RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= ABE00528.1 lsal0 dnaB.2 GIB00337CH01 "Replicative DNA helicase"
         (463 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cmxA [x.x.x] PROTEIN RECA                                            147   4e-38
1b79A [a.81.1] DNAB HELICASE                                          135   3e-34
1b79B [a.81.1] DNAB HELICASE                                          128   3e-32
3cmtD [x.x.x] PROTEIN RECA                                            125   2e-31
3cmwC [x.x.x] PROTEIN RECA                                            105   3e-25
3bs4A [x.x.x] UNCHARACTERIZED PROTEIN PH0321                          101   4e-24
1cr1A [c.37.1] DNA PRIMASE/HELICASE                                   100   1e-23
3bgwA [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           99   2e-23
3cmuA [x.x.x] PROTEIN RECA                                             98   6e-23
3b9cA [x.x.x] HSPC159                                                  94   6e-22
3dvlD [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC                      88   7e-20
3cmwA [x.x.x] PROTEIN RECA                                             86   2e-19
3cmvA [x.x.x] PROTEIN RECA                                             80   2e-17
3dvlC [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC                      79   2e-17
3cmvH [x.x.x] PROTEIN RECA                                             74   9e-16
3bgwD [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           65   3e-13
1e0jA [c.37.1] DNA HELICASE                                            57   1e-10
3cmvE [x.x.x] PROTEIN RECA                                             52   3e-09
1e0jB [c.37.1] DNA HELICASE                                            48   5e-08
1cr4A [c.37.1] DNA PRIMASE/HELICASE                                    42   3e-06
2bkeA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA                42   4e-06
2cvfA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB                41   6e-06
3eizA [x.x.x] INORGANIC PYROPHOSPHATASE                                39   3e-05
3bh0A [x.x.x] DNAB-LIKE REPLICATIVE HELICASE                           38   5e-05
2dflA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA                37   9e-05

>3cmxA [x.x.x] PROTEIN RECA
          Length = 1603

 Score =  147 bits (372), Expect = 4e-38
 Identities = 36/308 (11%), Positives = 86/308 (27%), Gaps = 44/308 (14%)

Query: 147 QIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPD 204
             +D ++++  +      +      S +     +S D+  + TG    D      GL   
Sbjct: 297 SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG 356

Query: 205 NLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHL 264
            ++ +    + GKT   L +          + A    E + + +  R             
Sbjct: 357 RIVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARK-LGVD------- 407

Query: 265 RTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYL 324
                      NL+ +           +    I  A  R+    +        L     +
Sbjct: 408 ---------IDNLLCSQ------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI 452

Query: 325 QLIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRES 383
           +   G +      + +S+  R+L    K+ +  ++ ++Q+   +          +     
Sbjct: 453 EGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTG---G 509

Query: 384 GSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLNQDVGEVELIIEKNRAGARGTVKL 443
            +++  A +   + R    + G                 VG    +       A    + 
Sbjct: 510 NALKFYASVRLDIRRIGAVKEG--------------ENVVGSETRVKVVKNKIAAPFKQA 555

Query: 444 LFIKSYNK 451
            F   Y +
Sbjct: 556 EFQILYGE 563



 Score =  109 bits (272), Expect = 2e-26
 Identities = 45/396 (11%), Positives = 111/396 (28%), Gaps = 44/396 (11%)

Query: 15  IEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLTVQNY 74
              +      + +            E ++      ++            +A   +     
Sbjct: 510 NALKFYASVRLDIRRIG-----AVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEG 564

Query: 75  LTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQA-NNG 133
           +    +L D+G    + E A +  +              + L+    TA  I  +     
Sbjct: 565 INFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELL 624

Query: 134 DDDVPSLLDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYRE 193
             +  S +D  +++ +  +  +    F           S +     +S D+  + TG   
Sbjct: 625 LSNPNSAIDENKQKALAAALGQIEKQFG--------KGSIMRLGEDRSMDVETISTGSLS 676

Query: 194 FDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNR 251
            D      GL    ++ +    + GKT   L +          + A    E + + +  R
Sbjct: 677 LDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYAR 735

Query: 252 MLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAK 311
            L               +D               +     +    I  A  R+    +  
Sbjct: 736 KLG--------------VDIDNLLC---------SQPDTGEQALEICDALARSGAVDVIV 772

Query: 312 EKGNLGLVVIDYLQLIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQR 370
                 L     ++   G +      + +S+  R+L    K+ +  ++ ++Q+   +   
Sbjct: 773 VDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVM 832

Query: 371 QDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGE 406
                  +      +++  A +   + R    + GE
Sbjct: 833 FGNPETTTGGN---ALKFYASVRLDIRRIGAVKEGE 865



 Score = 80.6 bits (197), Expect = 9e-18
 Identities = 24/199 (12%), Positives = 54/199 (27%), Gaps = 27/199 (13%)

Query: 184 ITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSL 241
           +  + TG    D      GL    ++ +    + GKT   L +          + A    
Sbjct: 1   VETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDA 59

Query: 242 EMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAE 301
           E + + +  R L                       L              +    I  A 
Sbjct: 60  EHALDPIYARKLG----------------VDIDNLLCSQ-------PDTGEQALEICDAL 96

Query: 302 IRAKCRRLAKEKGNLGLVVIDYLQLIE-GSNKESRQQEVSEISRQLKKLAKELSVPILAL 360
            R+    +        L     ++     S+     + +S+  R+L    K+ +  ++ +
Sbjct: 97  ARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFI 156

Query: 361 SQLSRGVEQRQDKRPVLSD 379
           +Q+   +          + 
Sbjct: 157 NQIRMKIGVMFGNPETTTG 175



 Score = 77.1 bits (188), Expect = 9e-17
 Identities = 31/247 (12%), Positives = 69/247 (27%), Gaps = 31/247 (12%)

Query: 161  REIKDVLNETLSDIDRLS-QQSEDITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGK 217
               +         I RL   +S D+  + TG    D      GL    ++ +    + GK
Sbjct: 976  ALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGK 1035

Query: 218  TAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNL 277
            T   L +          + A    E + + +  R        N    +            
Sbjct: 1036 TTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARK-LGVDIDNLLCSQ------------ 1081

Query: 278  IVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQL-IEGSNKESRQ 336
                          +    I  A  R+    +        L     ++  I  S+     
Sbjct: 1082 ----------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAA 1131

Query: 337  QEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFL 396
            + +S+  R+L    K+ +  ++ ++Q+   +          +       ++  A +   +
Sbjct: 1132 RMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNA---LKFYASVRLDI 1188

Query: 397  YRDDYYE 403
             R    +
Sbjct: 1189 RRIGAVK 1195



 Score = 60.9 bits (146), Expect = 7e-12
 Identities = 43/372 (11%), Positives = 102/372 (27%), Gaps = 43/372 (11%)

Query: 34   DAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLTVQNYLTTNNQLDDVGGVAYIAEL 93
                 +      +    ++           +         +     +  +  G      +
Sbjct: 1183 SVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGV 1242

Query: 94   ATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSLLDSAERQIMDVSE 153
               +   A A Y  K  +         +   +    A   +  V  LL S     +D ++
Sbjct: 1243 KEKLIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSAIDENK 1302

Query: 154  RRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPDNLIILAA 211
            ++  +      +      S +     +S D+  + TG    D      GL    ++ +  
Sbjct: 1303 QKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYG 1362

Query: 212  RPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDE 271
              + GKT                                  + A              + 
Sbjct: 1363 PESSGKTTLT-----------------------------LQVIAAAQREGKTCAFIDAEH 1393

Query: 272  GEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSN 331
                     +G   +  +      G +  EI     R     G + ++V+D    +    
Sbjct: 1394 ALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARS----GAVDVIVVDS---VAALT 1446

