hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_16637.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABE00441.1
Accession:      [none]
Description:    lsal0 ABE00441.1 GIB00337CH01 "Zinc-transporting ATPase"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0048396  HAD-like                                       137.7    1.5e-40   1
0048428  HAD-like                                       125.0    5.2e-37   1
0047540  HAD-like                                       113.1    5.4e-33   1
0050690  HAD-like                                       107.9    1.7e-32   1
0051937  HAD-like                                       107.6    7.8e-31   1
0041356  HAD-like                                        95.2    1.9e-30   1
0047938  HAD-like                                       100.8    7.4e-30   1
0047721  HAD-like                                       101.2    5.9e-29   1
0043763  HAD-like                                        98.5    3.1e-28   1
0049203  HAD-like                                        99.9    4.7e-28   1
0049302  HAD-like                                        95.5    6.1e-28   1
0049197  HAD-like                                        99.6    1.1e-27   1
0044171  HAD-like                                        88.9    5.7e-25   1
0051938  Metal cation-transporting ATPase, ATP-bindin    79.6    1.3e-23   1
0052665  HAD-like                                        75.7      2e-22   1
0044221  Metal cation-transporting ATPase, ATP-bindin    79.4    2.6e-22   1
0049471  Calcium ATPase, transduction domain A           75.0    1.1e-20   1
0043284  HAD-like                                        64.1    3.4e-19   1
0051348  HAD-like                                        70.0    9.7e-19   1
0052186  HAD-like                                        65.1    2.4e-18   1
0051120  HAD-like                                        57.6      6e-15   1
0037518  HAD-like                                        50.0    4.6e-14   1
0045131  HAD-like                                        42.6    3.7e-12   1
0049473  Calcium ATPase, transmembrane domain M          40.1    4.8e-11   1
0051058  HAD-like                                        36.0    2.4e-09   1
0051800  HAD-like                                        33.6    2.9e-09   1
0046572  HAD-like                                        29.5    2.5e-07   1
0053006  HAD-like                                        26.3      3e-07   1
0051888  HAD-like                                        27.4    5.2e-07   1
0040657  HAD-like                                        27.2    6.7e-07   1
0050761  HAD-like                                        24.1    6.4e-06   1
0049814  HAD-like                                        21.5    1.5e-05   1
0049067  HAD-like                                        19.6    8.3e-05   1
0053041  HAD-like                                        19.1    0.00011   1
0052884  HAD-like                                        17.1    0.00026   1
0052765  HAD-like                                        16.8    0.00026   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0049473    1/1      45   636 ..     1   308 [.    40.1  4.8e-11
0049471    1/1     119   217 ..     1   115 []    75.0  1.1e-20
0048396    1/1     305   558 ..     1   217 []   137.7  1.5e-40
0051888    1/1     305   560 ..     1   283 []    27.4  5.2e-07
0040657    1/1     308   534 ..     1   149 []    27.2  6.7e-07
0047721    1/1     310   584 ..     1   177 []   101.2  5.9e-29
0052884    1/1     310   559 ..     1   247 []    17.1  0.00026
0043284    1/1     311   560 ..     1   271 []    64.1  3.4e-19
0047540    1/1     311   560 ..     1   210 []   113.1  5.4e-33
0049814    1/1     311   545 ..     1   164 []    21.5  1.5e-05
0051120    1/1     311   532 ..     1   232 []    57.6    6e-15
0052665    1/1     311   572 ..     1   226 []    75.7    2e-22
0053041    1/1     311   560 ..     1   224 []    19.1  0.00011
0047938    1/1     313   565 ..     1   225 []   100.8  7.4e-30
0049067    1/1     313   547 ..     1   380 []    19.6  8.3e-05
0049197    1/1     313   569 ..     1   206 []    99.6  1.1e-27
0049203    1/1     313   563 ..     1   269 []    99.9  4.7e-28
0049302    1/1     313   563 ..     1   244 []    95.5  6.1e-28
0050690    1/1     313   569 ..     1   230 []   107.9  1.7e-32
0050761    1/1     313   531 ..     1   243 []    24.1  6.4e-06
0051800    1/1     313   548 ..     1   243 []    33.6  2.9e-09
0051937    1/1     313   560 ..     1   136 []   107.6  7.8e-31
0052186    1/1     313   574 ..     1   273 []    65.1  2.4e-18
0053006    1/1     313   559 ..     1   207 []    26.3    3e-07
0037518    1/1     314   559 ..     1   256 []    50.0  4.6e-14
0041356    1/1     314   564 ..     1   267 []    95.2  1.9e-30
0043763    1/1     314   562 ..     1   169 []    98.5  3.1e-28
0045131    1/1     314   559 ..     1   220 []    42.6  3.7e-12
0051058    1/1     314   539 ..     1   124 []    36.0  2.4e-09
0051348    1/1     314   560 ..     1   260 []    70.0  9.7e-19
0044171    1/1     315   570 ..     1   229 []    88.9  5.7e-25
0046572    1/1     315   555 ..     1   222 []    29.5  2.5e-07
0048428    1/1     315   563 ..     1   285 []   125.0  5.2e-37
0051938    1/1     320   438 ..     1   113 []    79.6  1.3e-23
0044221    1/1     329   443 ..     1   136 []    79.4  2.6e-22
0052765    1/1     505   547 ..   197   244 .]    16.8  0.00026

Alignments of top-scoring domains:
0049473: domain 1 of 1, from 45 to 636: score 40.1, E = 4.8e-11
                   *->eldlhalsveevlkllntdlekGLsseeaeerlekyGpNelpekkyk
                                                                   + 
  ABE00441.1    45    ---------------------------------------------II 46   

                   sflkllleqflnpf.......nliLlvaailslilglllegegelvdyid
                   s +++l e++ n+f+ +  ++n+++ va++ +l++g           + +
  ABE00441.1    47 SAYPILKEAIENIFhgkwfdeNFLMSVATVGALAIG----------QFSE 86   

                   alvillvvlinaiigfvqeyraekalealknllap...............
                   a++++l   +  i++ +   +++k++  l ++ +++++ + + + ++++ 
  ABE00441.1    87 AIAVMLFYRVGEIFEDLAIENSKKSITNLLDIRPEyanlelngklqqvkp 136  

                   ..................................................
                   +  ++ ++++++  ++++++ +++  +++ ++++ + +++   ++++ ++
  ABE00441.1   137 ellnkgdiiivnpgekiavdgvvesgeaylntaaltgetnpllvtkdsqv 186  

                   ...............................vrselkptplqrklnrlak
                      +++++ +  + + +++++ +++++ + ++++ +k+t  +  +++++ 
  ABE00441.1   187 lsgmivensalrirvskeykdstvvkilelvQNASEKKTKTENFITKFSQ 236  

                   llliillvlallvfivllirfllllrggdwlegflnallfavalavaaiP
                   +++ ++++ a+ +  +  +     ++g+++      +l +a++ +v+ +P
  ABE00441.1   237 IYTPVIVISAIMLASIPPL-----FLGQEFQV----WLYRALIFLVISCP 277  

                   egLpavvtitlalgakrlakknalvrrlsavEtlG...............
                   ++L++++ ++ + g+   ++ ++lv+  + +E l ++++++ +++ + + 
  ABE00441.1   278 CALVISIPLSYFGGIGASSRAGILVKGSNYLEALSqakavifdktgtltr 327  

