hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_16637.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: ABE00459.1
Accession:      [none]
Description:    lsal0 ABE00459.1 GIB00337CH01 "Hypothetical protein, phage associated"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0043316  Prim-pol domain                                 74.3    1.1e-21   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0043316    1/1       1   187 [.     1   210 []    74.3  1.1e-21

Alignments of top-scoring domains:
0043316: domain 1 of 1, from 1 to 187: score 74.3, E = 1.1e-21
                   *->sselleyAllyaklGfsviPidpngKkPllkewqgysdatlteeeie
                       +++l+  + ++++G++v Pi pngK+P+ ++  +y +at + + i+
  ABE00459.1     1    -MNRLDQVIEMVQRGLYVYPIVPNGKQPIKDY--SYLKATQDIALIK 44   

                   kflksinpganialltGqdglvvvDvdv.kedldgl.lgellledlipkt
                   +++ + +p+ ni+l   +++l++vD+d +++dl++   + + l++ +p+ 
  ABE00459.1    45 RWFMD-EPNINIGLNLAKSNLIIVDIDNhNNDLQAPlQSLSNLGYNLPSD 93   

                   lvvtTpsGGlHiylradegvelksnpgflkkgkggvDlkalggYvvapps
                   +v++T sGGlH+y+r  +g++ + +  f++    gvDl +  ++vv  ps
  ABE00459.1    94 YVERTKSGGLHFYYRCSDGIPATRKTKFID----GVDLLS--DFVVTSPS 137  

                   vinhglyevdkgplkgqdyttcytlvndlgeipevllelllkllaekgkk
                    +    y+++ g +           ++d+++ p +++++l +   +++k+
  ABE00459.1   138 TN----YKILNGAT-----------LDDIPQTPNWIIKALDNRAMPTDKM 172  

                   lgielssdalellsg