RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABE00312.1 lsal0 ABE00312.1 GIB00337CH01 "Transcription
regulator, GntR family"
         (241 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3eetA [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR          127   4e-32
3ddvB [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)                 116   7e-29
3ddvD [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)                 114   3e-28
3eetB [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR          109   1e-26
3cnvC [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR          107   4e-26
3cnvA [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR          107   4e-26
3cnvB [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR          106   5e-26
3cnvD [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR          105   1e-25
3ddvC [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)                  97   6e-23
2di3A [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY               96   9e-23
3ddvA [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)                  96   1e-22
3bwgB [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 95   2e-22
3bwgA [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 93   8e-22
2di3B [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY               89   1e-20
3bwgC [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 84   3e-19
3edpA [x.x.x] LIN2111 PROTEIN                                          83   9e-19
3edpB [x.x.x] LIN2111 PROTEIN                                          77   6e-17
1e2xA [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN         75   2e-16
2b7oB [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE              68   3e-14
2b7oA [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE              66   1e-13
3by6E [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      66   1e-13
3by6D [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      66   1e-13
3by6B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      64   4e-13
3by6A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      64   5e-13
3by6C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR                      64   6e-13
3c7jA [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY                   63   8e-13
3c7jB [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY                   63   1e-12
2ek5B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     61   4e-12
2du9A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     57   7e-11
1aoyA [x.x.x] ARGININE REPRESSOR                                       56   8e-11
3d0sB [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN                       56   1e-10
2ek5A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     55   2e-10
2ek5C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS                     55   3e-10
3d0sA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN                       51   5e-09
2dk8A [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA                   48   2e-08
2acjC [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE         47   5e-08
2co5A [x.x.x] VIRAL PROTEIN F93                                        47   6e-08
1b1bA [a.4.5 - a.76.1] PROTEIN (IRON DEPENDENT REGULATOR)              46   1e-07
2d45B [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI           46   1e-07
2acjD [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE         44   3e-07
2b0lA [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC                  43   8e-07
2d45A [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI           43   1e-06
2acjA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE         42   1e-06
1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]                   42   2e-06
2co5B [x.x.x] VIRAL PROTEIN F93                                        41   3e-06
2b0lB [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC                  41   4e-06
1bi2B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR                      40   5e-06
2d45D [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI           40   9e-06
1bi3B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR                      40   1e-05
2dtrA [x.x.x] DIPHTHERIA TOXIN REPRESSOR                               39   2e-05
2acjB [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE         38   2e-05
1bi0A [x.x.x] DIPHTHERIA TOXIN REPRESSOR                               37   5e-05
3cuoD [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 36   1e-04
1biaA [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 / CO...    35   2e-04
1c0wB [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             35   2e-04
1dprA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR                        35   3e-04
3cuoA [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL                 35   3e-04
1efaB [a.35.1 - c.93.1] LAC REPRESSOR                                  35   3e-04
1c0wD [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             34   3e-04
1ddnA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR                        34   4e-04
1efaA [a.35.1 - c.93.1] LAC REPRESSOR                                  34   5e-04
1bi2A [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR             33   0.001
3dkwA [x.x.x] DNR PROTEIN                                              33   0.001
3e6bA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN                        33   0.001

>3eetA [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 238

 Score =  127 bits (319), Expect = 4e-32
 Identities = 38/237 (16%), Positives = 84/237 (35%), Gaps = 10/237 (4%)

Query: 1   MAELVYKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFK 59
             +  Y  +  DL++KI  G      +LP +  + E+Y VS +    A  K+  EG++  
Sbjct: 2   FEQPAYLRVAGDLRKKIVDGSLPPHTRLPSQARIREEYGVSDTVALEAR-KVLAEGLVEG 60

Query: 60  KRGSGTFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDL 119
           + G+     P  +      +    S        +  G    T     +  + +  +   L
Sbjct: 61  RSGTYVRERP--VPRRVARSGYRPSGATPFRQEQADGAVRGTWESHSEQAEASGAIAERL 118

Query: 120 FLSPEDFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYI--QSELNQTA 177
            + P + V      R   D   ++ T + P+ +  +      E  +   +  ++ ++   
Sbjct: 119 DIRPGERVCTKYVFR---DAGEVLSTSWEPLAVTGRTPVLPEEGPVGGGVVERAAIDVIV 175

Query: 178 SKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
                 + A P  +E+   L       V V++   +  +G P E + + +     + 
Sbjct: 176 DNVTEEVGARPGLAEELLTLGGVPGHVVLVIQRT-YFASGRPVETADVVVPADRYRV 231


>3ddvB [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
          Length = 139

 Score =  116 bits (292), Expect = 7e-29
 Identities = 28/134 (20%), Positives = 67/134 (50%)

Query: 101 TKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQ 160
           ++ + + V KP+S     L L PED + ++ R+R  +D P   E   IP  ++ +  +++
Sbjct: 2   SRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVSQYGKSE 61

Query: 161 LESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPF 220
           + +S +  ++++       S  +I A  ++ +    L++K  + +  +  + + +NG PF
Sbjct: 62  ITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYFENGLPF 121