                   ..................................................
                    +  +++++ ++ + ++++++ +++++    + ++  ++++   +++ + 
  ABE00441.1   328 geffvtqiipangvskkeivklaaiaesssphpiarsivknypgniarvs 377  

                   ..................................................
                   ++++ +   + ++ + +++ + +++ +++ +++ + ++++++ +++ ++ 
  ABE00441.1   378 nveelvglgvraeyqgdtisvgnmklmnklnidgvstiedttgtvvyval 427  

                   ..................................................
                   +++   ++++ ++++++++++++  +++ ++++++ + +++++ ++++++
  ABE00441.1   428 nneyfgaievsdmiktdakvaiqglknvgidnvtmltgdkkivgknvaek 477  

                   ..................................................
                    ++ +++++   ++++++++ ++ ++ ++ +++ + +  +++ + + +++
  ABE00441.1   478 lnipnvktellpqdkvteverikseigdkgkvifvgdglndtpvlasadv 527  

                   ..................................GRriydnikkfilyll
                    +++ +   ++++++++++ ++++ ++++ ++++ R++   ++  i++ l
  ABE00441.1   528 gvamgalgsdaavevadvvlmkdnptavtrvikiARKTKMIVWENIIFAL 577  

                   ssniglvlllllaalfglplpltpvqilwinlitdglpalaLafeppepd
                   ++ + ++l+  l+++ +++ ++ +v +++i++++    al L   + e +
  ABE00441.1   578 MVKVIFLLVGALGIATMWEAVFADVGVTFIAILN----ALRLLKMKEENK 623  

                   lmkrpPrkrnesllpptalvlrdgklvevpaeelvvGDivllkagdrvPaDgvllegsdg
                       p++a +  +gkl++v+ e l  GDi+++++g+++ +Dgv+ +g+  
  ABE00441.1   119    RPEYANLELNGKLQQVKPELLNKGDIIIVNPGEKIAVDGVVESGE-- 163  

                   lllvdesaLTGEslpvlktalllldedlllldlgnlvfagtlvlsgsllg
                    ++++++aLTGE++p l t              ++ v++g +v ++ l++
  ABE00441.1   164 -AYLNTAALTGETNPLLVTK-------------DSQVLSGMIVENSALRI 199  

                   vVtatgadtllgkiarlvlnaletlgsiklvvfDkDGTLtdgep.....................
                      +n+le l++ k+v+fDk+GTLt+ge  +++++ ++ + ++++++ ++
  ABE00441.1   305    SNYLEALSQAKAVIFDKTGTLTRGEFfvtqiipangvskkeivklaa 351  

                   ......idelakalgle........eeveeltglglegeldfrevllgrl
                   +++    +++a+ +++++  +++ +  veel+glg+++e+ ++++ +g++
  ABE00441.1   352 iaesssPHPIARSIVKNypgniarvSNVEELVGLGVRAEYQGDTISVGNM 401  

                   allagl...................seeellgllaledplrpgakellaa
                   +l+ +l+++ + ++++++ ++++++ ++e+ g+++++d ++ +ak +++ 
  ABE00441.1   402 KLMNKLnidgvstiedttgtvvyvaLNNEYFGAIEVSDMIKTDAKVAIQG 451  

                   lkeagik.vaivsgdnretaeaiaeklgideenvlanelefddggyftgi
                   lk+ gi++v +++gd + + +++aekl+i++                   
  ABE00441.1   452 LKNVGIDnVTMLTGDKKIVGKNVAEKLNIPN------------------- 482  

                   vtvdarvlpkpKpeivkllleklg.peevlmvGDgvnDlpalkaadvgia
                     v  ++lp++K+  v++++++ g++ +v++vGDg nD p l+ advg+a
  ABE00441.1   483 --VKTELLPQDKVTEVERIKSEIGdKGKVIFVGDGLNDTPVLASADVGVA 530  

                   vg..gtdvakeaadivlldddlldillalllllllmmikliafDlDGTLlds.......................
                        +l+ l++ k+++fD  GTL++++  +++++ ++ + ++++++ ++
  ABE00441.1   305    SNYLEALSQAKAVIFDKTGTLTRGeffvtqiipangvskkeivklaa 351  

                   ..................................................
                   +++    + ++  +++++  +++ + ++++ +   + ++++ +++ + ++
  ABE00441.1   352 iaesssphpiarsivknypgniarvsnveelvglgvraeyqgdtisvgnm 401  

                   ...................................ddkkispetiealkk
                   + +++ +++ + ++++++ ++++++ ++++  +++ +  i   ++ a++ 
  ABE00441.1   402 klmnklnidgvstiedttgtvvyvalnneyfgaieVSDMIKTDAKVAIQG 451  

                   lkekgi.kvviaTGRplasvlpllkelgldlllllldpviaenGaliydl
                   lk+ gi+ v+  TG      ++++++l++                     
  ABE00441.1   452 LKNVGIdNVTMLTGDKKIVGKNVAEKLNI--------------------- 480  

                   dgeviysklldlelvleilellkelgilillytldgayilllldnllell
                                                                     
  ABE00441.1     - -------------------------------------------------- -    

                   lleltllglelkvvdllelldldilkilifgdpelleellellkellgdl
                                                                     
  ABE00441.1     - -------------------------------------------------- -    

                   lsvvrsgpyfleilpkgvsKgtalkallellgisleeviafGDglNDlem
                          ++  e+lp+  +K t ++++  + g ++ +vi++GDglND ++
  ABE00441.1   481 ------PNVKTELLPQ--DKVTEVERIKSEIG-DKGKVIFVGDGLNDTPV 521  

                   lelaglgvamgn.AtdevkaaadyvtdlsndedGvakaleklllkenlllkkikavifDlDGTLldsepllhyaleea...............
                         l++ kavifD  GTL+++e ++ +++++  + ++++++ +++++
  ABE00441.1   308    LEALSQAKAVIFDKTGTLTRGEFFVTQIIPANgvskkeivklaaiae 354  

                   ..................................................
                       + ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +
  ABE00441.1   355 sssphpiarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklm 404  

                   ................................gedklypgvvellkalka
                   ++ +++ + ++++++ ++++++ ++++  +++  d +  +++ +++ lk+
  ABE00441.1   405 nklnidgvstiedttgtvvyvalnneyfgaieVSDMIKTDAKVAIQGLKN 454  

                   rGy.klaivTgrpgelaeallellgllglfdgvvllngallllgdevilr
                    G++ + ++Tg   +  + ++e+l+++++   ++         +d+    
  ABE00441.1   455 VGIdNVTMLTGDKKIVGKNVAEKLNIPNVKTELL--------PQDK---- 492  

                   kpdpeiklellkellgldpeevlavGDslnDieaaraaglptilvatgna
                         ++++ +e+ g + + v++vGD+lnD +++  a++   +va+g  
  ABE00441.1   493 ---VTEVERIKSEI-GDK-GKVIFVGDGLNDTPVLASADV---GVAMGAL 534  

                   rlakiklvvfDlDGTLtdgepll........................
                       l++ k+v+fD++GTLt+ge+++++++ ++ + ++++++ +++++  
  ABE00441.1   310    ALSQAKAVIFDKTGTLTRGEFFVtqiipangvskkeivklaaiaess 356  

                   ..................................................
                     + ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++
  ABE00441.1   357 sphpiarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnk 406  

