RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABD99233.1 lsal0 rbsK GIB00337CH01 "Ribokinase"
         (307 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00294 PfkB "pfkB family carbohydrate kinase"                        136   6e-35
PF08543 Phos_pyr_kin "Phosphomethylpyrimidine kinase"                  37   5e-05

>PF00294 PfkB "pfkB family carbohydrate kinase"
          Length = 295

 Score =  136 bits (342), Expect = 6e-35
 Identities = 101/292 (34%), Positives = 158/292 (54%), Gaps = 15/292 (5%)

Query: 7   VLGSLNVDTILRIPRLPQPGETLKMDDIGVAGGGKGANQAISAARSKSHVTFIGGVGNDV 66
           V+G + +D +  + R    GET++      + GG GAN A++ AR  + V  +G VG+D 
Sbjct: 4   VIGEVMIDLVPTVDR----GETVRASSFEQSPGGAGANVAVALARLGARVALVGAVGDDE 59

Query: 67  QGEMMLKLLKEDGININNVAKLNEG--TGQAFILLQESGENSIVIYGGANQAIKTTVIQN 124
            G  +L  L+ +G++ + V +++ G  TG A IL+   GE +IVIY GAN  +    + +
Sbjct: 60  FGRFLLDELEAEGVDTSGV-RVDPGAPTGVALILVDGDGERTIVIYRGANADLTPEELAD 118

Query: 125 ----AMNDIKDSDFLVAQF--ETPLEVTNEAFKLARELNVKTILNPAPATDILDELKKNI 178
               A  DI     L+ +   E  LE   EA K   + N++  L  A A + L EL   +
Sbjct: 119 EDLLAGADILHLSGLLPEELPEATLEAAIEAAKAGGDPNLRDPLW-ADAREALRELLPYV 177

Query: 179 DLIIPNETEAELLTGIKVVDEDTCRQAADKLIDQGINNVIITLGKQGAYYKTKDGVCELV 238
           D++ PNE EAE LTG +  D +    A  KL+++G+  V++TLG  GA   T DG   + 
Sbjct: 178 DILKPNEEEAEALTGAEGEDPEEALAALRKLLEKGVKIVVVTLGADGALLYTGDGEYHVP 237

Query: 239 PAFKVKAIDTTAAGDTFIGALVSKLDTSFSNLREAIIYASKASSLAVQRLGA 290
               V+ +DTT AGD F+  L++ L  +  +L EA+ +A+ A++L V R GA
Sbjct: 238 AVPPVEVVDTTGAGDAFVAGLLAGL-LAGKSLEEALRFANAAAALVVTRPGA 288


>PF08543 Phos_pyr_kin "Phosphomethylpyrimidine kinase"
          Length = 245

 Score = 36.6 bits (84), Expect = 5e-05
 Identities = 23/60 (38%), Positives = 34/60 (56%), Gaps = 4/60 (6%)

Query: 167 ATDILDELKKNI----DLIIPNETEAELLTGIKVVDEDTCRQAADKLIDQGINNVIITLG 222
           A D ++ L++ +    DLI PN  EAELLTGIK+   +  ++AA  L   G   V++  G
Sbjct: 105 APDAVEALREELLPLADLITPNLFEAELLTGIKITSLEDLKEAARALHALGPKAVLVKGG 164


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.325    0.141    0.412 

Gapped
Lambda     K      H
   0.267   0.0577    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 10,999,865
Number of extensions: 591891
Number of successful extensions: 87405
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1640
Number of HSP's successfully gapped: 248
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)