Query: 221 EFSQMRLHFKYLKF 234
           E+ + +      +F
Sbjct: 122 EYVRTQYAGSRFEF 135


>3ddvD [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
          Length = 138

 Score =  114 bits (286), Expect = 3e-28
 Identities = 28/134 (20%), Positives = 67/134 (50%)

Query: 101 TKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQ 160
           ++ + + V KP+S     L L PED + ++ R+R  +D P   E   IP  ++ +  +++
Sbjct: 2   SRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVSQYGKSE 61

Query: 161 LESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPF 220
           + +S +  ++++       S  +I A  ++ +    L++K  + +  +  + + +NG PF
Sbjct: 62  ITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYFENGLPF 121

Query: 221 EFSQMRLHFKYLKF 234
           E+ + +      +F
Sbjct: 122 EYVRTQYAGSRFEF 135


>3eetB [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 229

 Score =  109 bits (273), Expect = 1e-26
 Identities = 33/232 (14%), Positives = 77/232 (33%), Gaps = 15/232 (6%)

Query: 6   YKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
           Y  +  DL++KI  G      +LP +  + E+Y VS +    A   ++   +    R   
Sbjct: 3   YLRVAGDLRKKIVDGSLPPHTRLPSQARIREEYGVSDTVALEARKVLAEGLVETYVRE-- 60

Query: 65  TFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPE 124
               P+  +          +        +  G    T     +  + +  +   L + P 
Sbjct: 61  ---RPVPRRVARSGYRSGATPF---RQEQADGAVRGTWESHSEQAEASGAIAERLDIRPG 114

Query: 125 DFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYI--QSELNQTASKSFM 182
           + V          D   ++ T + P+ +  +      E  +   +  ++ ++        
Sbjct: 115 ERVCTKYVF---RDAGEVLSTSWEPLAVTGRTPVLPEEGPVGGGVVERAAIDVIVDNVTE 171

Query: 183 SIYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
            + A P  +E+   L       V V++   +  +G P E + + +     + 
Sbjct: 172 EVGARPGLAEELLTLGGVPGHVVLVIQRT-YFASGRPVETADVVVPADRYRV 222


>3cnvC [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 158

 Score =  107 bits (268), Expect = 4e-26
 Identities = 22/152 (14%), Positives = 62/152 (40%), Gaps = 7/152 (4%)

Query: 86  LGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIET 145
           L ++ +   +G + +++IL+ + ++  +E+ R L L   + V      R   + P +I+ 
Sbjct: 6   LRLAPDEEGEGGRAESRILECRRLRAPAEIARALELRAGETVVT--IRRQLSNHPTVIDD 63

Query: 146 GYIPIKILPKLSRTQLE---SSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKEN 202
            ++P      L+   L    + ++   +      + ++   + A  ++ E   LL ++  
Sbjct: 64  LWLPGTHFRGLTLELLTASKAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPG 122

Query: 203 EPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
            P+  ++ I +       E  +      +  +
Sbjct: 123 RPLLQVDRISYTYGD-RPEVRRGLYLTDHYHY 153


>3cnvA [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 152

 Score =  107 bits (268), Expect = 4e-26
 Identities = 23/148 (15%), Positives = 59/148 (39%), Gaps = 7/148 (4%)

Query: 90  DNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETGYIP 149
              RL   + +++IL+ + ++  +E+ R L L   + V  I R     + P +I+  ++P
Sbjct: 4   RFLRLAPDEAESRILECRRLRAPAEIARALELRAGETVVTIRRQL--SNHPTVIDDLWLP 61

Query: 150 IKILPKLSRTQLE---SSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVS 206
                 L+   L    + ++   +      + ++   + A  ++ E   LL ++   P+ 
Sbjct: 62  GTHFRGLTLELLTASKAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGRPLL 120

Query: 207 VMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
            ++ I +       E  +      +  +
Sbjct: 121 QVDRISYTYGD-RPEVRRGLYLTDHYHY 147


>3cnvB [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 155

 Score =  106 bits (267), Expect = 5e-26
 Identities = 20/151 (13%), Positives = 57/151 (37%), Gaps = 7/151 (4%)

Query: 87  GISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETG 146
                   +  + +++IL+ + ++  +E+ R L L   + V      R   + P +I+  
Sbjct: 4   RFLRLAPDEEGEAESRILECRRLRAPAEIARALELRAGETVVT--IRRQLSNHPTVIDDL 61

Query: 147 YIPIKILPKLSRTQLES---SIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENE 203
           ++P      L+   L +    ++   +      + ++   + A  ++ E   LL ++   
Sbjct: 62  WLPGTHFRGLTLELLTASKAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGR 120

Query: 204 PVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
           P+  ++ I +       E  +      +  +
Sbjct: 121 PLLQVDRISYTYGD-RPEVRRGLYLTDHYHY 150


>3cnvD [x.x.x] PUTATIVE GNTR-FAMILY TRANSCRIPTIONAL REGULATOR
          Length = 153

 Score =  105 bits (264), Expect = 1e-25
 Identities = 21/150 (14%), Positives = 58/150 (38%), Gaps = 7/150 (4%)