                   .........................lallalldrlrpgalealkalkeag
                    +++ + ++++++ ++++++ ++++++++++ d ++ +a+ a++ lk+ g
  ABE00441.1   407 lnidgvstiedttgtvvyvalnneyFGAIEVSDMIKTDAKVAIQGLKNVG 456  

                   i.kvaivTgrssataralleelgldevfa..ggkpkpkallalleelgls
                   i+ v ++Tg+   + + ++e+l++ +v  +    +k + ++++  e+g +
  ABE00441.1   457 IdNVTMLTGDKKIVGKNVAEKLNIPNVKTelLPQDKVTEVERIKSEIG-D 505  

                   peevaavGDginDlpalaaaglgvavg.natdevkeaadyvllsndldgv
                     +v++vGDg+nD p+la a++gva+g+ + d++ e+ad+vl++++   v
  ABE00441.1   506 KGKVIFVGDGLNDTPVLASADVGVAMGaLGSDAAVEVADVVLMKDNPTAV 555  

                   araleellllargtlrlilqnlllallynllliMslskikavlFDlDGTLvdsepliaealnelleelglpldleellra
                        ls+ kav+FD  GTL+  e+++++++ +        + l+++++ 
  ABE00441.1   310    -ALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAES 355  

                   llgklllellrrllgrggldleellrellallleelglgldleellalll
                      +++ + + + ++          +++++ + e  glg+ +e       
  ABE00441.1   356 SSPHPIARSIVKNYPGN--------IARVSNVEELVGLGVRAEY------ 391  

                   dlygtllaeelelfpgalelLeaLk.agiklaivTngsrelaeallerlg
                           ++ ++  g  +l+++L + g+ ++  T g++ +++   e++g
  ABE00441.1   392 --------QGDTISVGNMKLMNKLNiDGVSTIEDTTGTVVYVALNNEYFG 433  

                   lddyfdgvvtsddvg...................................
                     ++ d + t   v ++  +++ ++++++ + +++++ ++++++ ++ ++
  ABE00441.1   434 AIEVSDMIKTDAKVAiqglknvgidnvtmltgdkkivgknvaeklnipnv 483  

                   ......vgKPdpeiyllalerlgvdpeevlmvGDslenDieaakaaGlrl
                   +++     K     ++++  ++g d ++v++vGD+l nD + ++ a+++ 
  ABE00441.1   484 ktellpQDK--VTEVERIKSEIG-DKGKVIFVGDGL-NDTPVLASADVG- 528  

                   tvlvarg.napeelleagadyvi..dslaellelllelllllllsMkkiklilfDlDGTLldsd............................
                        + k+++fD++GTL+ ++  +++++ ++ + ++++++ +++++   
  ABE00441.1   311    LSQAKAVIFDKTGTLTRGEffvtqiipangvskkeivklaaiaesss 357  

                   ..................................................
                    + ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++ 
  ABE00441.1   358 phpiarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnkl 407  

                   ...............................dkispeviealaalreagi
                   +++ + ++++++ ++++++ ++++  ++++ d+i  +++ a++ l++ gi
  ABE00441.1   408 nidgvstiedttgtvvyvalnneyfgaievsDMIKTDAKVAIQGLKNVGI 457  

                   k.vviaTGrpletaleiakelgldlpldyvitengaliydlkdgevlllk
                    +v ++TG++    +++a++l+++                  + e+l   
  ABE00441.1   458 DnVTMLTGDKKIVGKNVAEKLNIPNV----------------KTELL--- 488  

                   gldeelleellelllelgldlllesldgayieeknealaylaelllllpl
                                                                     
  ABE00441.1     - -------------------------------------------------- -    

                   ypgvlellealkarglklaivtggdrllalllllllglddfldvvlsgdt
                                                                     
  ABE00441.1     - -------------------------------------------------- -    

                   vleikpkpvsKaealklllerlgidpeevlaiGDganDiemlkaagvgva
                          p++K + +++++ + g d+  v+++GDg+nD + l+ a+vgva
  ABE00441.1   489 -------PQDKVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVA 530  

                   vg.ngteelkeaadyvtdsndedgvlralekllLvlgkiklivfDlDGTLtdsetiea........................
                      l++ k+++fD++GTLt++e+++++++ ++ + ++++++ +++++   
  ABE00441.1   311    LSQAKAVIFDKTGTLTRGEFFVTqiipangvskkeivklaaiaesss 357  

                   .....................lkelagkgirvllatgrallglldlleel
                    + ++  +++++  +++ + +++el+g+g+r+ + +  + +g+++l+ +l
  ABE00441.1   358 phpiarsivknypgniarvsnVEELVGLGVRAEYQGDTISVGNMKLMNKL 407  

                   gldla..........llaengaevlgllaledplrpgakellealkeagi
                   ++d   ++++++ ++++++++ e++g++ + d+++ +ak +++ lk+ gi
  ABE00441.1   408 NIDGVstiedttgtvVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGI 457  

                   k.vaivtgdnretaeaileelglddvfanvlegddgrstglvleivvkpk
                    +v ++tgd +++ + ++e+l++++v  ++l                 p 
  ABE00441.1   458 DnVTMLTGDKKIVGKNVAEKLNIPNVKTELL-----------------PQ 490  

                   pKpeallalleklgidpeevlavGDgvnDlpmlkaagvgiamn..gtdvl
                   +K++ +++++++ g d  +v++vGDg+nD p l+ a+vg+am++ g+d++
  ABE00441.1   491 DKVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGalGSDAA 539  

                   keaAdyvllsndelgvakaleMlkkikavifDlDgTLvdseplllealdelleelglellll......
                       l++ kavifD  gTL+ +e+++++++++        + l+++++  
  ABE00441.1   311    -LSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAaiaess 356  

                   ..................................................
                     + ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++
  ABE00441.1   357 sphpiarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnk 406  

                   .............................leelklfpgvlellkalkerg
                    +++ + ++++++ ++++++ ++++  +++    +  +++ +++ lk+ g
  ABE00441.1   407 lnidgvstiedttgtvvyvalnneyfgaiEVSDMIKTDAKVAIQGLKNVG 456  

                   i.klaivTngsrlelaealleklglddyfdaivssddpkpeiylkalekl
                   i+ + ++T++  + + + ++ekl+++++   ++  d  k   ++++ +++
  ABE00441.1   457 IdNVTMLTGDKKI-VGKNVAEKLNIPNVKTELLPQD--KVTEVERIKSEI 503  

                   gldpeevlfvgDslndieaakaaGlktvlvnrgytlkelldladdlaell
                   g d  +v+fvgD+lnd + +  a++++++ + g   + + +++       
  ABE00441.1   504 G-DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADV------- 545  

                   alllmmikliafDlDGTLldsdkyispeaiealkalrea.gikvvlaTgr
                      l + k+++fD++GTL+ ++  +++   +     +e + +  +  ++ 
  ABE00441.1   311    LSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIvKLAAIAESSS 357  

                   plaealplleelgldglpviaenGalvydpksll........lldgevly
                   p++ a+ +++ ++ ++        a+v ++++l+   + +++ +d   + 
  ABE00441.1   358 PHPIARSIVKNYPGNI--------ARVSNVEELVglgvraeyQGDTISVG 399  

                   elgldlelllellellkelgitvllytgdg...gyialadllgldavval
                   +  l  +l ++ ++++++   tv++++ + ++ g+i+++d+++ da+va+
  ABE00441.1   400 NMKLMNKLNIDGVSTIEDTTGTVVYVALNNeyfGAIEVSDMIKTDAKVAI 449  

                   lalldlgilkv.lltgddellaelialllglllvvvsggrfleilpkgvs
                   + l++ gi  v++ltgd++ + + +a+ l++ +v        e+lp++  
  ABE00441.1   450 QGLKNVGIDNVtMLTGDKKIVGKNVAEKLNIPNVK------TELLPQD-- 491  

