksnyevysqe 45   

                   ..gavyvsldellaesDvvvlcapl....eaineealaalkkgailints
                   + +  + s  e++++sDvv+l++ +++++++++e+   +l ++ +l+ + 
  ABE00071.1    46 tgVSACESNSEVIEKSDVVFLAVKPivveKVLKEVKDSVLTHDPVLVSVV 95   

                   rgalvdeeallelleagkiagagldvlsgeplgld..plleldnviltph
                   +g  v e                   l+++ +  d+++ ++++nv ++  
  ABE00071.1    96 TGVSVAE-------------------LEDILGSKDvkIVRTMPNVNVEIG 126  

                   ialgMkiaiiGGtGniGsalAlrLaaaG...heVvvvsrspekaealaeeg
                      Mki++i G Gn+ +a+ + L ++G+++ ++ + s +++  e   +e 
  ABE00071.1     1    MKIGFI-GVGNMAKAIIEGLMSKGveaKNIFIHSAHKSNYEVYSQET 46   

                   lnllylpgvtaa.dlaeaaegaDvvilavppeavrevleelapll..egk
                          gv a +++ e++e++Dvv+lav+p +v++vl+e+++ + + + 
  ABE00071.1    47 -------GVSACeSNSEVIEKSDVVFLAVKPIVVEKVLKEVKDSVltHDP 89   

                   ivvdvtnglpidtllllvlsgpslaeevaellpgarvvkafntiaaarla
                   ++v+v +g+ +  l+ ++ s     + +++ +p++ v             
  ABE00071.1    90 VLVSVVTGVSVAELEDILGSKD---VKIVRTMPNVNV------------- 123  

                   dlfaglgflvlvagdde..ealklvialaaglggldpvdlgdlaaaalle
                      +g g+  l+ +d++ +e ++lv++l++++g+++ ++++d++  ++l+
  ABE00071.1   124 --EIGEGMTALHKNDNVsdEDYQLVKELFEKIGKVADIEEKDFSTFVALA 171  

                   rglpllirlgialgakaltllGLlllmlkmmkiaviGaGavGtalAallaengh...eVtlwdrneekve
                             mki++iG G++  a+   l ++g++++++ + +  ++  e
  ABE00071.1     1    -------MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYE 40   

                   llnekgenpiylpglelpenltattdleeavkdadlviiavptdalrsvl
                      ++               ++a+ +  e+++ +d+v++av   ++++vl
  ABE00071.1    41 VYSQETG-------------VSACESNSEVIEKSDVVFLAVKPIVVEKVL 77   

                   rqlakllkdvllkkgaiivsltsgipvgtlallseiieevlgghpfavls
                   +++++ +       + ++vs+  g+ v +l+ ++   +        +v +
  ABE00071.1    78 KEVKDSVL----THDPVLVSVVTGVSVAELEDILGSKD------VKIVRT 117  

                   gPefarevaeglptavtiagedeeaaellaellssiyfrvyvvdDDgiGfvellregldlkgkkvlviGaGgaaravaaallelga..kkit
                                       +k+ +iG G++a+a++ +l+++g+++k+i+
  ABE00071.1     1    -----------------MKIGFIGVGNMAKAIIEGLMSKGVeaKNIF 30   

                   ivnrtlekaealaeefgvla..tllealaeadlvvnatpagmaplvlell
                   i++ + ++ e   +e gv a +++ e+++++d+v++a++   ++ v+++l
  ABE00071.1    31 IHSAHKSNYEVYSQETGVSAceSNSEVIEKSDVVFLAVK---PIVVEKVL 77   

                   lplllellkpgllvidiaygpletpllklara...aglrvvdGlemlvgq
                    ++  ++l+++ ++++++ g  +  l +++++++++++r+++++++ +g+
  ABE00071.1    78 KEVKDSVLTHDPVLVSVVTGVSVAELEDILGSkdvKIVRTMPNVNVEIGE 127  

                   aaeafelwtgvlppvelileallealgmmkklkvaiiGaGniGlalarallalag.gaevvavadrdpekagla
                          +k+++iG+Gn++ a++++l+   g+ a+ + + + + +  +  
  ABE00071.1     1    ----MKIGFIGVGNMAKAIIEGLMS-KGvEAKNIFIHSAHKSNYE-V 41   

                   lakelgatttvnavddleelladpgvDvvieatpagahaevalaalea..
                   + +e g+ ++    ++  e++++   Dvv++a+++ ++ +v++++ + + 
  ABE00071.1    42 YSQETGVSAC----ESNSEVIEK--SDVVFLAVKPIVVEKVLKEVKDSvl 85   