Query: 332  KESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDK-----RPVLSDIRESGSI 386
             ++  + +S+  R+L    K+ +  ++ ++Q+                 V  DIR  G++
Sbjct: 1447 PKAEARMMSQAMRKLAGNLKQSNTLLIFINQIRNPETTTGGNALKFYASVRLDIRRIGAV 1506

Query: 387  EQDADIVAFLYR 398
            ++  ++V    R
Sbjct: 1507 KEGENVVGSETR 1518


>1b79A [a.81.1] DNAB HELICASE
          Length = 102

 Score =  135 bits (341), Expect = 3e-34
 Identities = 48/102 (47%), Positives = 62/102 (60%)

Query: 11  PPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT 70
           PP +IEAEQ+VLG + L+ +   D  E V  DDFY R H+ +F  M  L   G  ID++T
Sbjct: 1   PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT 60

Query: 71  VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEE 112
           +   L    QLD VGG AY+AEL+ + P+AAN   YA IV E
Sbjct: 61  LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRE 102


>1b79B [a.81.1] DNAB HELICASE
          Length = 103

 Score =  128 bits (324), Expect = 3e-32
 Identities = 48/103 (46%), Positives = 63/103 (61%)

Query: 11  PPQNIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLT 70
           PP +IEAEQ+VLG + L+ +   D  E V  DDFY R H+ +F  M  L   G  ID++T
Sbjct: 1   PPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLIT 60

Query: 71  VQNYLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEK 113
           +   L    QLD VGG AY+AEL+ + P+AAN   YA IV E+
Sbjct: 61  LAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRER 103


>3cmtD [x.x.x] PROTEIN RECA
          Length = 1609

 Score =  125 bits (314), Expect = 2e-31
 Identities = 42/367 (11%), Positives = 102/367 (27%), Gaps = 30/367 (8%)

Query: 44  FYRRAHQILFQAMVDLNNDGEAIDVLTVQNYLTTNNQLDDVGGVAYIAELATSVPTAANA 103
             +    ++           +         +     +  +  G      +   +   A A
Sbjct: 194 AVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGA 253

Query: 104 GYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSLLDSAERQIMDVSERRNRSGFREI 163
            Y  K  +         +   +    A   +  V  LL S     +D ++++  +     
Sbjct: 254 WYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSAIDENKQKALAAALGQ 313

Query: 164 KDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFA 221
            +      S +     +S D+  + TG    D      GL    ++ +    + GKT   
Sbjct: 314 IEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLT 373

Query: 222 LNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAM 281
           L +          + A    E + + +  R L      N    +                
Sbjct: 374 LQVIAAAQR-EGKTCAFIDAEHALDPIYARKL-GVDIDNLLCSQ---------------- 415

Query: 282 GALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNK-ESRQQEVS 340
                     +    I  A  R+    +        L     ++   G +      + +S
Sbjct: 416 ------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMS 469

Query: 341 EISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDD 400
           +  R+L    K+ +  ++ ++Q+   +          +      +++  A +   + R  
Sbjct: 470 QAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTG---GNALKFYASVRLDIRRIG 526

Query: 401 YYERGES 407
             + GE+
Sbjct: 527 AVKEGEN 533



 Score = 87.2 bits (214), Expect = 9e-20
 Identities = 29/234 (12%), Positives = 67/234 (28%), Gaps = 27/234 (11%)

Query: 147  QIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTA--GLQPD 204
              +D ++++  +      +      S +     +S D+  + TG    D      GL   
Sbjct: 963  SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG 1022

Query: 205  NLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHL 264
             ++ +    + GKT   L +          + A    E + + +  R L           
Sbjct: 1023 RIVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKLG---------- 1071

Query: 265  RTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYL 324
                        L              +    I  A  R+    +        L     +
Sbjct: 1072 ------VDIDNLLCSQ-------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI 1118

Query: 325  QLIEG-SNKESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVL 377
            +   G S+     + +S+  R+L    K+ +  ++ ++Q+   +          
Sbjct: 1119 EGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETT 1172



 Score = 86.4 bits (212), Expect = 2e-19
 Identities = 24/201 (11%), Positives = 54/201 (26%), Gaps = 27/201 (13%)

Query: 184 ITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSL 241
           +  + TG    D      GL    ++ +    + GKT   L +          + A    
Sbjct: 1   VETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDA 59

Query: 242 EMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAE 301
           E + + +  R L                       L              +    I  A 
Sbjct: 60  EHALDPIYARKLG----------------VDIDNLLCSQ-------PDTGEQALEICDAL 96

Query: 302 IRAKCRRLAKEKGNLGLVVIDYLQLIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILAL 360
            R+    +        L     ++   G +      + +S+  R+L    K+ +  ++ +
Sbjct: 97  ARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFI 156

Query: 361 SQLSRGVEQRQDKRPVLSDIR 381
           +Q+   +          +   
Sbjct: 157 NQIRMKIGVMFGNPETTTGGN 177



 Score = 84.8 bits (208), Expect = 4e-19
 Identities = 33/243 (13%), Positives = 70/243 (28%), Gaps = 31/243 (12%)

Query: 168 NETLSDIDRL-SQQSEDITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNI 224
                 I RL   +S D+  + TG    D      GL    ++ +    + GKT   L +
Sbjct: 650 QFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQV 709

Query: 225 AQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGAL 284
                     + A    E + + +  R L      N    +                   
Sbjct: 710 IAAAQR-EGKTCAFIDAEHALDPIYARKL-GVDIDNLLCSQP------------------ 749

Query: 285 SNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNK-ESRQQEVSEIS 343
                  +    I  A  R+    +        L     ++   G +      + +S+  
Sbjct: 750 ----DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAM 805

Query: 344 RQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYE 403
           R+L    K+ +  ++ ++Q+   +                 +++  A +   + R    +
Sbjct: 806 RKLAGNLKQSNTLLIFINQIRMKIGVMFGNPE---TTTGGNALKFYASVRLDIRRIGAVK 862

Query: 404 RGE 406
            GE
Sbjct: 863 EGE 865



 Score = 54.4 bits (129), Expect = 6e-10
 Identities = 37/261 (14%), Positives = 77/261 (29%), Gaps = 45/261 (17%)

Query: 149  MDVSERRNRSGFREIKDVLNETLSDIDRLS-QQSEDITGLPTGYREFDKM--TAGLQPDN 205
             +  +    +  +  K         I RL   +S D+  + TG    D      GL    
Sbjct: 1300 ENKQKALAAALGQIEKQF---GKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGR 1356

Query: 206  LIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLR 265
            ++ +    + GKT   L +          + A    E + + +  R L            
Sbjct: 1357 IVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKLG----------- 1404

Query: 266  TGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQ 325
                                     +  +      +    C  LA+      +VV     
Sbjct: 1405 --------------------VDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAA 1444

Query: 326  LIEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRP-------VLS 378
            L   +      + +S+  R+L    K+ +  ++ ++Q+     +             V  
Sbjct: 1445 LTPKAEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKNPETTTGGNALKFYASVRL 1504

Query: 379  DIRESGSIEQDADIVAFLYRD 399
            DIR  G++++  ++V    R 
Sbjct: 1505 DIRRIGAVKEGENVVGSETRV 1525


>3cmwC [x.x.x] PROTEIN RECA
          Length = 1608

 Score =  105 bits (261), Expect = 3e-25
 Identities = 39/305 (12%), Positives = 88/305 (28%), Gaps = 30/305 (9%)

Query: 105 YYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSLLDSAERQIMDVSERRNRSGFREIK 164
           Y  K  +         +   +    A   +  V  LL S     +D ++++  +      
Sbjct: 255 YSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPNSAIDENKQKALAAALGQI 314

Query: 165 DVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFAL 222
           +      S +     +S D+  + TG    D      GL    ++ +    + GKT   L
Sbjct: 315 EKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTL 374

Query: 223 NIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMG 282
            +          + A    E + + +  R L      N    +                 
Sbjct: 375 QVIAAAQ-REGKTCAFIDAEHALDPIYARKL-GVDIDNLLCSQ----------------- 415

Query: 283 ALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNK-ESRQQEVSE 341
                    +    I  A  R+    +        L     ++   G +      + +S+
Sbjct: 416 -----PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQ 470

Query: 342 ISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDY 401
             R+L    K+ +  ++ ++Q+   +                 +++  A +   + R   
Sbjct: 471 AMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPE---TTTGGNALKFYASVRLDIRRIGA 527

Query: 402 YERGE 406
            + GE
Sbjct: 528 VKEGE 532



 Score =  100 bits (248), Expect = 1e-23
 Identities = 32/262 (12%), Positives = 76/262 (29%), Gaps = 30/262 (11%)

Query: 148 IMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTA--GLQPDN 205
            +D ++++  +      +      S +     +S D+  + TG    D      GL    
Sbjct: 631 AIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGR 690

Query: 206 LIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLR 265
           ++ +    + GKT   L +          + A    E + + +  R L            
Sbjct: 691 IVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKLG----------- 738

Query: 266 TGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQ 325
                      L              +    I  A  R+    +        L     ++
Sbjct: 739 -----VDIDNLLCSQPDT-------GEQALEICDALARSGAVDVIVVDSVAALTPKAEIE 786

Query: 326 LIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESG 384
              G +      + +S+  R+L    K+ +  ++ ++Q+   +                 
Sbjct: 787 GEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPE---TTTGGN 843

Query: 385 SIEQDADIVAFLYRDDYYERGE 406
           +++  A +   + R    + GE
Sbjct: 844 ALKFYASVRLDIRRIGAVKEGE 865



 Score = 99.8 bits (247), Expect = 1e-23
 Identities = 27/232 (11%), Positives = 66/232 (28%), Gaps = 27/232 (11%)

Query: 147  QIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTA--GLQPD 204
              +D ++++  +      +      S +     +S D+  + TG    D      GL   
Sbjct: 963  SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG 1022

Query: 205  NLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHL 264
             ++ +    + GKT   L +          + A    E + + +  R        N    
Sbjct: 1023 RIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARK-LGVDIDNLLCS 1080

Query: 265  RTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYL 324
            +                          +    I  A  R+    +        L     +
Sbjct: 1081 Q----------------------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI 1118

Query: 325  QLIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRP 375
            +   G +      + +S+  R+L    K+ +  ++ ++Q+   +        
Sbjct: 1119 EGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPE 1170



 Score = 91.4 bits (225), Expect = 5e-21
 Identities = 39/295 (13%), Positives = 89/295 (30%), Gaps = 61/295 (20%)

Query: 168  NETLSDIDRLS-QQSEDITGLPTGYREFDKMTA--GLQPDNLIILAARPAVGKTAFALNI 224
                  I RL   +S D+  + TG    D      GL    ++ +    + GKT   L +
Sbjct: 1316 QFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQV 1375

Query: 225  AQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGAL 284
                     T   I + E + + +  R L                        +     L
Sbjct: 1376 IAAAQREGKTCAFIDA-EHALDPIYARKLG-----------------------VDIDNLL 1411

Query: 285  SNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISR 344
             +     +        EI     R     G + ++V+D +  +    +    + +S+  R
Sbjct: 1412 CSQPDTGEQ-----ALEICDALARS----GAVDVIVVDSVAALTPKAEGLAARMMSQAMR 1462

Query: 345  QLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYER 404
            +L    K+ +  ++ ++Q+                     +++  A +   + R      
Sbjct: 1463 KLAGNLKQSNTLLIFINQIRMKNP---------ETTTGGNALKFYASVRLDIRRIGAV-- 1511

Query: 405  GESKSEEDGDDQDSLNQDVGEVELIIEKNR---AGARGTVKLLFIKSYNKFSNIS 456
                       ++  N    E  + + KN+      +   ++L+ +  N +  + 
Sbjct: 1512 -----------KEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELV 1555



 Score = 44.0 bits (102), Expect = 9e-07
 Identities = 13/72 (18%), Positives = 24/72 (33%), Gaps = 3/72 (4%)

Query: 184 ITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSL 241
           +  + TG    D      GL    ++ +    + GKT   L +          + A    
Sbjct: 1   VETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDA 59

Query: 242 EMSAESLVNRML 253
           E + + +  R L
Sbjct: 60  EHALDPIYARKL 71


>3bs4A [x.x.x] UNCHARACTERIZED PROTEIN PH0321
          Length = 245

 Score =  101 bits (252), Expect = 4e-24
 Identities = 26/222 (11%), Positives = 58/222 (26%), Gaps = 10/222 (4%)

Query: 187 LPTGYREFDKMTAG-LQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSA 245
           L     E D+      +   ++I     +         I       +D  V +FS+    
Sbjct: 2   LSWEIEELDREIGKIKKHSLILIHEEDASSRGKDILFYILSRKL-KSDNLVGMFSISYPL 60

Query: 246 ESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAK 305
           + ++  +    G     +L   +L   +       +               +    +  K
Sbjct: 61  QLIIRILS-RFGVDVIKYLENHRLAIVDTFGSFHGIMP-----GVWYLEGMLSSETLPIK 114

Query: 306 CRRLAKEKGNLGLV--VIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQL 363
             +  ++   + +   + +  +L   +   S   EV      L+ L     V     +  
Sbjct: 115 YAKAVEDHKKVWMDLNLFEGRELYGFAISMSGYLEVFTPEETLRYLETSAEVRYGHPAYK 174

Query: 364 SRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERG 405
                        + D R   S+ + AD V            
Sbjct: 175 KYPRGTNFWLWEGVKDKRVLLSVYRRADYVLKTRSSLGENGI 216


>1cr1A [c.37.1] DNA PRIMASE/HELICASE
          Length = 245

 Score =  100 bits (248), Expect = 1e-23
 Identities = 40/273 (14%), Positives = 90/273 (32%), Gaps = 36/273 (13%)

Query: 173 DIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILAARPAVGKTAFALNIAQNVATST 232
            I       E +  L +G    +  T G +   +I++ +   +GK+ F    A    T+ 
Sbjct: 4   RIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 233 DTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALS--NTSIF 290
              V +  LE S E     ++     +      + + +  E          L   +T   
Sbjct: 64  GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL 123

Query: 291 IDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLA 350
            D     +   + AK   +        ++++D++ +         ++ +  +  +LK  A
Sbjct: 124 YDSFAEAETDRLLAKLAYMR-SGLGCDVIILDHISI---------RKMIDNLMTKLKGFA 173

Query: 351 KELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSE 410
           K   V ++ +               + +D+R SG++ Q +D +  L R+        K  
Sbjct: 174 KSTGVVLVVICH-------------LKTDLRGSGALRQLSDTIIALERNQLVLVRILK-- 218

Query: 411 EDGDDQDSLNQDVGEVELIIEKNRAGARGTVKL 443
                     +  G+  +          G ++ 
Sbjct: 219 ---------CRFTGDTGIAGYMEYNKETGWLEP 242


>3bgwA [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 419

 Score = 99.5 bits (246), Expect = 2e-23
 Identities = 134/446 (30%), Positives = 206/446 (46%), Gaps = 32/446 (7%)