Query: 88  ISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETGY 147
                    ++ +++IL+ + ++  +E+ R L L   + V  I R     + P +I+  +
Sbjct: 3   YRFLRLAPDERAESRILECRRLRAPAEIARALELRAGETVVTIRRQL--SNHPTVIDDLW 60

Query: 148 IPIKILPKLSRTQLE---SSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEP 204
           +P      L+   L    + ++   +      + ++   + A  ++ E   LL ++   P
Sbjct: 61  LPGTHFRGLTLELLTASKAPLYGLFE-SEFGVSVRADEKLRAVAASPEIAPLLGVEPGRP 119

Query: 205 VSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
           +  ++ I +       E  +      +  +
Sbjct: 120 LLQVDRISYTYGD-RPEVRRGLYLTDHYHY 148


>3ddvC [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
          Length = 120

 Score = 96.9 bits (241), Expect = 6e-23
 Identities = 28/140 (20%), Positives = 58/140 (41%), Gaps = 24/140 (17%)

Query: 95  KGKKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETGYIPIKILP 154
           + + P ++ + + V KP+S     L L PED + ++ R+R  +D P   E   IP  ++ 
Sbjct: 1   QNRVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVG 60

Query: 155 KLSRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEGIFFL 214
                                    S  +I A  ++ +    L++K  + +  +  + + 
Sbjct: 61  ------------------------HSNQTISAVQASEQIAEYLEIKRGDAILRVRQVSYF 96

Query: 215 DNGTPFEFSQMRLHFKYLKF 234
           +NG PFE+ + +      +F
Sbjct: 97  ENGLPFEYVRTQYAGSRFEF 116


>2di3A [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
          Length = 231

 Score = 96.2 bits (238), Expect = 9e-23
 Identities = 28/201 (13%), Positives = 71/201 (35%), Gaps = 8/201 (3%)

Query: 6   YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
           +++++  + E++ +G+      LP ER+L+E   VSRSS++ AL  +   G I    GSG
Sbjct: 5   HESVMDWVTEELRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSG 64

Query: 65  TFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPE 124
                +           +  +L       +  +     I + + +              +
Sbjct: 65  PRSGTI-----ITAAPGQALSL-SVTLQLVTNQVGHHDIYETRQLLEGWAALHSSAERGD 118

Query: 125 DFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSI 184
             V + +  ++ +    + +      +    +S+      I   ++  L  + +   ++ 
Sbjct: 119 WDVAEALLEKMDDPSLPLEDFLRFDAEFHVVISKGAENPLISTLME-ALRLSVADHTVAR 177

Query: 185 YAEPSTSEDQNLLKLKENEPV 205
                     +    KE+  +
Sbjct: 178 ARALPDWRATSARLQKEHRAI 198


>3ddvA [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
          Length = 121

 Score = 96.1 bits (239), Expect = 1e-22
 Identities = 27/138 (19%), Positives = 57/138 (41%), Gaps = 22/138 (15%)

Query: 97  KKPQTKILDFQVIKPTSELQRDLFLSPEDFVYKIIRLRLFEDEPFMIETGYIPIKILPKL 156
           + P ++ + + V KP+S     L L PED + ++ R+R  +D P   E   IP  ++  +
Sbjct: 2   RVPSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIPICFEVASIPYSLVK-I 60

Query: 157 SRTQLESSIFAYIQSELNQTASKSFMSIYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDN 216
             +                        I A  ++ +    L++K  + +  +  + + +N
Sbjct: 61  GHSNQT---------------------ISAVQASEQIAEYLEIKRGDAILRVRQVSYFEN 99

Query: 217 GTPFEFSQMRLHFKYLKF 234
           G PFE+ + +      +F
Sbjct: 100 GLPFEYVRTQYAGSRFEF 117


>3bwgB [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 225

 Score = 95.0 bits (235), Expect = 2e-22
 Identities = 55/230 (23%), Positives = 104/230 (45%), Gaps = 13/230 (5%)

Query: 6   YKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
           Y+ I ++++  I   +     KLP       Q+ VS+S++ ++L  +  +G IF+ RGSG
Sbjct: 3   YQQIATEIETYIEEHQLQQGDKLP-VLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSG 61

Query: 65  TFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPE 124
            F+             +    + +  N  L+     +K+++  V KPT E   +     +
Sbjct: 62  IFVRKH----------KRKGYISLLSNQDLEDFNVTSKVIELDVRKPTPE-AAENLNIGD 110

Query: 125 DFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSI 184
           + +Y + R+R    +    E  Y    I+  L+   +  SIF YI+  L      S + +
Sbjct: 111 EDIYYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFL 170

Query: 185 YAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
           +      E+   L L+   P   +E IF L NG PF++S++  +++  +F
Sbjct: 171 HVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQF 220


>3bwgA [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 221

 Score = 93.0 bits (230), Expect = 8e-22
 Identities = 49/227 (21%), Positives = 94/227 (41%), Gaps = 15/227 (6%)

Query: 9   IISDLKEKIFAGKF-TDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFI 67
           I ++++  I   +     KLP       Q+ VS+S++ ++L  +  +G IF+ RGSG F+
Sbjct: 3   IATEIETYIEEHQLQQGDKLP-VLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSGIFV 61

