RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABD99303.1 lsal0 thrS GIB00337CH01 "Threonyl-tRNA synthetase"
         (649 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00587 tRNA-synt_2b "tRNA synthetase class II core domain (G, H...    87   2e-20
PF03129 HGTP_anticodon "Anticodon binding domain"                      71   1e-15
PF02824 TGS "TGS domain"                                               61   2e-12

>PF00587 tRNA-synt_2b "tRNA synthetase class II core domain (G, H,
           P, S and T)"
          Length = 170

 Score = 86.7 bits (214), Expect = 2e-20
 Identities = 51/153 (33%), Positives = 80/153 (52%), Gaps = 2/153 (1%)

Query: 276 IRRVIERYIIDKEVAWGFQHVYTPVLANLNLYKQSGHWDHYREDMFPPMDMGDGEMLELR 335
           I+R +E++  ++ V +G++ + TP+L    L K SGH D + ++M+   D G G  L LR
Sbjct: 1   IKRALEQFWREEFVEYGYEEIDTPILEPYELLKASGHVDKFADEMYKFKDRG-GRDLYLR 59

Query: 336 PMNCPSHIQVYNHHKRSYRELPLRIAELGMMHRYEKSGALTGLSRVREMTLNDGHDFIEP 395
           P       + + +   SYR+LPLR+A++G + R E      GL RVRE T  +   F  P
Sbjct: 60  PETTQPIARNFKNLLLSYRKLPLRLAQIGKVFRNE-IRPRRGLGRVREFTQVEAEIFGTP 118

Query: 396 DHIEDEIKTLIKLMTEVYNDFDITDYRFRLSYR 428
           +   +E+  +I L  E      +  YR RL  R
Sbjct: 119 EQSNEELAEMIALAEEFLEKLGLDPYRVRLHTR 151


>PF03129 HGTP_anticodon "Anticodon binding domain"
          Length = 91

 Score = 70.8 bits (173), Expect = 1e-15
 Identities = 34/78 (43%), Positives = 58/78 (74%), Gaps = 3/78 (3%)

Query: 551 VDIIPVKNDLHMDYVNDLSSKLRAHGIRVTVDDRNEKMGYKIRQAQVNKIPYTLVIGDEE 610
           V +IP+ ++L +DY  +L+++LRA GIRV +DD +  +G KI++A +  IPY +++G++E
Sbjct: 2   VVVIPLGDEL-LDYAQELAAELRAAGIRVELDDSSGSLGKKIKRADLRGIPYAIIVGEKE 60

Query: 611 VSNGTVTV--RKYGEEKT 626
           + +GTVTV  R  GE++T
Sbjct: 61  LEDGTVTVKDRDTGEQET 78


>PF02824 TGS "TGS domain"
          Length = 60

 Score = 60.5 bits (146), Expect = 2e-12
 Identities = 31/60 (51%), Positives = 40/60 (66%)

Query: 4  IKITFPDNSVKEFDAGVTTAEIAKSISISLAKKAVAGKVDGNFVDLNQPLKEDGSIEIIT 63
          I++T PD SVKE   G T  + A SI  SLAK  VA KV+G  VDL+ PL++D  +EI+T
Sbjct: 1  IRVTTPDGSVKELPKGSTPLDFAYSIHKSLAKAFVAAKVNGQLVDLSHPLEDDDVVEIVT 60


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.328    0.139    0.397 

Gapped
Lambda     K      H
   0.267   0.0474    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 16,021,075
Number of extensions: 895147
Number of successful extensions: 123083
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2525
Number of HSP's successfully gapped: 219
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)