Query: 14  NIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLTVQN 73
           N  AEQAVLG+I    + + +      P+ F    H  ++  M DL+  G+++D  ++  
Sbjct: 1   NEYAEQAVLGSILTEPELIKECPLT--PEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAA 58

Query: 74  YLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNG 133
            +    +L  +GG  Y+ ELA SV +      + + V E    R+ IS A  II   N  
Sbjct: 59  RVG--EKLPQLGGFGYLTELAASVASTTTFKQHCQTVSEYFQKRKAISIAQQIIENVNVK 116

Query: 134 DDDVPSLLDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYRE 193
                              +  +            E             +ITG+P+G+ E
Sbjct: 117 PIQEAVSELMEIEASGTDDDDGSIDEALVTVYEEIE---------SADGNITGVPSGFTE 167

Query: 194 FDKMTAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRML 253
            D+MT G +  N +++AARP+               +  D  V + SLEM  +  + R++
Sbjct: 168 LDRMTYGYKRRNFVLIAARPS-MGKTAFALKQAKNMSDNDDVVNLHSLEMGKKENIKRLI 226

Query: 254 CAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRL---- 309
              GSINA  ++  + D        ++M     ++  I+       +      +      
Sbjct: 227 VTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTRQTKR 286

Query: 310 AKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQ 369
                 + +++     L      +SR  ++S+ISR LKK+A+EL V ++ALSQLSR VEQ
Sbjct: 287 KNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIALSQLSRQVEQ 346

Query: 370 RQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLNQDVGEVELI 429
           RQDKRP+LSD+RESG +EQDADI+ FLYRDDYY++               ++    VE+I
Sbjct: 347 RQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK--------------ESESKNIVEVI 392

Query: 430 IEKNRAGARGTVKLLFIKSYNKFSNI 455
           I K+R G  GTV L FIK Y  F N+
Sbjct: 393 IAKHRDGPVGTVSLAFIKEYGNFVNL 418


>3cmuA [x.x.x] PROTEIN RECA
          Length = 1937

 Score = 97.7 bits (241), Expect = 6e-23
 Identities = 37/365 (10%), Positives = 95/365 (26%), Gaps = 28/365 (7%)

Query: 36   MEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLTVQNYLTTNNQLDDVGGVAYIAELAT 95
            ++           + +  +  V +  +  A      +  +     ++  G +  +     
Sbjct: 848  LDIRRIGAVKEGENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGINFYGELVDLGVKEK 907

Query: 96   SVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNGDDDVPSLLDSAERQIMDVSERR 155
             +  A     Y      +           N  T           LL +     +D ++++
Sbjct: 908  LIEKAGAWYSYKGEKIGQGKANATAWLKDNPETAKEIEKKVRELLLSNPN-SAIDENKQK 966

Query: 156  NRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMT--AGLQPDNLIILAARP 213
              +      +      S +     +S D+  + TG    D      GL    ++ +    
Sbjct: 967  ALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPE 1026

Query: 214  AVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGE 273
            + GKT   L +          + A    E + + +  R L  +                 
Sbjct: 1027 SSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQ--------- 1076

Query: 274  WQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEG-SNK 332
                              +    I  A  R+    +        L     ++   G S+ 
Sbjct: 1077 --------------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHM 1122

Query: 333  ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADI 392
                + +S+  R+L    K+ +  ++ ++Q+   +          +              
Sbjct: 1123 GLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLD 1182

Query: 393  VAFLY 397
            +  + 
Sbjct: 1183 IRRIG 1187



 Score = 90.0 bits (221), Expect = 1e-20
 Identities = 42/320 (13%), Positives = 94/320 (29%), Gaps = 61/320 (19%)

Query: 149  MDVSERRNRSGFREIKDVLNETLSDIDRLS-QQSEDITGLPTGYREFDKMTA--GLQPDN 205
             +  +    +  +  K         I RL   +S D+  + TG    D      GL    
Sbjct: 1628 ENKQKALAAALGQIEKQF---GKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGR 1684

Query: 206  LIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLR 265
            ++ +    + GKT   L +          + A    E + + +  R L            
Sbjct: 1685 IVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKLG----------- 1732

Query: 266  TGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQ 325
                        +     L +     +    I  A  R+           + ++V+D + 
Sbjct: 1733 ------------VDIDNLLCSQPDTGEQALEICDALARSGA---------VDVIVVDSVA 1771

Query: 326  LIEGSNKES---RQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDK-----RPVL 377
             +    +       + +S+  R+L    K+ +  ++ ++Q+                 V 
Sbjct: 1772 ALTPKAEIEMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRNPETTTGGNALKFYASVR 1831

Query: 378  SDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLNQDVGEVEL-IIEKNRAG 436
             DIR  G++++  ++V    R                 ++ +     + E  I+      
Sbjct: 1832 LDIRRIGAVKEGENVVGSETRVKVV-------------KNKIAAPFKQAEFQILYGEGIN 1878

Query: 437  ARGTVKLLFIKSYNKFSNIS 456
              G +  L +K        +
Sbjct: 1879 FYGELVDLGVKEKLIEKAGA 1898



 Score = 86.5 bits (212), Expect = 1e-19
 Identities = 28/243 (11%), Positives = 67/243 (27%), Gaps = 27/243 (11%)

Query: 147  QIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKMTA--GLQPD 204
              +D ++++  +      +      S +     +S D+  + TG    D      GL   
Sbjct: 1291 SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG 1350

Query: 205  NLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHL 264
             ++ +    + GKT   L +          + A    E + + +  R L           
Sbjct: 1351 RIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKLG---------- 1399

Query: 265  RTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYL 324
                        L              +    I  A  R+    +        L     +
Sbjct: 1400 ------VDIDNLLCS-------QPDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI 1446

Query: 325  QLIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRES 383
            +   G +      + +S+  R+L    K+ +  ++ ++Q+   +          +     
Sbjct: 1447 EGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNAL 1506

Query: 384  GSI 386
               
Sbjct: 1507 KFY 1509



 Score = 74.6 bits (181), Expect = 6e-16
 Identities = 29/233 (12%), Positives = 68/233 (29%), Gaps = 27/233 (11%)

Query: 147 QIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDK--MTAGLQPD 204
             +D ++++  +      +      S +     +S D+  + TG    D      GL   
Sbjct: 625 SAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG 684

Query: 205 NLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHL 264
            ++ +    + GKT   L +          + A    E + + +  R L           
Sbjct: 685 RIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKLG---------- 733

Query: 265 RTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYL 324
               +D                     +    I  A  R+    +        L     +
Sbjct: 734 ----VDIDNLLCSQ---------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEI 780

Query: 325 QL-IEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPV 376
           +  I  S+     + +S+  R+L    K+ +  ++ ++Q+   +         
Sbjct: 781 EGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPET 833



 Score = 56.8 bits (135), Expect = 1e-10
 Identities = 26/222 (11%), Positives = 62/222 (27%), Gaps = 30/222 (13%)

Query: 184 ITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSL 241
           +  + TG    D      GL    ++ +    + GKT   L +          + A    
Sbjct: 1   VETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDA 59

Query: 242 EMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAE 301
           E + + +  R L                        +     L +     +    I  A 
Sbjct: 60  EHALDPIYARKLG-----------------------VDIDNLLCSQPDTGEQALEICDAL 96

Query: 302 IRAKCRRLAKEKGNLGLVVIDYLQLIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILAL 360
            R+    +        L     ++   G +      + +S+  R+L    K+ +  ++ +
Sbjct: 97  ARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFI 156

Query: 361 SQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYY 402
           +Q+   +                 +++  A +   + R    
Sbjct: 157 NQIRMKIGVMFGNPE---TTTGGNALKFYASVRLDIRRIGAV 195