Query: 68  NPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPEDFV 127
                K                     +G    T  +    ++  +    +     ++ +
Sbjct: 62  RKHKRKG-------------YISLLSNQGDFNVTSKVIELDVRKPTPEAAENLNIGDEDI 108

Query: 128 YKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSIYAE 187
           Y + R+R    +    E  Y    I+  L+   +  SIF YI+  L      S + ++  
Sbjct: 109 YYVKRVRYINGQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFLHVG 168

Query: 188 PSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
               E+   L L+   P   +E IF L NG PF++S++  +++  +F
Sbjct: 169 QLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQF 215


>2di3B [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
          Length = 230

 Score = 89.3 bits (220), Expect = 1e-20
 Identities = 28/202 (13%), Positives = 72/202 (35%), Gaps = 8/202 (3%)

Query: 5   VYKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGS 63
            +++++  + E++ +G+      LP ER+L+E   VSRSS++ AL  +   G I    GS
Sbjct: 4   AHESVMDWVTEELRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGS 63

Query: 64  GTFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSP 123
           G     +           +  +L ++       +     I + + +              
Sbjct: 64  GPRSGTI-----ITAAPGQALSLSVTLQLVT-NQVGHHDIYETRQLLEGWAALHSSAERG 117

Query: 124 EDFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMS 183
           +  V + +  ++ +    + +      +    +S+      I   ++  L  + +   ++
Sbjct: 118 DWDVAEALLEKMDDPSLPLEDFLRFDAEFHVVISKGAENPLISTLME-ALRLSVADHTVA 176

Query: 184 IYAEPSTSEDQNLLKLKENEPV 205
                      +    KE+  +
Sbjct: 177 RARALPDWRATSARLQKEHRAI 198


>3bwgC [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 222

 Score = 84.3 bits (207), Expect = 3e-19
 Identities = 56/230 (24%), Positives = 99/230 (43%), Gaps = 16/230 (6%)

Query: 6   YKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
           Y+ I ++++  I   +     KLP       Q+ VS+S++ ++L  +  +G IF+ RGSG
Sbjct: 2   YQQIATEIETYIEEHQLQQGDKLP-VLETLAQFEVSKSTITKSLELLEQKGAIFQVRGSG 60

Query: 65  TFINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPE 124
            F+     K                    L+     +K+++  V KPT E   +L +  E
Sbjct: 61  IFVRKHKRKG-------------YISLLSLEDFNVTSKVIELDVRKPTPEAAENLNIGDE 107

Query: 125 DFVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTASKSFMSI 184
           D  Y      +   +    E  Y    I+  L+   +  SIF YI+  L      S + +
Sbjct: 108 DIYYVKRVRYIN-GQTLCYEESYYTKSIVTYLNNEIVSHSIFHYIREGLGLKIGFSDLFL 166

Query: 185 YAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
           +      E+   L L+   P   +E IF L NG PF++S++  +++  +F
Sbjct: 167 HVGQLNEEEAEYLGLEAGLPKLYIESIFHLTNGQPFDYSKISYNYEQSQF 216


>3edpA [x.x.x] LIN2111 PROTEIN
          Length = 217

 Score = 83.0 bits (204), Expect = 9e-19
 Identities = 41/225 (18%), Positives = 82/225 (36%), Gaps = 25/225 (11%)

Query: 6   YKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGT 65
           ++ I S +K+ I   ++     P+E +L E Y+ SR++++RA++ +  EG++ +K G G 
Sbjct: 5   FEVIASKIKDSINRDEYKT--GPNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVGL 62

Query: 66  FINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPED 125
           ++ P                     N    G K   K +    I+   +   ++F    +
Sbjct: 63  YVQPKLTA----------------QNILETGVKNLKKDIKDFYIRKAGKFYAEIFGKENE 106

Query: 126 FVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTA--SKSFMS 183
            VY I  ++  E    +              ++     +I   + S   +     +    
Sbjct: 107 LVYSIKFVQKSEHGATLDRLILPLGLYPDLQAKDFQIINIIELVNSGKYKLFELEQELQL 166

Query: 184 IYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLH 228
           I A      +Q    L EN+PV  +  +F+     P         
Sbjct: 167 ILAGN----EQIKNHLNENDPVFKLSSVFY-AENDPIAIQYHYED 206


>3edpB [x.x.x] LIN2111 PROTEIN
          Length = 214

 Score = 76.8 bits (188), Expect = 6e-17
 Identities = 39/231 (16%), Positives = 82/231 (35%), Gaps = 27/231 (11%)

Query: 6   YKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGT 65
           ++ I S +K+ I   ++     P+E +L E Y+ SR++++RA++ +  EG++ +K G G 
Sbjct: 4   FEVIASKIKDSINRDEYKT--GPNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVGL 61

Query: 66  FINPLYLKNESIFNYEEGSNLGISDNFRLKGKKPQTKILDFQVIKPTSELQRDLFLSPED 125
           ++ P                        +       K +    I+   +   ++F    +
Sbjct: 62  YVQP------------------KLTAQNILETGVLKKDIKDFYIRKAGKFYAEIFGKENE 103