                   KgaalklllellgillssleeviafGDglNDlpmLeaaglgvamgnAtlkkkklvifDfDGTltdsdsidelaellg.gpevaaltelamgggls
                      l++ k+vifD++GTlt+++ +++ +  ++   + + ++ +a++ + s
  ABE00441.1   311    LSQAKAVIFDKTGTLTRGEFFVTQIIPANgVSKKEIVKLAAIAESSS 357  

                   feealrrrlellkglpeee...............................
                   +  + r +++ ++g    + ++++ +   + ++++ +++ + +++ +++ 
  ABE00441.1   358 PHPIARSIVKNYPGNIARVsnveelvglgvraeyqgdtisvgnmklmnkl 407  

                   .......................llellaedlplrpgakellkklkergi
                   +++ + ++++++ ++++++ ++++ + ++  ++++ +ak +++ lk+ gi
  ABE00441.1   408 nidgvstiedttgtvvyvalnneYFGAIEVSDMIKTDAKVAIQGLKNVGI 457  

                   p.laivSggfgefiealleklglp...dyifanellfddggltgvvlgad
                   +++ +++g+ + + + ++ekl++p+++                       
  ABE00441.1   458 DnVTMLTGDKKIVGKNVAEKLNIPnvkTEL-------------------- 487  

                   vfgrrkpkpelkleileelgldpeevimiGDgvnDleaakaadlgiamgg
                      ++k     +++i  e+g ++ +vi++GDg+nD + ++ ad+g+amg 
  ABE00441.1   488 -LPQDK--VTEVERIKSEIGDKG-KVIFVGDGLNDTPVLASADVGVAMGA 533  

                   .gkdeakeaadpvlviddlselldllkellevinnikqvlmmikaviFDlDGTLv...............................
                      l++ kaviFD  GTL+  +  +++++ ++ + ++++++ +++++   
  ABE00441.1   311    LSQAKAVIFDKTGTLTrgeffvtqiipangvskkeivklaaiaesss 357  

                   .........dsepliaaalnealaelglpllteellrallglslrellrr
                    + ++  ++  +p  +a +  + + +gl +  +e+    + ++ + l+ +
  ABE00441.1   358 phpiarsivKNYPGNIARVSNVEELVGLGV-RAEYQGDTISVGNMKLMNK 406  

                   llellglllglgldeeeleelleaylelylellleelrlypgvlelLeal
                   l          ++ + +   ++ a++++y+ ++     +  +++ +++ l
  ABE00441.1   407 LNIDGVS----TIEDTTGTVVYVALNNEYFGAIEVSDMIKTDAKVAIQGL 452  

                   kargik.lavvTngprelaeallealglddyfdaivssddvgvgKPdpei
                   k+ gi ++ ++T++   + + ++e+l++ ++   ++           p+ 
  ABE00441.1   453 KNVGIDnVTMLTGDKKIVGKNVAEKLNIPNVKTELL-----------PQD 491  

                   fllalerlgv...dpeevlmvGDslnDilaAkaaGmrtvgvargy.gple
                       +er++ ++ d ++v++vGD lnD    ++a+   vgva+g  g+++
  ABE00441.1   492 KVTEVERIKSeigDKGKVIFVGDGLNDTPVLASAD---VGVAMGAlGSDA 538  

                   eleaagadlviddlseLldlLeHkiklilfDlDGTLtdsdpti..........................
                       + k+++fD++GTLt+++  +++++ ++ + ++++++ +++++    
  ABE00441.1   313    -QAKAVIFDKTGTLTRGEFFVtqiipangvskkeivklaaiaesssp 358  

                   spaaiaalaalaekgipvviatgrsleevlellgelglrgllialngalv
                   +p+a+ +++ +      ++ +++          +el + g+++ + g  +
  ABE00441.1   359 HPIARSIVKNY---PGNIARVSNV---------EELVGLGVRAEYQGDTI 396  

                   lllge.................................laledplrpgvk
                   ++++ + +++ +++ + ++++++ ++++++ ++++  ++ + d ++ ++k
  ABE00441.1   397 SVGNMklmnklnidgvstiedttgtvvyvalnneyfgaIEVSDMIKTDAK 446  

                   elleelkeagi.kvaivtgdnelllllldldletaeaiakelgdlfdvvl
                    +++ lk+ gi+ v ++tgd             + + +a++l+       
  ABE00441.1   447 VAIQGLKNVGIdNVTMLTGDKK----------IVGKNVAEKLN------- 479  

                   sgdvvaevkpdgvdKpealeallerlgldpeevlmvGDgvnDlpalka.g
                   + +v  e++p+  dK++ +e+++++ g d  +v++vGDg+nD p l+ ++
  ABE00441.1   480 IPNVKTELLPQ--DKVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASaD 526  

                   vlgiavg.ngtdvlkeaadyvlldddldgvlealeelnlliklvlfDlDGtLlnddklipgakealkelkkgikvviaTgrsylsvl
                                                                     
  ABE00441.1     -    ----------------------------------------------- -    

                   elleelgllgivvtnngilvldlslgllneldlllllsllvlaeylkell
                                                                     
  ABE00441.1     - -------------------------------------------------- -    

                   lgnlvyvlgedgliylklllilllllnlmmmikaviFDlDGTLvdsepli
                                                 + kaviFD  GTL+  e ++
  ABE00441.1   313 ------------------------------QAKAVIFDKTGTLTRGEFFV 332  

                   leafne.......................................ealee
                   ++++  + + ++++++ +++++    + ++  +++++  +++ +  + e 
  ABE00441.1   333 TQIIPAngvskkeivklaaiaesssphpiarsivknypgniarvsNVEEL 382  

                   lglelldleelrrliglgleeileellg......lseeeieellelyrel
                   +gl  +  e+   +i  g  +++++l +++ + ++ + +   ++ +++++
  ABE00441.1   383 VGLG-VRAEYQGDTISVGNMKLMNKL-NidgvstIEDTTGTVVYVALNNE 430  

                   ykelllelldelklypgvkelLeeLkeaGik.laiaTnkprelaealler
                   y+ +++       +  ++k +++ Lk+ Gi ++  +T++ +   + + e+
  ABE00441.1   431 YFGAIE---VSDMIKTDAKVAIQGLKNVGIDnVTMLTGDKKIVGKNVAEK 477  

                   lglldyfdaelivggddvllriellrkgvglgKPdPeilllalerlgKae
                   l++ +  +   ++  d v           +                   e
  ABE00441.1   478 LNIPNVKTE--LLPQDKV-----------T-----------------EVE 497  

                   aikrlleelgivdpeevlmvGDslnDilaakaaGmktigvltGvamgnsr
                    ik  +      d+ +v++vGD+lnD      a+   +gv++G     + 
  ABE00441.1   498 RIKSEI-----GDKGKVIFVGDGLNDTPVLASAD---VGVAMGA---LGS 536  

                   eelkaagadyvidslaeLldlLeellklekiklvvfDlDGTLtdedi.............................
                      + k+v+fD++GTLt++++ +++++ ++ + ++++++ +++++    +
  ABE00441.1   313    QAKAVIFDKTGTLTRGEFfvtqiipangvskkeivklaaiaesssph 359  