 Score = 49.1 bits (115), Expect = 2e-08
 Identities = 25/248 (10%), Positives = 67/248 (27%), Gaps = 45/248 (18%)

Query: 147 QIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPD 204
             +D ++++  +      +      S +     +S D+  + TG    D      GL   
Sbjct: 292 LAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMG 351

Query: 205 NLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHL 264
            ++ +    + GKT   L +                                 +      
Sbjct: 352 RIVEIYGPESSGKTTLTLQVIAAAQ------------------------REGKTCAFIDA 387

Query: 265 RTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYL 324
                     +  +     L +     +    I  A  R+           + ++V+D +
Sbjct: 388 EHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA---------VDVIVVDSV 438

Query: 325 QLI----------EGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKR 374
             +            S+     + +S+  R+L    K+ +  ++ ++Q+   +       
Sbjct: 439 AALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNP 498

Query: 375 PVLSDIRE 382
              +    
Sbjct: 499 ETTTGGNA 506


>3b9cA [x.x.x] HSPC159
          Length = 134

 Score = 94.3 bits (234), Expect = 6e-22
 Identities = 14/136 (10%), Positives = 42/136 (30%), Gaps = 11/136 (8%)

Query: 195 DKMTAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAI-FSLEMSAESLVNRML 253
             +  G++P   +++     +   +FA+++    +      VAI      +   L+    
Sbjct: 4   GHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSC 63

Query: 254 CAEGS-INANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKE 312
            +       + +        +   + +         +F+D               R+ + 
Sbjct: 64  ISGERGEEQSAIPYFPFIPDQPFRVEILCE-YPRFRVFVDGHQLFDFY------HRI-QT 115

Query: 313 KGNLGLVVID-YLQLI 327
              +  + I+  LQ+ 
Sbjct: 116 LSAIDTIKINGDLQIT 131


>3dvlD [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
          Length = 483

 Score = 87.6 bits (216), Expect = 7e-20
 Identities = 36/282 (12%), Positives = 74/282 (26%), Gaps = 44/282 (15%)

Query: 180 QSEDITGLPTGYREFDKMTA-GLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAI 238
           + + I  + T    FD ++  GL      +++     GKT F++    N     D     
Sbjct: 1   EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVF 60

Query: 239 FSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIK 298
            + E + + ++         +                 L +     S      +   G  
Sbjct: 61  VTFEETPQDIIKNARSFGWDLAKLVD---------EGKLFIL--DASPDPEGQEVVGGFD 109

Query: 299 MAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPIL 358
           ++ +  +      +K     V ID +  +    +      V     +L    K++    +
Sbjct: 110 LSALIERINYAI-QKYRARRVSIDSVTSVF--QQYDASSVVRRELFRLVARLKQIGATTV 166

Query: 359 ALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDS 418
             ++                 I   G  E  +D V  L      ER              
Sbjct: 167 MTTERIEEY----------GPIARYGVEEFVSDNVVILRNVLEGER-------------- 202

Query: 419 LNQDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNISYAQE 460
                    L I K R  +    +  F  + +  +       
Sbjct: 203 -----RRRTLEILKLRGTSHMKGEYPFTITDHGINIFPLGAM 239



 Score = 80.3 bits (197), Expect = 1e-17
 Identities = 26/194 (13%), Positives = 55/194 (28%), Gaps = 26/194 (13%)

Query: 176 RLSQQSEDITGLPTGYREFDKMTAG-LQPDNLIILAARPAVGKTAFALNIAQNVATSTDT 234
           RL+Q+S ++  + +G    D+M  G    D++I+       GKT       +N   +   
Sbjct: 240 RLTQRSSNVR-VSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENAC-ANKE 297

Query: 235 SVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDT 294
              +F+ E S   L+                    +      L           I     
Sbjct: 298 RAILFAYEESRAQLLRNAY---------SWGMDFEEMERQNLLK----------IVCAYP 338

Query: 295 PGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELS 354
               + +     +    +      + ID L  +             +    +   AK+  
Sbjct: 339 ESAGLEDHLQIIKSEIND-FKPARIAIDSLSALARGV---SNNAFRQFVIGVTGYAKQEE 394

Query: 355 VPILALSQLSRGVE 368
           +  L  +   + + 
Sbjct: 395 ITGLFTNTSDQFMG 408


>3cmwA [x.x.x] PROTEIN RECA
          Length = 1609

 Score = 86.1 bits (211), Expect = 2e-19
 Identities = 25/223 (11%), Positives = 58/223 (26%), Gaps = 27/223 (12%)

Query: 184 ITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSL 241
           +  + TG    D      GL    ++ +    + GKT   L +          + A    
Sbjct: 1   VETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDA 59

Query: 242 EMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAE 301
           E + + +  R L  +                                   +    I  A 
Sbjct: 60  EHALDPIYARKLGVDIDNLLCSQ-----------------------PDTGEQALEICDAL 96

Query: 302 IRAKCRRLAKEKGNLGLVVIDYLQLIEG-SNKESRQQEVSEISRQLKKLAKELSVPILAL 360
            R+    +        L     ++   G S+     + +S+  R+L    K+ +  ++ +
Sbjct: 97  ARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFI 156

Query: 361 SQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYE 403
           +Q+   +          +              +  +      E
Sbjct: 157 NQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGE 199



 Score = 83.4 bits (204), Expect = 1e-18
 Identities = 33/276 (11%), Positives = 82/276 (29%), Gaps = 30/276 (10%)

Query: 149 MDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPDNL 206
           +D ++++  +      +      S +     +S D+  + TG    D      GL    +
Sbjct: 299 IDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRI 358

Query: 207 IILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRT 266
           + +    + GKT   L +    A     + A    E + + +  R L  +          
Sbjct: 359 VEIYGPESSGKTTLTLQVIAA-AQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP- 416

Query: 267 GQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQL 326
                                    +    I  A  R+    +        L     ++ 
Sbjct: 417 ----------------------DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEG 454

Query: 327 IEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGS 385
             G +      + +S+  R+L    K+ +  ++ ++Q+   +          +       
Sbjct: 455 EIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNA--- 511

Query: 386 IEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLNQ 421
           ++  A +   + R    + GE+    +   +   N+
Sbjct: 512 LKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNK 547



 Score = 75.7 bits (184), Expect = 3e-16
 Identities = 29/237 (12%), Positives = 72/237 (30%), Gaps = 27/237 (11%)

Query: 148 IMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPDN 205
            +D ++++  +      +      S +     +S D+  + TG    D      GL    
Sbjct: 631 AIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGR 690

Query: 206 LIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLR 265
           ++ +    + GKT   L +          + A    E + + +  R L     ++ ++L 
Sbjct: 691 IVEIYGPESSGKTTLTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKL----GVDIDNLL 745

Query: 266 TGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQ 325
             Q                       +    I  A  R+    +        L     ++
Sbjct: 746 CSQ-------------------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIE 786

Query: 326 LIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIR 381
              G +      + +S+  R+L    K+ +  ++ ++Q+   +          +   
Sbjct: 787 GEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGN 843



 Score = 72.6 bits (176), Expect = 2e-15
 Identities = 37/295 (12%), Positives = 84/295 (28%), Gaps = 56/295 (18%)

Query: 173  DIDRLSQQS-EDITGLPTGYREFDKMTA--GLQPDNLIILAARPAVGKTAFALNIAQNVA 229
             I RL +    D+  + TG    D      GL    ++ +    + GKT   L +     
Sbjct: 1321 SIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQ 1380

Query: 230  TSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSI 289
                 + A    E + +                            +  +     L +   
Sbjct: 1381 R-EGKTCAFIDAEHALD-----------------------PIYARKLGVDIDNLLCSQPD 1416

