RPS-BLAST 2.2.16 [Mar-25-2007] Database: Pfam-A 11,912 sequences; 2,039,872 total letters Searching..................................................done Query= ABE00459.1 lsal0 ABE00459.1 GIB00337CH01 "Hypothetical protein, phage associated" (256 letters) Score E Sequences producing significant alignments: (bits) Value PF09250 Prim-Pol "Bifunctional DNA primase/polymerase, N-terminal" 80 3e-18 PF08708 PriCT_1 "Primase C terminal 1 (PriCT-1)" 33 4e-04 >PF09250 Prim-Pol "Bifunctional DNA primase/polymerase, N-terminal" Length = 163 Score = 80.1 bits (197), Expect = 3e-18 Identities = 53/155 (34%), Positives = 77/155 (49%), Gaps = 14/155 (9%) Query: 13 RGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLAKSNLIIVDIDNH 72 RG V P+ P GK+P+ + + AT D I+RW+ P NIGL S L+++D+D Sbjct: 7 RGWPVLPLDPGGKRPLSPHGWQDATTDPEQIRRWWTRYPGANIGLATGPSGLVVIDVDTK 66 Query: 73 NNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFID-----GVDL 127 L +L G LP RT SGG H Y+R DG+ R F+ G+D+ Sbjct: 67 AG--ADALAALEAAGGPLPPTLTVRTPSGGRHIYFRVPDGVELPRNLGFLTNGGDPGIDI 124 Query: 128 LSD--FVVTSPSTN----YKILNG-ATLDDIPQTP 155 +D +VV PS + Y+ L G + + D+P P Sbjct: 125 RADGGYVVAPPSIHPGGPYEWLPGPSPVADLPLLP 159 >PF08708 PriCT_1 "Primase C terminal 1 (PriCT-1)" Length = 66 Score = 33.2 bits (75), Expect = 4e-04 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 194 GVDAGNRNNWIASIFGKLLRAGASPKNAYSLLQLINDNYVQPPLPAKELDNVAESILK 251 G+ G RN + + +L G + Y+L N N + PPLP E+ +A+SI K Sbjct: 6 GIVEGGRNCTLFELARRLAYRGVREERVYALALAANSN-LSPPLPESEVRAIAKSIAK 62 Database: Pfam-A Posted date: Oct 30, 2009 9:48 AM Number of letters in database: 2,039,872 Number of sequences in database: 11,912 Lambda K H 0.332 0.150 0.433 Gapped Lambda K H 0.267 0.0554 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 11912 Number of Hits to DB: 6,782,403 Number of extensions: 352146 Number of successful extensions: 47143 Number of sequences better than 1.0e-03: 10 Number of HSP's gapped: 1515 Number of HSP's successfully gapped: 386 Length of database: 100,000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.4 bits)