Query: 126 FVYKIIRLRLFEDEPFMIETGYIPIKILPKLSRTQLESSIFAYIQSELNQTA--SKSFMS 183
            VY I  ++  E    +              ++     +I   + S   +     +    
Sbjct: 104 LVYSIKFVQKSEHGATLDRLILPLGLYPDLQAKDFQIINIIELVNSGKYKLFELEQELQL 163

Query: 184 IYAEPSTSEDQNLLKLKENEPVSVMEGIFFLDNGTPFEFSQMRLHFKYLKF 234
           I A      +Q    L EN+PV  +  + F     P          +  K+
Sbjct: 164 ILAG----NEQIKNHLNENDPVFKLSSV-FYAENDPIAIQYHYEDAESTKY 209


>1e2xA [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
          Length = 222

 Score = 74.9 bits (183), Expect = 2e-16
 Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
                 + E I+  +F     LP ER L+E   V+R++++  L +++ +G +  + G  
Sbjct: 4  AGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP 63

Query: 65 TFINPL 70
          T +N  
Sbjct: 64 TKVNNF 69


>2b7oB [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
          Length = 438

 Score = 67.7 bits (164), Expect = 3e-14
 Identities = 6/68 (8%), Positives = 22/68 (32%)

Query: 2   AELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKR 61
             +   + I  L+E++      +  L      AE ++ +   ++  +  +    ++    
Sbjct: 56  PPVTVPSEIVRLQEQLAQVAKGEAFLLQGGDCAETFDNTEPHIRGNVRALLQAVVLTYGA 115

Query: 62  GSGTFINP 69
                +  
Sbjct: 116 SPVVKVAR 123


>2b7oA [x.x.x] 3-DEOXY-D-ARABINO-HEPTULOSONATE 7-PHOSPHATE
          Length = 438

 Score = 65.8 bits (159), Expect = 1e-13
 Identities = 6/69 (8%), Positives = 21/69 (30%), Gaps = 2/69 (2%)

Query: 2   AELVYKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKK 60
             +   + I  L+E++          L      AE ++ +   ++  +  +    ++   
Sbjct: 56  PPVTVPSEIVRLQEQLAQVAKGEAFLLQ-GGDCAETFDNTEPHIRGNVRALLQAVVLTYG 114

Query: 61  RGSGTFINP 69
                 +  
Sbjct: 115 ASPVVKVAR 123


>3by6E [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 124

 Score = 65.8 bits (160), Expect = 1e-13
 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          Y  ++  +K ++     +   +LP  R  A Q  ++ ++V +A  ++  + +I    G G
Sbjct: 12 YLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG 71

Query: 65 TFINPL 70
          TFI   
Sbjct: 72 TFITGN 77


>3by6D [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 121

 Score = 65.8 bits (160), Expect = 1e-13
 Identities = 15/65 (23%), Positives = 31/65 (47%), Gaps = 1/65 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          Y  ++  +K ++     +   +LP  R  A Q  ++ ++V +A  ++  + +I    G G
Sbjct: 12 YLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG 71

Query: 65 TFINP 69
          TFI  
Sbjct: 72 TFITG 76


>3by6B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 118

 Score = 64.3 bits (156), Expect = 4e-13
 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          Y  ++  +K ++     +   +LP  R  A Q  ++ ++V +A  ++  + +I    G G
Sbjct: 11 YLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG 70

Query: 65 TFINPL 70
          TFI   
Sbjct: 71 TFITGN 76


>3by6A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 119

 Score = 63.9 bits (155), Expect = 5e-13
 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          Y  ++  +K ++     +   +LP  R  A Q  ++ ++V +A  ++  + +I    G G
Sbjct: 12 YLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG 71

Query: 65 TFINPL 70
          TFI   
Sbjct: 72 TFITGN 77


>3by6C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
          Length = 120

 Score = 63.5 bits (154), Expect = 6e-13
 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          Y  ++  +K ++     +   +LP  R  A Q  ++ ++V +A  ++  + +I    G G
Sbjct: 13 YLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG 72

Query: 65 TFINPL 70
          TFI   
Sbjct: 73 TFITGN 78


>3c7jA [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
          Length = 232

 Score = 63.2 bits (153), Expect = 8e-13
 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 3/70 (4%)

Query: 6  YKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
             I   L+  I  G       L  ++ LA  + VSR  V+ AL ++  + ++  +   G
Sbjct: 27 RTVIEEKLRNAIIDGSLPSGTALR-QQELATLFGVSRP-VREALRQLEAQSLLRVETHKG 84

Query: 65 TFINPLYLKN 74
            + PL  ++
Sbjct: 85 AVVAPLITED 94


>3c7jB [x.x.x] TRANSCRIPTIONAL REGULATOR, GNTR FAMILY
          Length = 222

 Score = 62.8 bits (152), Expect = 1e-12
 Identities = 16/70 (22%), Positives = 30/70 (42%), Gaps = 3/70 (4%)

Query: 6  YKNIISDLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
             I   L+  I  G       L  ++ LA  + VSR  V+ AL ++  + ++  +   G
Sbjct: 27 RTVIEEKLRNAIIDGSLPSGTALR-QQELATLFGVSRP-VREALRQLEAQSLLRVETHKG 84