Query: 290  FIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLI---EGSNKESRQQEVSEISRQL 346
              +    I  A  R+           + ++V+D +  +            + +S+  R+L
Sbjct: 1417 TGEQALEICDALARSGA---------VDVIVVDSVAALTPKAEIEMGLAARMMSQAMRKL 1467

Query: 347  KKLAKELSVPILALSQLSRGVEQRQDK-----RPVLSDIRESGSIEQDADIVAFLYRDDY 401
                K+ +  ++ ++Q+                 V  DIR  G++++  ++V    R   
Sbjct: 1468 AGNLKQSNTLLIFINQIRNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKV 1527

Query: 402  YERGESKSEEDGDDQDSLNQDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNIS 456
             +   +   +  +              I+        G +  L +K        +
Sbjct: 1528 VKNKIAAPFKQAE------------FQILYGEGINFYGELVDLGVKEKLIEKAGA 1570



 Score = 63.8 bits (153), Expect = 1e-12
 Identities = 29/258 (11%), Positives = 74/258 (28%), Gaps = 30/258 (11%)

Query: 148  IMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYREFDKM--TAGLQPDN 205
             +D ++++  +      +      S +     +S D+  + TG    D      GL    
Sbjct: 964  AIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGR 1023

Query: 206  LIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLR 265
            ++ +    + GKT   L +          + A    E + + +  R              
Sbjct: 1024 IVEIYGPESSGKTTLTLQVIAAAQR-EGKTCAFIDAEHALDPIYARK------------- 1069

Query: 266  TGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQ 325
             G   +    +               +    I  A  R+    +        L     ++
Sbjct: 1070 LGVDIDNLLCSQ----------PDTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIE 1119

Query: 326  LIEGSNK-ESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESG 384
               G +      + +S+  R+L    K+ +  ++ ++Q+   +                 
Sbjct: 1120 GEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETT---TGGN 1176

Query: 385  SIEQDADIVAFLYRDDYY 402
            +++  A +   + R    
Sbjct: 1177 ALKFYASVRLDIRRIGAV 1194


>3cmvA [x.x.x] PROTEIN RECA
          Length = 1190

 Score = 79.7 bits (195), Expect = 2e-17
 Identities = 34/295 (11%), Positives = 73/295 (24%), Gaps = 44/295 (14%)

Query: 163 IKDVLNETLSDIDRLSQQS-EDITGLPTGYREFDKMTA--GLQPDNLIILAARPAVGKTA 219
            +         I RL +    D+  + TG    D      GL    ++ +    + GKT 
Sbjct: 286 GQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTT 345

Query: 220 FALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIV 279
             L +          + A    E + + +  R L  +                       
Sbjct: 346 LTLQVIAAAQ-REGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQP-------------- 390

Query: 280 AMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQL-IEGSNKESRQQE 338
                       +    I  A  R+    +        L     ++  I  S+     + 
Sbjct: 391 ---------DTGEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARM 441

Query: 339 VSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYR 398
           +S+  R+L    K+ +  ++ ++Q+   +          +              +  +  
Sbjct: 442 MSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGA 501

Query: 399 DDYYERGESKSEEDGDDQDSLNQDVGEVELIIEKNRAGARGTVKLLFIKSYNKFS 453
                                N    E  + + KN+  A        I      +
Sbjct: 502 VKEG----------------ENVVGSETRVKVVKNKIAAPFKQAEFQILYGEGIN 540


>3dvlC [x.x.x] CIRCADIAN CLOCK PROTEIN KINASE KAIC
          Length = 486

 Score = 79.4 bits (195), Expect = 2e-17
 Identities = 35/228 (15%), Positives = 68/228 (29%), Gaps = 25/228 (10%)

Query: 180 QSEDITGLPTGYREFDKMTA-GLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAI 238
           + + I  + T    FD ++  GL      +++     GKT F++    N     D     
Sbjct: 1   EHQAIAKMRTMIEGFDDISHGGLPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVF 60

Query: 239 FSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIK 298
            + E + + ++     + G   A  +  G+L       ++ A        +         
Sbjct: 61  VTFEETPQDIIKNAR-SFGWDLAKLVDEGKL------FILDASPDPEGQEVVGGFDLSAL 113

Query: 299 MAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPIL 358
           +  I       A +K     V ID +  +    +      V     +L    K++    +
Sbjct: 114 IERINY-----AIQKYRARRVSIDSVTSVF--QQYDASSVVRRELFRLVARLKQIGATTV 166

Query: 359 ALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGE 406
             ++                 I   G  E  +D V  L      ER  
Sbjct: 167 MTTERIEEY----------GPIARYGVEEFVSDNVVILRNVLEGERRR 204



 Score = 52.4 bits (125), Expect = 3e-09
 Identities = 32/188 (17%), Positives = 60/188 (31%), Gaps = 26/188 (13%)

Query: 176 RLSQQSEDITGLPTGYREFDKMTAG-LQPDNLIILAARPAVGKTAFALNIAQNVATSTDT 234
           RL+Q+S ++  + +G    D+M  G    D++I+       GKT       +N   +   
Sbjct: 240 RLTQRSSNVR-VSSGVVRLDEMCGGGFFKDSIILATGATGTGKTLLVSRFVENAC-ANKE 297

Query: 235 SVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDT 294
              +F+ E S   L+        S   +       +E E QNL+            +   
Sbjct: 298 RAILFAYEESRAQLLRNAY----SWGMD------FEEMERQNLLK----------IVCAY 337

Query: 295 PGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELS 354
           P     E   +  +          + ID L  +             +    +   AK+  
Sbjct: 338 PESAGLEDHLQIIKSEINDFKPARIAIDSLSALARG---VSNNAFRQFVIGVTGYAKQEE 394

Query: 355 VPILALSQ 362
           +  L  + 
Sbjct: 395 ITGLFTNT 402


>3cmvH [x.x.x] PROTEIN RECA
          Length = 1173

 Score = 73.9 bits (180), Expect = 9e-16
 Identities = 47/451 (10%), Positives = 116/451 (25%), Gaps = 67/451 (14%)

Query: 17   AEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLTVQNYLT 76
             +Q+    IF+N                +  + ++  + +  +      +   T    + 
Sbjct: 750  LKQSNTLLIFINQG---------GNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVK 800

Query: 77   TNNQLDDVGGV---AYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNG 133
                           Y   +               I +  +               A   
Sbjct: 801  NKIAAPFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGKANATAW 860

Query: 134  DDDVPSLLDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQS-EDITGLPTGYR 192
              D P      E+++ ++  ++        +         I RL +    D+  + TG  
Sbjct: 861  LKDNPETAKEIEKKVRELLLKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSL 920

Query: 193  EFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLVN 250
              D      GL    ++ +    + GKT   L +                          
Sbjct: 921  SLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQRE------------------- 961

Query: 251  RMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAKCRRLA 310
                   +                +  +     L +     +    I  A  R+      
Sbjct: 962  -----GKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALEICDALARSGA---- 1012

Query: 311  KEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSRGVEQR 370
                 + ++V+D +  +         + +S+  R+L    K+ +  ++ ++Q    ++  
Sbjct: 1013 -----VDVIVVDSVAALTPL----AARMMSQAMRKLAGNLKQSNTLLIFINQGGNALKFY 1063

Query: 371  QDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLNQDVGEVELII 430
               R    DIR  G++++  ++V    R         K++     +            I+
Sbjct: 1064 ASVR---LDIRRIGAVKEGENVVGSETRVKVV-----KNKIAAPFKQ-------AEFQIL 1108

Query: 431  EKNRAGARGTVKLLFIKSYNKFSNISYAQEP 461
                    G +  L +K        ++    
Sbjct: 1109 YGEGINFYGELVDLGVKEKLIEKAGAWYSYK 1139



