RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABE00014.1 lsal0 comFC GIB00337CH01 "ComF operon protein 3"
         (228 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF00156 Pribosyltran "Phosphoribosyl transferase domain"               33   4e-04

>PF00156 Pribosyltran "Phosphoribosyl transferase domain"
          Length = 116

 Score = 33.2 bits (75), Expect = 4e-04
 Identities = 21/60 (35%), Positives = 29/60 (48%)

Query: 168 SEKSRSERLKTQQPFEYIGDKLQGNYVIIDDVYTTGRTLYYAQELLLKNGASRVCSVTLA 227
           S++   ER    +    +GD      +++DDV TTG TL  A E L + GA  V    LA
Sbjct: 57  SDEEERERGNVARLIRLVGDVKGKRVLLVDDVITTGGTLAAAAEALREAGAKVVYVAVLA 116


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.308    0.127    0.341 

Gapped
Lambda     K      H
   0.267   0.0542    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 9,755,693
Number of extensions: 528734
Number of successful extensions: 66891
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1874
Number of HSP's successfully gapped: 305
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.7 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (19.9 bits)