Query: 65 TFINPLYLKN 74
            + PL  ++
Sbjct: 85 AVVAPLITED 94


>2ek5B [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 108

 Score = 60.8 bits (147), Expect = 4e-12
 Identities = 14/60 (23%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 12 DLKEKIFAGKFT-DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL 70
           +++ I  G  + D ++P    LA  + ++ ++ +  L  +   GI++KKRG G      
Sbjct: 3  LIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIGFVSAQA 62


>2du9A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 115

 Score = 56.6 bits (136), Expect = 7e-11
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          YK I S +++ I  G  +   ++P    LA  + ++ ++ +  L  +   GI++KKRG G
Sbjct: 4  YKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG 63

Query: 65 TFINPL 70
                
Sbjct: 64 FVSAQA 69


>1aoyA [x.x.x] ARGININE REPRESSOR
          Length = 78

 Score = 56.5 bits (136), Expect = 8e-11
 Identities = 10/65 (15%), Positives = 21/65 (32%), Gaps = 1/65 (1%)

Query: 6  YKNIISDLKEKIFAGKF-TDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
           + ++   K  +   KF +  ++          N+++S V R L K         K    
Sbjct: 7  QEELVKAFKALLKEEKFSSQGEIVAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEMV 66

Query: 65 TFINP 69
            +  
Sbjct: 67 YCLPA 71


>3d0sB [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 218

 Score = 55.6 bits (133), Expect = 1e-10
 Identities = 10/64 (15%), Positives = 23/64 (35%), Gaps = 1/64 (1%)

Query: 6   YKNIISDLKEKIFAGKFTDMKL-PDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
            + +    +     G    +     +  +A+    SR +V +AL   ++ G I  +  S 
Sbjct: 155 KQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSV 214

Query: 65  TFIN 68
              +
Sbjct: 215 LISD 218


>2ek5A [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 114

 Score = 55.4 bits (133), Expect = 2e-10
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          YK I S +++ I  G  +   ++P    LA  + ++ ++ +  L  +   GI++KKRG G
Sbjct: 4  YKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG 63

Query: 65 TFINPL 70
                
Sbjct: 64 FVSAQA 69


>2ek5C [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
          Length = 117

 Score = 54.7 bits (131), Expect = 3e-10
 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 6  YKNIISDLKEKIFAGKFTD-MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          YK I S +++ I  G  +   ++P    LA  + ++ ++ +  L  +   GI++KKRG G
Sbjct: 4  YKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG 63

Query: 65 TFINPL 70
                
Sbjct: 64 FVSAQA 69


>3d0sA [x.x.x] TRANSCRIPTIONAL REGULATORY PROTEIN
          Length = 224

 Score = 50.6 bits (120), Expect = 5e-09
 Identities = 10/48 (20%), Positives = 19/48 (39%)

Query: 26  KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLK 73
               +  +A+    SR +V +AL   ++ G I  +  S    +   L 
Sbjct: 173 HDLTQEEIAQLVGASRETVNKALADFAHRGWIRLEGKSVLISDSERLA 220


>2dk8A [x.x.x] DNA-DIRECTED RNA POLYMERASE III 39 KDA
          Length = 81

 Score = 48.3 bits (115), Expect = 2e-08
 Identities = 5/62 (8%), Positives = 22/62 (35%), Gaps = 1/62 (1%)

Query: 7  KNIISDLKEKIFAGKFTDMKLPDERSLAEQ-YNVSRSSVKRALNKMSNEGIIFKKRGSGT 65
               +++ +I            ++ +  +  ++       A+N++ + G +   R +  
Sbjct: 9  DADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQRAVAINRLLSMGQLDLLRSNTG 68

Query: 66 FI 67
           +
Sbjct: 69 LL 70


>2acjC [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 66

 Score = 47.1 bits (112), Expect = 5e-08
 Identities = 9/59 (15%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query: 11 SDLKEKIFA--GKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFI 67
          S ++++I     +  + K      L+ +    +  + R L  ++ +G + K+ G+    
Sbjct: 1  SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLW 59


>2co5A [x.x.x] VIRAL PROTEIN F93
          Length = 92

 Score = 46.9 bits (111), Expect = 6e-08
 Identities = 8/59 (13%), Positives = 25/59 (42%), Gaps = 2/59 (3%)

Query: 24 DMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLKNESIFNYEE 82
            +L  E       ++S   +   ++ + ++ I+ ++      +  L+L  + +  +EE
Sbjct: 23 KKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKV--LFLTEKGMKEFEE 79


>1b1bA [a.4.5 - a.76.1] PROTEIN (IRON DEPENDENT REGULATOR)
          Length = 140

 Score = 45.9 bits (108), Expect = 1e-07
 Identities = 8/65 (12%), Positives = 24/65 (36%), Gaps = 1/65 (1%)

Query: 6  YKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGT 65
            +        I+  +  +   P    +AE+ + S  +V + +++M  +G++        
Sbjct: 4  LVDTTEMYLRTIYDLE-EEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHL 62

Query: 66 FINPL 70
           +   
Sbjct: 63 ELTEK 67


>2d45B [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
          Length = 116