 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 34/226 (15%), Positives = 75/226 (33%), Gaps = 40/226 (17%)

Query: 182 EDITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIF 239
            D+  + TG    D      GL    ++ +    + GKT   L +         T  A  
Sbjct: 611 MDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKT-CAFI 669

Query: 240 SLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKM 299
             E + + +  R L  +                   NL+ +                   
Sbjct: 670 DAEHALDPIYARKLGVD-----------------IDNLLCS--------------QPDTG 698

Query: 300 AEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNK--ESRQQEVSEISRQLKKLAKELSVPI 357
            +    C  LA+    + ++V+D +  +    +      + +S+  R+L    K+ +  +
Sbjct: 699 EQALEICDALARSGA-VDVIVVDSVAALTPKAEIEGLAARMMSQAMRKLAGNLKQSNTLL 757

Query: 358 LALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYE 403
           + ++Q    ++     R    DIR  G++++  ++V    R    +
Sbjct: 758 IFINQGGNALKFYASVR---LDIRRIGAVKEGENVVGSETRVKVVK 800


>3bgwD [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 409

 Score = 65.3 bits (157), Expect = 3e-13
 Identities = 123/450 (27%), Positives = 198/450 (44%), Gaps = 50/450 (11%)

Query: 14  NIEAEQAVLGAIFLNTDALADAMEYVEPDDFYRRAHQILFQAMVDLNNDGEAIDVLTVQN 73
           N  AEQAVLG+I    + + +      P+ F    H  ++  M DL+  G+++D  ++  
Sbjct: 1   NEYAEQAVLGSILTEPELIKECPL--TPEHFSPGKHFNIYFTMQDLDRKGQSVDFTSIAA 58

Query: 74  YLTTNNQLDDVGGVAYIAELATSVPTAANAGYYAKIVEEKSMLRRLISTATNIITQANNG 133
            +                                      + L   +++ T         
Sbjct: 59  RVGEKLPQL-------------------------GGFGYLTELAASVASTTTFKQHCQTV 93

Query: 134 DDDVPSLLDSAERQIMDVSERRNRSGFREIKDVLNETLSDIDRLSQQSEDITGLPTGYRE 193
            +        +  Q +  +           + +  E    +  + ++ E   G  TG   
Sbjct: 94  SEYFQKRKAISIAQQIIENVNVKPIQEAVSELMEIEIDEALVTVYEEIESADGNITGVPS 153

Query: 194 ----FDKMTAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSAESLV 249
                D+MT G +  N +++AARP++GKTAFAL       +  D  V + SLEM  +  +
Sbjct: 154 GFTELDRMTYGYKRRNFVLIAARPSMGKTAFALKQ-AKNMSDNDDVVNLHSLEMGKKENI 212

Query: 250 NRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIF----IDDTPGIKMAEIRAK 305
            R++   GSINA  ++  + D        ++M     ++            +     + +
Sbjct: 213 KRLIVTAGSINAQKIKAARRDFASEDWGKLSMAIGEISNSNINIFDKAGQSVNYIWSKTR 272

Query: 306 CRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSR 365
             +       + +++     L      +SR  ++S+ISR LKK+A+EL V ++ALSQLSR
Sbjct: 273 QTKRKNPGKRVIVMIDYLQLLEPAKANDSRTNQISQISRDLKKMARELDVVVIALSQLSR 332

Query: 366 GVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEEDGDDQDSLNQDVGE 425
            VEQRQDKRP+LSD+RESG +EQDADI+ FLYRDDYY++               ++    
Sbjct: 333 QVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK--------------ESESKNI 378

Query: 426 VELIIEKNRAGARGTVKLLFIKSYNKFSNI 455
           VE+II K+R G  GTV L FIK Y  F N+
Sbjct: 379 VEVIIAKHRDGPVGTVSLAFIKEYGNFVNL 408


>1e0jA [c.37.1] DNA HELICASE
          Length = 287

 Score = 56.7 bits (135), Expect = 1e-10
 Identities = 49/301 (16%), Positives = 99/301 (32%), Gaps = 25/301 (8%)

Query: 163 IKDVLNETLSDIDRLSQ-QSEDITGLPTGYREFDKMTAGLQPDNLIILAARPAVGKTAFA 221
           I D +   LS  +R+ +  S  +  L +G    +  T G +   +I++ +   +GK+ F 
Sbjct: 1   IPDGVVSALSLRERIREHLSSSVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFV 60

Query: 222 LNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAM 281
              A    T+    V +  LE S E     ++     +      + + +  E        
Sbjct: 61  RQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF 120

Query: 282 GALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDY--LQLIEGSNKESRQQEV 339
             L     F       +    R   +      G    V+I      ++  S +   ++ +
Sbjct: 121 DELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMI 180

Query: 340 SEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVL---SDIRESGSIEQDADIVAFL 396
             +  +LK  AK   V ++ +  L    + +  +       +D+R SG++ Q +D +  L
Sbjct: 181 DNLMTKLKGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIAL 240

Query: 397 YRDDYYERGESKSEEDGDDQDSLNQDVGEVELIIEKNR-AGARGTVKLLFIKSYNKFSNI 455
            R+   +                        + I K R  G  G    +       +   
Sbjct: 241 ERNQQGDMPNLV------------------LVRILKCRFTGDTGIAGYMEYNKETGWLEP 282

Query: 456 S 456
           S
Sbjct: 283 S 283


>3cmvE [x.x.x] PROTEIN RECA
          Length = 1165

 Score = 52.2 bits (123), Expect = 3e-09
 Identities = 38/243 (15%), Positives = 79/243 (32%), Gaps = 43/243 (17%)

Query: 163  IKDVLNETLSDIDRLSQQS-EDITGLPTGYREFDKM--TAGLQPDNLIILAARPAVGKTA 219
             +         I RL +    D+  + TG    D      GL    ++ +    + GKT 
Sbjct: 882  GQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTT 941

Query: 220  FALNIAQNVATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIV 279
              L +          + A    E + + +  R L     ++ ++L   Q D GE    I 
Sbjct: 942  LTLQVIAAAQR-EGKTCAFIDAEHALDPIYARKL----GVDIDNLLCSQPDTGEQALEIC 996

Query: 280  AMGALSNTSIFIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEV 339
                                              G + ++V+D +     +      + +
Sbjct: 997  DA--------LARS--------------------GAVDVIVVDSV----AALTPLAARMM 1024

Query: 340  SEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRD 399
            S+  R+L    K+ +  ++ ++Q    ++     R    DIR  G++++  ++V    R 
Sbjct: 1025 SQAMRKLAGNLKQSNTLLIFINQGGNALKFYASVR---LDIRRIGAVKEGENVVGSETRV 1081

Query: 400  DYY 402
               
Sbjct: 1082 KVV 1084


>1e0jB [c.37.1] DNA HELICASE
          Length = 288

 Score = 48.3 bits (113), Expect = 5e-08
 Identities = 45/294 (15%), Positives = 95/294 (32%), Gaps = 24/294 (8%)

Query: 169 ETLSDIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILAARPAVGKTAFALNIAQNV 228
                I       E +  L +G    +  T G +   +I++ +   +GK+ F    A   
Sbjct: 9   SLRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQW 68

Query: 229 ATSTDTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTS 288
            T+    V +  LE S E     ++     +      + + +  E          L    
Sbjct: 69  GTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGND 128

Query: 289 I--FIDDTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQL 346
                D     +   + AK   +    G   +++     ++  S +   ++ +  +  +L
Sbjct: 129 TFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIVVSASGESDERKMIDNLMTKL 188