                   ...................lelaaeagir.....vtlatgrgl......l
                    ++  +++++  +++ + ++e++   g+r++++  t+  g++  +++ ++
  ABE00441.1   360 piarsivknypgniarvsnVEELVGLGVRaeyqgDTISVGNMKlmnklnI 409  

                   dfaellrervallaengalledlgelaledplrpgalelldalk.agik.
                   d +  ++  + +++++ ++ e++g++ ++d+++ +a+ +++ lk+ gi++
  ABE00441.1   410 DGVSTIEDTTGTVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKnVGIDn 459  

                   vvivsgdftetaepiakelgldelfanvlevddsgltvleikpspeqKae
                   v +++gd + + +++a++l+++++  ++l               p++K+ 
  ABE00441.1   460 VTMLTGDKKIVGKNVAEKLNIPNVKTELL---------------PQDKVT 494  

                   alealg...idgeeviavGDgaNDlpmlkaAglgvam..nakdavkeaad
                    +e+++ ++ d  +vi+vGDg+ND+p l+ A++gvam + ++da++e+ad
  ABE00441.1   495 EVERIKseiGDKGKVIFVGDGLNDTPVLASADVGVAMgaLGSDAAVEVAD 544  

                   yvllsndldgvllalelgratlrnimikliafDlDGTLldndmtvslpetiealkklkekgikvviaTgrpl
                        k+++fD++GTL++++  v+                          
  ABE00441.1   313    QAKAVIFDKTGTLTRGEFFVT-------------------------- 333  

                   asvlklleelglddpliaenGaliyddgevllltgldrellleilellae
                                               ++++ +g +++++ ++++++++
  ABE00441.1   334 ----------------------------QIIPANGVSKKEIVKLAAIAES 355  

                   lglrvlaladkdgvy...................................
                      + +a + ++ +  +++ + ++++ +   + ++++ +++ + +++ ++
  ABE00441.1   356 SSPHPIARSIVKNYPgniarvsnveelvglgvraeyqgdtisvgnmklmn 405  

                   ...................lekdltllgllalldplrpgvvealeelkda
                   + +++ + ++++++ +++++  +++++g +++ d ++ +++ a++ lk+ 
  ABE00441.1   406 klnidgvstiedttgtvvyVALNNEYFGAIEVSDMIKTDAKVAIQGLKNV 455  

                   gi.kvaiitgdneeldeaeailkelgidlvdvvlsggvfldilpkgvdKg
                   gi+ v ++tgd++++   ++++++l+i+ v          ++lp+  dK 
  ABE00441.1   456 GIdNVTMLTGDKKIV--GKNVAEKLNIPNVK--------TELLPQ--DKV 493  

                   ealkallerlgispeevaaiGDgvNDlpmlkaagvgvamg.natdelkea
                   + +++++ + g ++ +v+++GDg+ND p l+ a+vgvamg+ ++d++ e+
  ABE00441.1   494 TEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGaLGSDAAVEV 542  

                   adyvlldnnedgvaealeellliydnikMkiklilfDlDGTLldgdplipaliea.............laalekg
                       + k+++fD++GTL++g+ +++ +i+a+ + ++++++ +++a+    
  ABE00441.1   313    -QAKAVIFDKTGTLTRGEFFVTQIIPAngvskkeivklaaIAES--- 355  

                   ipvvlvTgrplaeieellkelglglpd....eliaengaliyvlggevl.
                          + p++ ++ ++k +  ++  + ++e +++ g+++ + g+++ +
  ABE00441.1   356 -------SSPHPIARSIVKNYPGNIARvsnvEELVGLGVRAEYQGDTISv 398  

                   gllellleeylelleelllllll..................plrpgakel
                   g+++l+  + ++ +  +  +++ +++++ ++++  ++++ + ++ +ak +
  ABE00441.1   399 GNMKLMNKLNIDGVSTIEDTTGTvvyvalnneyfgaievsdMIKTDAKVA 448  

                   .....eagi.klaihvtlgdneetaeaiakellsllpgldevfsgvvgae
                   ++  ++ gi+ + + +t gd   + + +a++l     ++  v       e
  ABE00441.1   449 iqglkNVGIdNVTM-LT-GDKKIVGKNVAEKL-----NIPNVK-----TE 486  

                   vlpegkpKpealeallerlgidpeevlmvGDglnDipmlkaagvgvavg.
                   +lp++  K++ +e+++++ g d+ +v++vGDglnD p l+ a+vgva+g+
  ABE00441.1   487 LLPQD--KVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGa 533  

                   ngtdelkeaadelglpplyvllsndldgvaealelllllsmiklilfDlDGTLtdsehliaealiealaelaek.gipvvivtgrpl
                        k+++fD++GTLt++e ++++++ +     +e ++++ +  ++ p+
  ABE00441.1   313    QAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIvKLAAIAESSSPH 359  

                   eellellgelglrlyliaengalildpdgel...................
                   + ++ +++ ++ +++ +     l+ ++ +++++ +++ + +++ +++ ++
  ABE00441.1   360 PIARSIVKNYPGNIARVSNVEELVGLGVRAEyqgdtisvgnmklmnklni 409  

                   .............lalaldlyllgllalld.lrpgarellaelkeagik.
                   + + ++++++ +++++al+ ++ g ++++d+++ +a+ +++ lk+ gi +
  ABE00441.1   410 dgvstiedttgtvVYVALNNEYFGAIEVSDmIKTDAKVAIQGLKNVGIDn 459  

                   vaivtgdnretaeaiaeelgldfdvvvsgvfaevlpekpdKpeallalle
                   v ++tgd   + + +ae+l+++      +v  e+lp+  dK++ ++++++
  ABE00441.1   460 VTMLTGDKKIVGKNVAEKLNIP------NVKTELLPQ--DKVTEVERIKS 501  

                   rlgvdpeevlmvGDgvnDlpalkaagvgvavg.ngtdvakeaadyvlldd
                   + g d  +v++vGDg+nD p l+ a+vgva+g+ g+d+a e+ad+vl++d
  ABE00441.1   502 EIG-DKGKVIFVGDGLNDTPVLASADVGVAMGaLGSDAAVEVADVVLMKD 550  

                   dldgvlealeelrlllgnimikliafDlDgTLldgd.....ispe.....................
                        k+++fD  gTL++g+  +++i+p++ + ++++++ +++++    +
  ABE00441.1   313    QAKAVIFDKTGTLTRGEffvtqIIPAngvskkeivklaaiaesssph 359  