 Score = 45.8 bits (108), Expect = 1e-07
 Identities = 6/42 (14%), Positives = 19/42 (45%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFI 67
             +     +Q + S  +++  + ++  +G I +K+ +  F 
Sbjct: 22 SANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQ 63


>2acjD [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 63

 Score = 44.4 bits (105), Expect = 3e-07
 Identities = 8/55 (14%), Positives = 22/55 (40%)

Query: 12 DLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTF 66
          + +   F  +  + K      L+ +    +  + R L  ++ +G + K+ G+   
Sbjct: 4  EQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPL 58


>2b0lA [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
          Length = 98

 Score = 43.1 bits (101), Expect = 8e-07
 Identities = 9/60 (15%), Positives = 25/60 (41%), Gaps = 1/60 (1%)

Query: 5  VYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          +  + +  ++         +  L     +A++  ++RS +  AL K+ + G+I  +    
Sbjct: 19 LSYSELEAIEHIFEELDGNE-GLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGM 77


>2d45A [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
          Length = 114

 Score = 42.8 bits (100), Expect = 1e-06
 Identities = 7/57 (12%), Positives = 21/57 (36%), Gaps = 1/57 (1%)

Query: 12 DLKEKIFAGKF-TDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFI 67
             E      +       +     +Q + S  +++  + ++  +G I +K+ +  F 
Sbjct: 5  SSAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIFQ 61


>2acjA [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 53

 Score = 42.5 bits (100), Expect = 1e-06
 Identities = 6/37 (16%), Positives = 16/37 (43%)

Query: 30 ERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTF 66
             L+ +    +  + R L  ++ +G + K+ G+   
Sbjct: 12 AHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPL 48


>1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
          Length = 294

 Score = 42.0 bits (98), Expect = 2e-06
 Identities = 6/42 (14%), Positives = 16/42 (38%)

Query: 30 ERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLY 71
             L E   +SR+++ + +  + + G+         +  P  
Sbjct: 21 GEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEP 62


>2co5B [x.x.x] VIRAL PROTEIN F93
          Length = 94

 Score = 41.2 bits (96), Expect = 3e-06
 Identities = 9/66 (13%), Positives = 27/66 (40%), Gaps = 2/66 (3%)

Query: 17 IFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLKNES 76
          I   +    +L  E       ++S   +   ++ + ++ I+ ++      +  L+L  + 
Sbjct: 20 INGSRLEKKRLRSEILKRFDIDISDGVLYPLIDSLIDDKILREEEAPDGKV--LFLTEKG 77

Query: 77 IFNYEE 82
          +  +EE
Sbjct: 78 MKEFEE 83


>2b0lB [x.x.x] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC
          Length = 95

 Score = 40.9 bits (95), Expect = 4e-06
 Identities = 16/64 (25%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query: 9  IISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRG--SGTF 66
             +  E IF     +  L     +A++  ++RS +  AL K+ + G+I  +     GT+
Sbjct: 20 SELEAIEHIFEELDGNEGLLVASKIADRVGITRSVIVNALRKLESAGVIESRSLGMKGTY 79

Query: 67 INPL 70
          I  L
Sbjct: 80 IKVL 83


>1bi2B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 138

 Score = 40.4 bits (94), Expect = 5e-06
 Identities = 8/46 (17%), Positives = 18/46 (39%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLY 71
            P    +AE+   S  +V + + +M  +G++         + P  
Sbjct: 21 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTG 66


>2d45D [x.x.x] METHICILLIN RESISTANCE REGULATORY PROTEIN MECI
          Length = 112

 Score = 39.7 bits (92), Expect = 9e-06
 Identities = 7/55 (12%), Positives = 21/55 (38%), Gaps = 1/55 (1%)

Query: 13 LKEKIFAGKF-TDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTF 66
            E      +       +     +Q + S  +++  + ++  +G I +K+ +  F
Sbjct: 4  SAEWEVNIIWKKYASANNIIEEIQQKDWSPKTIRTLITRLYKKGFIDRKKDNKIF 58


>1bi3B [a.4.5 - a.76.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 136

 Score = 39.6 bits (92), Expect = 1e-05
 Identities = 8/45 (17%), Positives = 18/45 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL 70
            P    +AE+   S  +V + + +M  +G++         + P 
Sbjct: 20 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT 64


>2dtrA [x.x.x] DIPHTHERIA TOXIN REPRESSOR
          Length = 214

 Score = 38.8 bits (89), Expect = 2e-05
 Identities = 8/45 (17%), Positives = 18/45 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL 70
            P    +AE+   S  +V + + +M  +G++         + P 
Sbjct: 20 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT 64


>2acjB [x.x.x] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE DEAMINASE
          Length = 65

 Score = 38.3 bits (89), Expect = 2e-05
 Identities = 8/54 (14%), Positives = 24/54 (44%), Gaps = 2/54 (3%)

Query: 13 LKEKIFA--GKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSG 64
          ++++I     +  + K      L+ +    +  + R L  ++ +G + K+ G+ 
Sbjct: 2  MEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTP 55