                   .........................g.khvvvekptaltveeavvpl...
                   +++ + + +++ + +++ +++   + +k+v++++++ + ++e++++l+++
  ABE00071.1    86 thdpvlvsvvtgvsvaeledilgskDvKIVRTMPNVNVEIGEGMTALhkn 135  

                   ....velvelaeekgvvlgvgfgv.rflppvvkalellasgyigeivemmkigviGlGlmGlplalnlakagh...eVvvydrnpekvealkelg
                       mkig+iG G+m  +++  l+++g++++++++++ +++ +e   ++ 
  ABE00071.1     1    -MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYSQET 46   

                   apilelknltaatsleelvellkdadvvilavptpsavkevlegllpl.l
                   ++        a++s++e++   +++dvv+lav+ p +v++vl+++++ +l
  ABE00071.1    47 GV-------SACESNSEVI---EKSDVVFLAVK-PIVVEKVLKEVKDSvL 85   

                   kpgaividtstvspgt.teelaklleekgi.lfvdapvsggpagaglg.l
                     + +++   +v  g+ ++el+++l +k++++++ +p  + ++g g  +l
  ABE00071.1    86 THDPVLV---SVVTGVsVAELEDILGSKDVkIVRTMPNVNVEIGEGMTaL 132  

                   tilvggdeealekvkpllealgkkvv....llddviGplgaGllmkigfiGlGvmGlnlalnllkagf...evtvynrtaekaeelvae
                        mkigfiG+G+m ++++  l+++g++++++++++ +++ +e + +e
  ABE00071.1     1    --MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYSQE 45   

                   galelkllgalvaeslvealekadvvilmvplkiavlGaGswGtaLAvlladnghevllwgrrldpelveelnadren
                      +ki+++G G ++ a+   l+++g e      +           + ++
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMSKGVEAKNIFIH-----------SAHK 36   

                   krylpgvllpnllattdleealegadlvllavPsqalrevlkqlkpll..
                   + y      +++ a ++  e++e++d+v+lav   +++ vlk++k+ + +
  ABE00071.1    37 SNYEVYSQETGVSACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDSVlt 86   

                   kdaiivsvtkGlkkvgiiGlGlmGlalarnlaaaGy...eVvvydrspeklealaal.g
                      +k+g+iG G+m++a++ +l+++G++++++ +++ + +  e   +++g
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYSQEtG 47   

                   aevaaslaealadadvvilavplpaavkavlnglaellallkpgailidv
                   + +++s+ e+++++dvv+lav+ p +v++vl   +   ++l  + +l++v
  ABE00071.1    48 VSACESNSEVIEKSDVVFLAVK-PIVVEKVLK--EVKDSVLTHDPVLVSV 94   

                   ssglpvdtealaaalaeggi.lvaglpvfggepgaglgvltphvggdeea
                    +g  v +++l+++l ++ +++v+ +p+ + e+g g+++l    ++++e+
  ABE00071.1    95 VTG--VSVAELEDILGSKDVkIVRTMPNVNVEIGEGMTALHKNDNVSDED 142  

                   lervlpllealgktvvvlglmeikkvaviGaGlmGlgiAavlaraGl...eVvlvdinpealeral
                          +k+++iG G+m  +i   l+++G++++++ ++  + +  e + 
  ABE00071.1     1    ----MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYS 43   

                   deiaklllklvlkgllvelllgaalaritgttdl.ealadadlVieavpe
                   +e                         ++++++  e++++ d+V++av  
  ABE00071.1    44 QETG-----------------------VSACESNsEVIEKSDVVFLAV-- 68   

                   nldvklavlae.leallkpgailasntsslsitaladalg.rpgrviglh
                   ++ v+++vl+e+ +++l  + +l+s+ +++s+ +l d lg    ++++++
  ABE00071.1    69 KPIVVEKVLKEvKDSVLTHDPVLVSVVTGVSVAELEDILGsKDVKIVRTM 118  

                   ffnpvplmplve.lvpgegtspetlervlellealgktpvvvgdePmkigiiGaGnmGralaagLlkaGh..sevtvanrtpekaealaeegg
                      mkig+iG Gnm+ a++ gL+++G++++++++++ +++  e   +e g
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMSKGVeaKNIFIHSAHKSNYEVYSQETG 47   

                   v.vaaslaealadadvvilavkpqaveevlaelag....kgalvidiaag
                   v +++s+ e+++++dvv+lavkp +ve+vl+e+++ + +++ +++++++g
  ABE00071.1    48 VsACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDsvltHDPVLVSVVTG 97   

                   ipieelaealpeag.lvvrdmpnlgalvgagataltllaggdeealelve
                   ++++el+++l+++ +++vr+mpn+++++g+g+tal  + ++++e+++lv+
  ABE00071.1    98 VSVAELEDILGSKDvKIVRTMPNVNVEIGEGMTALHKNDNVSDEDYQLVK 147  

                   pllealgkvvvvenkkkrvaiiGaGriGsalaralleap.gfevvgvfdvdpekvgraie
                         +++++iG+G++++a+++ l+ ++++ + + +++++ +  +   +
  ABE00071.1     1    ---MKIGFIGVGNMAKAIIEGLMSKGvEAKNIFIHSAHKSNYEVYSQ 44   

                   glpvlgvddleelleggvdvvilavPaeaaqevadelleagvkvillppl
                   + +v ++++  e++ ++ dvv+lav   ++ +v++e+++           
  ABE00071.1    45 ETGVSACESNSEVI-EKSDVVFLAVKPIVVEKVLKEVKDS---------- 83   

                   arllvgaavvvrevdledllgrllvgldletlkvgiiGlGnigralhlrallklp.gvelv.vadrdperaeklakk
                       +k+g+iG+Gn+++a +++ l++ +++++ + + + ++++ e + ++
  ABE00071.1     1    -MKIGFIGVGNMAKA-IIEGLMSKGvEAKNIfIHSAHKSNYEVYSQE 45   

                   lgipkvyddleelldpdiDaViiatpnslhaeialakirvgiiGlgnigrahlrallklp.gvelvavvdrdpekaedfaekl
                       +++g+iG+gn+++a+++ l+  +++++ + + + ++++ e + ++ 
  ABE00071.1     1    -MKIGFIGVGNMAKAIIEGLMSKGvEAKNIFIHSAHKSNYEVYSQET 46   

                   gipkgvkvyddleellkdpdiDaliiatpnglhaelakkaleagkhvlvE
                   g++    ++++  e+++  + D++++a+                k+++vE
  ABE00071.1    47 GVS----ACESNSEVIE--KSDVVFLAV----------------KPIVVE 74   

                   KmkigiiGaGnmGsalakgllkagh...evvvadrspekaeelaeelg
                      mkig+iG+Gnm++a+++gl+++g++++++ +++ ++++ e   +e g
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMSKGVeakNIFIHSAHKSNYEVYSQETG 47   

                   vtaatsleelledaDvvilavppqlveevlkalkp.....gklvidvaag
                   v a++s+ e++e++Dvv+lav+p +ve+vlk++k+ + +++ ++++v +g
  ABE00071.1    48 VSACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDsvlthDPVLVSVVTG 97   

                   idiealaealke.ggivvrvapntgalvgagatalvagagvdeealelvl
                   +++++l+++l+++++ +vr++pn  +++g+g+tal  + +v++e+++lv+
  ABE00071.1    98 VSVAELEDILGSkDVKIVRTMPNVNVEIGEGMTALHKNDNVSDEDYQLVK 147  

                   ellealgkvvvveemkiaviGaGnyrlyaaagitnfaraaevaeevgkpeialthstitlg
                      mki++iG Gn                                     
  ABE00071.1     1    MKIGFIGVGN------------------------------------- 10   

                   aelkelalgldevvlgepvfmGsgiAlvadevlaeagmkvaligisglig
                                                        m+ a+i +     
  ABE00071.1    11 -------------------------------------MAKAIIEG----- 18   

                   sslaralkkkg...kevivsnrsaatlerle.elGvkvttdlaeAvkgAD
                         l +kg+++k++ +   + ++ e   +e Gv++  ++ e+++ +D
  ABE00071.1    19 ------LMSKGveaKNIFIHSAHKSNYEVYSqETGVSACESNSEVIEKSD 62   

                   ivilavppgdavldvlkeladal..kegailvdtstikpvvaieaaaala
                   +v+lav+p  +v++vlke++d + +++ ++++ ++ +++   +e+   l+
  ABE00071.1    63 VVFLAVKPI-VVEKVLKEVKDSVltHDPVLVSVVTGVSV---AELEDILG 108  

                   pegvr.vvdahpsggpegaglveiltg.ggseeavekvrellealGkkvv
                   +++v +v+ ++++++  g+g++ + + ++ s+e +++v el+e++Gk + 
  ABE00071.1   109 SKDVKiVRTMPNVNVEIGEGMTALHKNdNVSDEDYQLVKELFEKIGKVAD 158  