                   ...............tkealkklkekgikvviaTgrslaevlellkelgl
                    ++  +++++  +++ +  +++l+++g++  +       + ++l+++l++
  ABE00441.1   360 piarsivknypgniaRVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNI 409  

                   ddpviae..nGaliydp.geeii.....kplllelalellellkelgi.k
                   d+    e++ G+++y+  ++e++ +++++++ + +a+ +++ lk+ gi++
  ABE00441.1   410 DGVSTIEdtTGTVVYVAlNNEYFgaievSDMIKTDAKVAIQGLKNVGIdN 459  

                   ivlvsgdnlytlkpiaellgldellaaeltgldglllllalereilkill
                   + +++gd+ ++ k +ae+l++  +  + l+                    
  ABE00441.1   460 VTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ------------------- 490  

                   flddelleeladalsvvrsggrvleilpkgvsKgsalkalleklgiddle
                                                  +K++ +++++ + g d ++
  ABE00441.1   491 -------------------------------DKVTEVERIKSEIG-D-KG 507  

                   eviafGDslNDleMleaaglgvamgnadpelkndedgvaealekllMkikliafDlDGTLldsdktispeaiealkrlaek..ipvvivTgrp
                       + k+++fD  GTL++++ ++++ + +     +e ++   +  ++ p
  ABE00441.1   313    -QAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIvkLAAIAESSSP 358  

                   lagllellgegllglpdyliaenGaliyddgellylagldaelleelldl
                   +  +++++++                  ++g++  +   ++ +   ++++
  ABE00441.1   359 HPIARSIVKN------------------YPGNIARVSNVEELVGLGVRAE 390  

                   leelllell..........delyl.ertpglvieakelsltlhvrdalel
                   +++  + + +++ +++ ++d++ ++e t g+v++      +++++++ ++
  ABE00441.1   391 YQGDTISVGnmklmnklniDGVSTiEDTTGTVVYVALNNEYFGAIEVSDM 440  

                   lkergiklliitndelleellallealglelgldvvlsgd..........
                   +k             +++ +++ l+++g++  ++ + + ++++ ++++++
  ABE00441.1   441 IKT------------DAKVAIQGLKNVGID-NVTMLTGDKkivgknvaek 477  

                   .....ivleilpkgvdKgtalkal...lgidpeevlaiGDslleggnDie
                    ++ ++  e+lp   dK t +++++ + g d+ +v+++GD+l    nD +
  ABE00441.1   478 lnipnVKTELLP--QDKVTEVERIkseIG-DKGKVIFVGDGL----NDTP 520  

                   mlkaagllgvavg..appelkeaAedldgkiklvvfDkdGTLtdg...............................
                      + k+v+fDk+GTLt+g+  +++++ ++ + ++++++ +++++    +
  ABE00441.1   313    QAKAVIFDKTGTLTRGeffvtqiipangvskkeivklaaiaesssph 359  

                   ..................................................
                    ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++ ++
  ABE00441.1   360 piarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnklni 409  

                   .........................laledplrpgakealkalkeagi.k
                   + + ++++++ ++++++ ++++  ++ + d ++ +ak a++ lk+ gi+ 
  ABE00441.1   410 dgvstiedttgtvvyvalnneyfgaIEVSDMIKTDAKVAIQGLKNVGIdN 459  

                   vvilTgdnlltaeaiakelgldlvfarvlpvdKaaavkllla....geev
                   v +lTgd  ++ +++a++l++  v  ++lp+dK++ v+++++++ ++++v
  ABE00441.1   460 VTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEVERIKSeigdKGKV 509  

                   aavGDglnDlpalkaagvgvamg.natdvakeaadivlldndllgvllal
                   ++vGDglnD p+l+ a+vgvamg+ ++d+a+e+ad+vl++++ + v +++
  ABE00441.1   510 IFVGDGLNDTPVLASADVGVAMGaLGSDAAVEVADVVLMKDNPTAVTRVI 559  

                   edparlldlllklvmkgmkiklviFDlDGTLldfdseplllaalneal
                                       + k+viFD  GTL+                
  ABE00441.1   313    -----------------QAKAVIFDKTGTLTR--------------- 327  

                   kelgllppedldelrkllglglrellaglltelalrgefeellrerlall
                          + ++ ++   +g++ +e+++ +  ++   ++  +         
  ABE00441.1   328 ------GEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIA--------- 362  

                   aelglfleeyeellae..................................
                         ++ y  ++a++ ++++ +   + ++++ +++ + +++ +++ ++
  ABE00441.1   363 ---RSIVKNYPGNIARvsnveelvglgvraeyqgdtisvgnmklmnklni 409  

                   ...........................iedplrpgakellealkaaGi.k
                   + + ++++++ ++++++ ++++  +++++d++  +ak +++ lk+ Gi+ 
  ABE00441.1   410 dgvstiedttgtvvyvalnneyfgaieVSDMIKTDAKVAIQGLKNVGIdN 459  

                   laivTggprefaeaileklglddyfdvvvgsdlevdedgeltglvedvvf
                   + ++Tg+ + + + ++ekl++++   +++                     
  ABE00441.1   460 VTMLTGDKKIVGKNVAEKLNIPNVKTELL--------------------- 488  

                   gkpkpeallealerlglll.dpeevlmvGDsvnDlpalkaagivgiavgn
                       p+++   +er++  + d+ +v++vGD++nD p l+ a+ vg+a+g 
  ABE00441.1   489 ----PQDKVTEVERIKSEIgDKGKVIFVGDGLNDTPVLASAD-VGVAMGA 533  

                   .gt.vakeladivlldddladilkaleegrliydnilkfilMkikaviFDlDGTLv................................
                       + kaviFD  GTL+  +  +++++ ++ + ++++++ +++++    
  ABE00441.1   313    -QAKAVIFDKTGTLTrgeffvtqiipangvskkeivklaaiaesssp 358  

                   ........dsepliaaalnealeelglplslellrrllglglrellrrll
                   + ++  ++  +p  +a +  + e +gl + +e+   ++ +g ++l+ +l 
  ABE00441.1   359 hpiarsivKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLN 408  

                   ......lleelleelleeflelylell.eelelfpgvlelLealka.gi.
                   ++ + ++ + +   ++ ++++ y+++++    +  +++ +++ lk++gi+
  ABE00441.1   409 idgvstIEDTTGTVVYVALNNEYFGAIeVSDMIKTDAKVAIQGLKNvGId 458  

                   klavvTngsrelaeallealglldyfdaivtsddvgrgKPdpdifllale
                    + ++T++ + + + + e+l++ +     v  + ++  K       + +e
  ABE00441.1   459 NVTMLTGDKKIVGKNVAEKLNIPN-----VKTELLPQDK------VTEVE 497  

                   rlgv...dpeeclmvGDslndieaakaaGmrtvgvatgyapeeel.agad
                   r++ ++ d +++++vGD+lnd    ++a+   vgva+g    ++ ++ ad
  ABE00441.1   498 RIKSeigDKGKVIFVGDGLNDTPVLASAD---VGVAMGALGSDAAvEVAD 544  

                   lvi..dslaeLlellmikaviFDlDGTLvdseplv...........................
                        kaviFD++GTL+  e +v++++ ++ + ++++++ +++++    +
  ABE00441.1   314    -AKAVIFDKTGTLTRGEFFVtqiipangvskkeivklaaiaesssph 359  