>1bi0A [x.x.x] DIPHTHERIA TOXIN REPRESSOR
          Length = 213

 Score = 37.3 bits (85), Expect = 5e-05
 Identities = 8/45 (17%), Positives = 18/45 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL 70
            P    +AE+   S  +V + + +M  +G++         + P 
Sbjct: 20 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT 64


>3cuoD [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 94

 Score = 36.2 bits (83), Expect = 1e-04
 Identities = 12/66 (18%), Positives = 23/66 (34%), Gaps = 9/66 (13%)

Query: 1  MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKK 60
          M+      I+  L         +         L     +S S+  + L +M +EG+I  +
Sbjct: 19 MSHPKRLLILCMLSGS---PGTS------AGELTRITGLSASATSQHLARMRDEGLIDSQ 69

Query: 61 RGSGTF 66
          R +   
Sbjct: 70 RDAQRI 75


>1biaA [x.x.x] BIRA BIFUNCTIONAL PROTEIN[MASQUE : MEMB(X) 45 /
          COIL(x) 0]
          Length = 292

 Score = 35.4 bits (81), Expect = 2e-04
 Identities = 5/37 (13%), Positives = 15/37 (40%)

Query: 30 ERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTF 66
             L E   +SR+++ + +  + + G+         +
Sbjct: 22 GEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGY 58


>1c0wB [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 219

 Score = 35.3 bits (80), Expect = 2e-04
 Identities = 8/45 (17%), Positives = 18/45 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL 70
            P    +AE+   S  +V + + +M  +G++         + P 
Sbjct: 22 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT 66


>1dprA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
          Length = 134

 Score = 34.7 bits (79), Expect = 3e-04
 Identities = 8/44 (18%), Positives = 18/44 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINP 69
            P    +AE+   S  +V + + +M  +G++         + P
Sbjct: 21 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTP 64


>3cuoA [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
          Length = 98

 Score = 34.7 bits (79), Expect = 3e-04
 Identities = 12/66 (18%), Positives = 23/66 (34%), Gaps = 9/66 (13%)

Query: 1  MAELVYKNIISDLKEKIFAGKFTDMKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKK 60
          M+      I+  L         +         L     +S S+  + L +M +EG+I  +
Sbjct: 21 MSHPKRLLILCMLSGS---PGTS------AGELTRITGLSASATSQHLARMRDEGLIDSQ 71

Query: 61 RGSGTF 66
          R +   
Sbjct: 72 RDAQRI 77


>1efaB [a.35.1 - c.93.1] LAC REPRESSOR
          Length = 330

 Score = 34.6 bits (78), Expect = 3e-04
 Identities = 11/49 (22%), Positives = 20/49 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLKN 74
          K      +AE   VS  +V R +N+ S+     +++         Y+ N
Sbjct: 1  KPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN 49


>1c0wD [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 175

 Score = 34.4 bits (78), Expect = 3e-04
 Identities = 8/45 (17%), Positives = 18/45 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPL 70
            P    +AE+   S  +V + + +M  +G++         + P 
Sbjct: 22 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPT 66


>1ddnA [a.4.5 - a.76.1] DIPHTHERIA TOX REPRESSOR
          Length = 118

 Score = 34.2 bits (78), Expect = 4e-04
 Identities = 8/44 (18%), Positives = 18/44 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINP 69
            P    +AE+   S  +V + + +M  +G++         + P
Sbjct: 21 VTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTP 64


>1efaA [a.35.1 - c.93.1] LAC REPRESSOR
          Length = 328

 Score = 33.8 bits (76), Expect = 5e-04
 Identities = 11/49 (22%), Positives = 20/49 (40%)

Query: 26 KLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLKN 74
          K      +AE   VS  +V R +N+ S+     +++         Y+ N
Sbjct: 1  KPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN 49


>1bi2A [a.4.5 - a.76.1 - b.34.1] DIPHTHERIA TOXIN REPRESSOR
          Length = 214

 Score = 33.0 bits (74), Expect = 0.001
 Identities = 8/45 (17%), Positives = 18/45 (40%)

Query: 25 MKLPDERSLAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINP 69
             P    +AE+   S  +V + + +M  +G++         + P
Sbjct: 20 GVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTP 64


>3dkwA [x.x.x] DNR PROTEIN
          Length = 227

 Score = 32.9 bits (74), Expect = 0.001
 Identities = 7/40 (17%), Positives = 19/40 (47%)

Query: 34  AEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLK 73
           A   ++   +  R ++++ +EGII       + ++   L+
Sbjct: 185 AGHLSIQPETFSRIMHRLGDEGIIHLDGREISILDRERLE 224


>3e6bA [x.x.x] CYCLIC NUCLEOTIDE-BINDING PROTEIN
          Length = 208

 Score = 32.9 bits (74), Expect = 0.001
 Identities = 12/41 (29%), Positives = 17/41 (41%)

Query: 33  LAEQYNVSRSSVKRALNKMSNEGIIFKKRGSGTFINPLYLK 73
           + E   V   +V R L  +  E I+ KK+      N   LK
Sbjct: 164 IGEITGVHHVTVSRVLASLKRENILDKKKNKIIVYNLGELK 204


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0488    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 25,043,677
Number of extensions: 1634809
Number of successful extensions: 18522
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8888
Number of HSP's successfully gapped: 525
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)