                   evpkkvgviGlGlmGlalalnlak.gf...evvvydrtpekaealaelga
                      +k+g+iG+G+m+ a++  l+++g++++++ +++ + +  e   ++ +
  ABE00071.1     1    MKIGFIGVGNMAKAIIEGLMSkGVeakNIFIHSAHKSNYEVYSQETG 47   

                   v..aaslaealaeadvvilavpapaavrevlegllpl.lkpgaividlst
                   v +++s  e+++++dvv+lav+ p +v+ vl+++++ +l  + +++ + t
  ABE00071.1    48 VsaCESNSEVIEKSDVVFLAVK-PIVVEKVLKEVKDSvLTHDPVLVSVVT 96   

                   gspldtealaealeekg.ilfldapvsggepgaragpltimaggdeeale
                   g  + +++l ++l +k +  +  +p  + e+g ++ +l    + ++e ++
  ABE00071.1    97 G--VSVAELEDILGSKDvKIVRTMPNVNVEIGEGMTALHKNDNVSDEDYQ 144  

                   rvrpllealgavvyvgdmkkvgiiGlGlmGlslalalaraGf.adeVvgydrnpeklekalelg
                       +k+g+iG+G+m  +++  l+ +G++a++++++  +++  e   ++ 
  ABE00071.1     1    -MKIGFIGVGNMAKAIIEGLMSKGVeAKNIFIHSAHKSNYEVYSQET 46   

                   atdliaatdlaealkdaDvvilavptpavrevleellpl.lkpgailidv
                   ++   a+++  e+++++Dvv+lav++ +v++vl+e+++ +l  + +l++v
  ABE00071.1    47 GV--SACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDSvLTHDPVLVSV 94   

                   ssgkpittealaeal.gervigahpvsggevgapegaladlfegplvilt
                    +g+++ +++ +   ++++++ ++p+ ++e+g+ + a           l 
  ABE00071.1    95 VTGVSVAELEDILGSkDVKIVRTMPNVNVEIGEGMTA-----------LH 133  

                   pmaggdeealelvlpllealgakvvvlpkkiaviGasddpgklgravarnllelgy...evvpvnpk......g
                        ki++iG+    g+++ a+++ l++ g +++++++ + ++ +++++
  ABE00071.1     2    --KIGFIGV----GNMAKAIIEGLMSKGVeakNIFIHSAHksnyevY 42   

                   aevlgvkvyaslaelpedvDlvviavppelvlevakeale...agvkvlv
                   ++  gv + +s +e++e+ D+v++av+p +v +v+ke+ + +  + +vlv
  ABE00071.1    43 SQETGVSACESNSEVIEKSDVVFLAVKPIVVEKVLKEVKDsvlTHDPVLV 92   

                   ekpggfne.ellelaeeag..irvvgpnclgllnakklrvgiiGaGrigrgahlralaalp.gvlelvavadrdpekaeal
                          ++g+iG+G++++ a+++ l++ ++++ + + + + + +  e +
  ABE00071.1     2    ----KIGFIGVGNMAK-AIIEGLMSKGvEA-KNIFIHSAHKSNYEVY 42   

                   aeelgiakvyddleelladpdiDaVviatpndlhaelaladeslldavtalsGsgPAyvflliealadaavklGlsrelAlelalqt
                      +e+ +++++al+Gs+PA+v+++i++la+ +vk+Gl+++ A+++a+q+
  ABE00071.1   160    EEKDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQA 206  

                   llGaaklllesglhpaelrdkvtspgGtTiagllvleegglrsalieavl
                   +lG+a  +l+s+++p el+d+v+spgGtT+agll++ee+g+   ++++v 
  ABE00071.1   207 VLGSALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVD 256  

                   aalerakelgkeldelldavtalsGsgPAyvflliealadaavklGlsrelAlelalqtll
                      + +++++al+Gs+PA+v+++i++la+ +vk+Gl++++A+++a+q++l
  ABE00071.1   162    KDFSTFVALAGSSPAFVYFFIDSLARSGVKYGLNKQKATQIAAQAVL 208  

                   GaaklllesglhpaelrdkvtspgGtTiagllvleegglrsalieavlaa
                   G+a  +l+s+++p el+d+v spgGtT+agll++ee+g+   ++++v a+
  ABE00071.1   209 GSALKVLKSDKTPWELVDDVSSPGGTTVAGLLAMEEAGFMTSIVKGVDAT 258  

                   lerakel