                   ............iaealnealeelglplsleeirsliglglrellralle
                    ++  +++++   ++    + e  gl +  e+   +i++g ++l+ +l  
  ABE00441.1   360 piarsivknypgNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNI 409  

                   elgvlllllellgrllleediealleellelylellaellppfpgvkell
                   +             ++ +   ++++ +l+ +y++++ + + ++ ++k ++
  ABE00441.1   410 DG----------VSTIEDTTGTVVYVALNNEYFGAIEVSDMIKTDAKVAI 449  

                   eaLkerGi.klavvTnkprelaealleelgledyffdvivtaddvpagKP
                   + Lk+ Gi+ + ++T++   + + ++e+l++ ++  +++           
  ABE00441.1   450 QGLKNVGIdNVTMLTGDKKIVGKNVAEKLNIPNVKTELL----------- 488  

                   dPeillkaleelg...vepleevlmvGDslnDiqaaraAGmttvgvatgl
                    P+ + + +e+   ++ +   +v++vGD+lnD + + +A+   vgva+g 
  ABE00441.1   489 -PQDKVTEVERIKseiGDK-GKVIFVGDGLNDTPVLASAD---VGVAMGA 533  

                   nllglsleelqalslaelellragsaeellaagadlvidslseLlelLdd
                                          gs+++++ a+++l+ d+++ +  ++  
  ABE00441.1   534 ----------------------LGSDAAVEVADVVLMKDNPTAVTRVI-- 559  

                   inMikliafDlDGTLldsdktiseet.......................
                        k+++fD++GTL++++  +++++ ++ + ++++++ +++++    +
  ABE00441.1   314    -AKAVIFDKTGTLTRGEFFVTQIIpangvskkeivklaaiaesssph 359  

                   ................iealkklke.gikvviaTgrplasvlellkelgl
                    ++  +++++  +++ ++ +++l++ g+   +       + ++l+++l++
  ABE00441.1   360 piarsivknypgniarVSNVEELVGlGVRAEYQGDTISVGNMKLMNKLNI 409  

                   dgdpliasnGalvydldgevlllkgldeelllellellaelglrvlllal
                   d                                        g+ ++  ++
  ABE00441.1   410 D----------------------------------------GVSTIEDTT 419  

                   dgvyileedlellgllalldplrpgvkelleelkkagi.kvaiitgdnee
                   ++v++++ + e++g +  +d ++ ++k +++ lk+ gi+ v ++tgd + 
  ABE00441.1   420 GTVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIdNVTMLTGDKKI 469  

                   laellailkelgldyfdvvlsgdvfleikpkgvdKgealkalleklgidp
                   + +  +++++l+++        +v  e++p+  dK + +++++++ g d+
  ABE00441.1   470 VGK--NVAEKLNIP--------NVKTELLPQ--DKVTEVERIKSEIG-DK 506  

                   eevlavGDglNDlpmlkaaglgvamg.natdeakeaadyvlldndedgva
                    +v++vGDglND p l+ a++gvamg+ ++d+a e+ad+vl+++++++v 
  ABE00441.1   507 GKVIFVGDGLNDTPVLASADVGVAMGaLGSDAAVEVADVVLMKDNPTAVT 556  

                   ealeelrlifdnikliafDldgtllgli...............................
                       k+++fD++gtl+ ++  +++++ ++ + ++++++ +++++    + 
  ABE00441.1   314    AKAVIFDKTGTLTRGEffvtqiipangvskkeivklaaiaesssphp 360  

                   ..................................................
                   ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++ +++
  ABE00441.1   361 iarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnklnid 410  

                   .........................aiedplrpgvkeaikalreagi.kv
                    + ++++++ ++++++ ++++  ++ + d ++ ++k ai+ l++ gi+ v
  ABE00441.1   411 gvstiedttgtvvyvalnneyfgaiEVSDMIKTDAKVAIQGLKNVGIdNV 460  

                   vilTGdnlltalaiakelgidtllialnglvltgkllellldelllelll
                    +lTGd++++ +++a++l+i +                            
  ABE00441.1   461 TMLTGDKKIVGKNVAEKLNIPN---------------------------- 482  

                   davvfarvspedKaeavkal...gisgevvaavGDgvNDapalkaAdvgv
                      v  +++p+dK++ v++++ +  +  +v++vGDg+ND p+l+ Advgv
  ABE00441.1   483 ---VKTELLPQDKVTEVERIkseIGDKGKVIFVGDGLNDTPVLASADVGV 529  

                   Amg.natdvakeaAdivlldndldgvllaleegMikavlfDldGTLv...........................dsepvl
                        kav+fD++GTL+  +  +++++ ++ + ++++++ ++++ s++++
  ABE00441.1   314    -AKAVIFDKTGTLTrgeffvtqiipangvskkeivklaaiaESSSPH 359  

                   aaalnealeelglpldleelralvglglrellgglldfgelleealalll
                     a   + +  g       +++lvglg+r+ ++g       +      l+
  ABE00441.1   360 PIARSIVKNYPGNIARVSNVEELVGLGVRAEYQGDT-----ISVGNMKLM 404  

                   eelgldlle.............ellelyralllelplfpgvvelLealka
                    +l++d + ++++++ +++++++  e++ a+  ++ +  +++ +++ lk+
  ABE00441.1   405 NKLNIDGVStiedttgtvvyvaLNNEYFGAIEVSDMIKTDAKVAIQGLKN 454  

                   aGi.klailTngsrelaeallerlglddyfdavlssddvgvaKPdpeiyl
                    Gi+ + +lT++   + + ++e+l+++++   +l           p+ + 
  ABE00441.1   455 VGIdNVTMLTGDKKIVGKNVAEKLNIPNVKTELL-----------PQDKV 493  

                   lalerlgv...dpeevlfvgDslndilaakaaGmrtvgvarggngldele
                     +er++ ++ d ++v+fvgD+lnd + ++ a+   vgva+g  g d++ 
  ABE00441.1   494 TEVERIKSeigDKGKVIFVGDGLNDTPVLASAD---VGVAMGALGSDAAV 540  

                   eaadlvi..ddlaeLlellikllvlDlDGTLldsd...............................
                       k++++D  GTL++++  +++++ ++ + ++++++ +++++    + 
  ABE00441.1   314    AKAVIFDKTGTLTRGEffvtqiipangvskkeivklaaiaesssphp 360  

                   ..................................................
                   ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++ +++
  ABE00441.1   361 iarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnklnid 410  

                   ......................gllleelklrpgviealkklkeaGi.ki
                    + ++++++ ++++++ ++++ g +  ++ +  +++ a++ lk+ Gi+ +
  ABE00441.1   411 gvstiedttgtvvyvalnneyfGAIEVSDMIKTDAKVAIQGLKNVGIdNV 460  

                   viaTgrslrtaealleklglddyvivengalvhdkpydelllrlpidlee
                    ++Tg+  +  ++++ekl+++   + ++ +    +   e ++    d + 
  ABE00441.1   461 TMLTGDKKIVGKNVAEKLNIPN--VKTELLPQDKVTEVERIKSEIGDKGK 508  

                   vlaiGDslndiemlkaaglgvalvnagdelkikliafDlDGTLldne...............................
                       k+++fD++GTL+++e  +++++ ++ + ++++++ +++++    + 
  ABE00441.1   314    AKAVIFDKTGTLTRGEffvtqiipangvskkeivklaaiaesssphp 360  

                   ..................................................
                   ++  +++++  +++ + ++++ +   + ++++ +++ + +++ +++ +++
  ABE00441.1   361 iarsivknypgniarvsnveelvglgvraeyqgdtisvgnmklmnklnid 410  