Query: 347 KKLAKELSVPILALSQLSRGVEQ---RQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYE 403
           K  AK   V ++ +  L    +     + +   ++D+R SG++ Q +D +  L R+   +
Sbjct: 189 KGFAKSTGVVLVVICHLKNPDKGKAHEEGRPVSITDLRGSGALRQLSDTIIALERNQQGD 248

Query: 404 RGESKSEEDGDDQDSLNQDVGEVELIIEKNR-AGARGTVKLLFIKSYNKFSNIS 456
                                 V + I K R  G  G    +       +   S
Sbjct: 249 MP------------------NLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPS 284


>1cr4A [c.37.1] DNA PRIMASE/HELICASE
          Length = 243

 Score = 42.3 bits (98), Expect = 3e-06
 Identities = 35/271 (12%), Positives = 75/271 (27%), Gaps = 34/271 (12%)

Query: 173 DIDRLSQQSEDITGLPTGYREFDKMTAGLQPDNLIILAARPAVGKTAFALNIAQNVATST 232
            I       E +  L +G    +  T G +   +I++ +   +GK+ F    A    T+ 
Sbjct: 4   RIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAM 63

Query: 233 DTSVAIFSLEMSAESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFID 292
              V +  LE S E     ++     +      + + +  E          L     F  
Sbjct: 64  GKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHL 123

Query: 293 DTPGIKMAEIRAKCRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKE 352
                +      +         +     +  L      +  S ++ +  +  +LK  AK 
Sbjct: 124 YDSFAEAETD--RLLAKLAYMRSGLGCDVIIL------DHISIRKMIDNLMTKLKGFAKS 175

Query: 353 LSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERGESKSEED 412
             V ++ +  L                     ++ Q +D +  L R+        K    
Sbjct: 176 TGVVLVVICHLKDLRGG---------------ALRQLSDTIIALERNQLVLVRILKCRFT 220

Query: 413 GDDQDSLNQDVGEVELIIEKNRAGARGTVKL 443
                      G+  +          G ++ 
Sbjct: 221 -----------GDTGIAGYMEYNKETGWLEP 240


>2bkeA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
          Length = 289

 Score = 41.6 bits (96), Expect = 4e-06
 Identities = 13/109 (11%), Positives = 35/109 (32%), Gaps = 3/109 (2%)

Query: 113 KSMLRRLISTATNIITQANNGD-DDVPSLLDSAERQIMDVSERRNRSGFREIKDVLNETL 171
              +  L   +  +I +        + +L  ++ + +   +     +  + IK+  +   
Sbjct: 2   IKTINDLPGISQTVINKLIEAGYSSLETLAVASPQDLSVAAGIPLSTAQKIIKEARDALD 61

Query: 172 SDIDRLSQ--QSEDITGLPTGYREFDKMTAGLQPDNLIILAARPAVGKT 218
                  +  +  ++  + TG +  D + AG               GKT
Sbjct: 62  IRFKTALEVKKERNVKKISTGSQALDGLLAGGIETRTTEFFGEFGSGKT 110


>2cvfA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADB
          Length = 220

 Score = 41.3 bits (95), Expect = 6e-06
 Identities = 28/217 (12%), Positives = 57/217 (26%), Gaps = 31/217 (14%)

Query: 187 LPTGYREFDK-MTAGLQPDNLIILAARPAVGKTAFALNIAQNVATSTDTSVAIFSLEMSA 245
           L TG +  D  +  G  P  L  +    A GKT  AL         +   VA    E   
Sbjct: 2   LSTGTKSLDSLLGGGFAPGVLTQVYGPYASGKTTLALQTGLL----SGKKVAYVDTEGGF 57

Query: 246 ESLVNRMLCAEGSINANHLRTGQLDEGEWQNLIVAMGALSNTSIFIDDTPGIKMAEIRAK 305
                  +     +N     +  +                             + +    
Sbjct: 58  SPERLVQMAETRGLNPEEALSRFILFTPS-------------DFKEQRRVIGSLKKTVDS 104

Query: 306 CRRLAKEKGNLGLVVIDYLQLIEGSNKESRQQEVSEISRQLKKLAKELSVPILALSQLSR 365
              L                     N+     E+S   + L  +A++ ++P++ ++Q+  
Sbjct: 105 NFALVVVDSITAH-------YRAEENRSGLIAELSRQLQVLLWIARKHNIPVIVINQV-- 155

Query: 366 GVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYY 402
                 D R  ++      ++      +  L +    
Sbjct: 156 ----HFDSRTEMTKPVAEQTLGYRCKDILRLDKLPKP 188


>3eizA [x.x.x] INORGANIC PYROPHOSPHATASE
          Length = 182

 Score = 38.9 bits (90), Expect = 3e-05
 Identities = 29/136 (21%), Positives = 45/136 (33%), Gaps = 9/136 (6%)

Query: 279 VAMGALSNTSIFIDDTPGIKM-AEIRAKCRRLAKE-KGNLGLVVIDYLQLIEGSNKESRQ 336
           +   + SN     D      +  EI A+   +  E    LGL+V+D           +  
Sbjct: 5   LEAQSFSNVPAGKDLPQDFNVIIEIPAQSEPVKYEADKALGLLVVDRFIGTGMRYPVNYG 64

Query: 337 QEVSEISRQLKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFL 396
                I + L      + V ++    L  G   R     +L    ESG    DA +VA  
Sbjct: 65  F----IPQTLSGDGDPVDVLVITPFPLLAGSVVRARALGMLKMTDESG---VDAKLVAVP 117

Query: 397 YRDDYYERGESKSEED 412
           +          KS +D
Sbjct: 118 HDKVCPMTANLKSIDD 133


>3bh0A [x.x.x] DNAB-LIKE REPLICATIVE HELICASE
          Length = 284

 Score = 38.2 bits (87), Expect = 5e-05
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 14/110 (12%)

Query: 346 LKKLAKELSVPILALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVAFLYRDDYYERG 405
           LKK+A+EL V ++ALSQLSR VEQRQDKRP+LSD+RESG +EQDADI+ FLYRDDYY++ 
Sbjct: 188 LKKMARELDVVVIALSQLSRQVEQRQDKRPMLSDLRESGQLEQDADIIEFLYRDDYYDK- 246

Query: 406 ESKSEEDGDDQDSLNQDVGEVELIIEKNRAGARGTVKLLFIKSYNKFSNI 455
                         ++    VE+II K+R G  GTV L FIK Y  F N+
Sbjct: 247 -------------ESESKNIVEVIIAKHRDGPVGTVSLAFIKEYGNFVNL 283


>2dflA [x.x.x] DNA REPAIR AND RECOMBINATION PROTEIN RADA
          Length = 294

 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 13/110 (11%), Positives = 39/110 (35%), Gaps = 5/110 (4%)

Query: 116 LRRLISTATNIITQA-NNGDDDVPSLLDSAERQI---MDVSERRNRSGFREIKDVLNETL 171
           +  L   +  +I +    G   + +L  ++ + +     +     +   +E +D L+   
Sbjct: 2   INDLPGISQTVINKLIEAGYSSLETLAVASPQDLSVAAGIPLSTAQKIIKEARDALDIRF 61

Query: 172 SDIDRLSQQSEDITGLPTGYRE-FDKMTAGLQPDNLIILAARPAVGKTAF 220
                + ++  ++  + TG +     +  G++   +         GKT  
Sbjct: 62  KTALEVKKERMNVKKISTGSQALDGLLAGGIETRTMTEFFGEFGSGKTQL 111


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.137    0.406 

Gapped
Lambda     K      H
   0.267   0.0537    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,861,205
Number of extensions: 1335283
Number of successful extensions: 14774
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5913
Number of HSP's successfully gapped: 295
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)