                   ...........................ldkispetiealkklreagik.v
                    + ++++++ ++++++ ++++  ++++ d i  +++ a++ l++ gi +v
  ABE00441.1   411 gvstiedttgtvvyvalnneyfgaievSDMIKTDAKVAIQGLKNVGIDnV 460  

                   viaTGrplatalaiaeelglleddpliaenGalvyddgevlllkpldlel
                   +++TG++    +++ae+l++                              
  ABE00441.1   461 TMLTGDKKIVGKNVAEKLNI------------------------------ 480  

                   lleilellkelglllllysgdglyvlllldelllllllllllpllevvdl
                                                                     
  ABE00441.1     - -------------------------------------------------- -    

                   lllldldilkillilddellaallelldelavvrsgvvfleitpkgvsKg
                                                       +v  e++p+  +K 
  ABE00441.1   481 -----------------------------------PNVKTELLPQ--DKV 493  

                   talklllellgisleeviafGDgaNDlemlkaaglgvamg.nateevkaa
                   t +++++++ g ++  vi++GDg+ND + l+ a++gvamg+ +++++ ++
  ABE00441.1   494 TEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGaLGSDAAVEV 542  

                   adyvtdsndedgvakaleklllvkliflDlDGTLldivpdpddvvispealealkalae..gikvviaTG
                      k++++D++GTL++      + ++++ + +     +e+++ + +  + 
  ABE00441.1   315    KAVIFDKTGTLTR-----GEFFVTQIIPANGVSKKEivKLAAIAESS 356  

                   Rslaellellgl.........dlpliaenGalirdngellllllldlll.
                    ++  ++++++ +  +++ + ++    + G+ + ++g+++ +++++l+ +
  ABE00441.1   357 SPHPIARSIVKNypgniarvsNVEELVGLGVRAEYQGDTISVGNMKLMNk 406  

                   ......................elllellelldelkedtpgllielkelg
                    +++ + ++++++ ++++++ ++++ +++e+ d++k d++ ++  lk++g
  ABE00441.1   407 lnidgvstiedttgtvvyvalnNEYFGAIEVSDMIKTDAKVAIQGLKNVG 456  

                   l.kvhlltadpelleelaeelaeelgidlvvvlsgklvlevlpkgvnKgs
                   ++ v +lt+d    + + + +ae+l i  v +       e+lp+  +K +
  ABE00441.1   457 IdNVTMLTGDK---KIVGKNVAEKLNIPNVKT-------ELLPQ--DKVT 494  

                   avkrlleelg....vlavGDglnDeemleaanlgvgvamgna.....kea
                    v+r+++e+g++ +v++vGDglnD ++l+ a  +vgvamg    +++ e+
  ABE00441.1   495 EVERIKSEIGdkgkVIFVGDGLNDTPVLASA--DVGVAMGALgsdaaVEV 542  

                   Adyvl..ndldgvaealelllltlklikkavlFDlDGTLv..e..........................pdiaaa
                      kav+FD  GTL+  e  +++++ ++ + ++++++ +++++ +  + +
  ABE00441.1   315    KAVIFDKTGTLTrgEffvtqiipangvskkeivklaaiaesSSPHPI 361  

                   lnellaelglelllllleelrallgelllallrglldfeellelllellg
                    + + + +  ++++     +++l+g +++a  +g     + ++l+ +l  
  ABE00441.1   362 ARSIVKNYPGNIARV--SNVEELVGLGVRAEYQGDTISVGNMKLMNKLNI 409  

                   lllke...lgldelieeflelylellaeglelypgalelleaLkaaGik.
                     ++ ++++    ++ +++++y+++++    +  +a+ +++ Lk+ Gi +
  ABE00441.1   410 DGVSTiedTTGTVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDn 459  

                   laivTngsgisrelaeallerllglddyfdgivtsddvgagKPdpeifll
                   + ++T++      + + ++e+l +++++      ++ ++  K     +++
  ABE00441.1   460 VTMLTGD---KKIVGKNVAEKL-NIPNVK-----TELLPQDK--VTEVER 498  

                   alerlgvdpeevlfvGDslnDieaakaaGlrtvlvlrggnaaeelka.lv
                   +  ++g d ++v+fvGD+lnD + ++ a++++++ + g  aa e+++++ 
  ABE00441.1   499 IKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADvVL 547  

                   lddllelliklivfDlDGTLtdgdptisd.atlealkelrelgiavvlatgrpla
                       k+++fD++GTLt+g+ +++++   + +++ +  ++a++ ++++p++
  ABE00441.1   315    -KAVIFDKTGTLTRGEFFVTQiIPANGVSKKEIVKLAAIAESSSPHP 360  

                   ailellkelgldlpliaenGalifdld...gtlilaevldeelllgllel
                    +++++k ++ ++       a + ++++ +g +++ae+ +  + +g+++l
  ABE00441.1   361 IARSIVKNYPGNI-------ARVSNVEelvGLGVRAEYQGDTISVGNMKL 403  

                   laelglrvlalaedalygeldfeelllealdllaglvdgvltdllidltl
                   +++l+++ +  +ed+  +  +    +++                      
  ABE00441.1   404 MNKLNIDGVSTIEDTTGTVVYVALNNEY---------------------- 431  

                   lglialadplrpgakellaa..kagi.kvviltgdnlleetaeaiakelg
                    g i ++d ++ +ak +++  ++ gi+ v +ltgd   + + + +a++l+
  ABE00441.1   432 FGAIEVSDMIKTDAKVAIQGlkNVGIdNVTMLTGDK--KIVGKNVAEKLN 479  

                   idelfdvvlsgdvfaevkpegvdKgealkalleklgidgeevamvGDgvN
                   i++         v  e++p+  dK++ +++++++ g d+ +v++vGDg+N
  ABE00441.1   480 IPN---------VKTELLPQ--DKVTEVERIKSEIG-DKGKVIFVGDGLN 517  

                   Dlpmlkaagvgvamg.ngtdvakeaadivlldndldgvaealelglDKTGTLTlGkpev............ellalaaalelasehPlAkAiv
                      DKTGTLT+G++ v++++ ++ + ++e+++laa++e+ s hP+A++iv
  ABE00441.1   320    DKTGTLTRGEFFVtqiipangvskkEIVKLAAIAESSSPHPIARSIV 366  

                   eaakerglallevedfealpGlGv....dgklvlvGnlrlllelgillle
                   + +     ++++v+++e+l+GlGv ++++g ++ vGn++l+ +l+i+   
  ABE00441.1   367 KNYPG---NIARVSNVEELVGLGVraeyQGDTISVGNMKLMNKLNID--- 410  

                   eleellealesegktvvlvavdgellgllalakpvvtdvlplggvseeellalaaaaelasehPlarAivelakergla
                      ++ vt+++p++gvs++e+++laa+ae +s hP+ar+iv+ +      
  ABE00441.1   329    EFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYP---GN 372  

                   llevedfealpgvgvsavtrmsgvdvdgrrvlvGapdlllelvldlggli
                   +++v+++e+l+g+gv+a+       ++g ++ vG+ +l+ +l +d     
  ABE00441.1   373 IARVSNVEELVGLGVRAE-------YQGDTISVGNMKLMNKLNID----- 410  

                   pseleeaveelereGkTvlvvavdgrllGvialaDtvkpsleevlafGDktleggNDlemlelaglgvamgn.apeevkeladyvt
                      ++ +v+++GD    g+ND ++l+ a++gvamg  + + ++e+ad+v+
  ABE00441.1   505    DKGKVIFVGD----GLNDTPVLASADVGVAMGAlGSDAAVEVADVVL 547  

                   ds