RPS-BLAST 2.2.16 [Mar-25-2007]

Database: Pfam-A 
           11,912 sequences; 2,039,872 total letters

Searching..................................................done

Query= ABE00459.1 lsal0 ABE00459.1 GIB00337CH01 "Hypothetical protein,
phage associated"
         (256 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

PF09250 Prim-Pol "Bifunctional DNA primase/polymerase, N-terminal"     80   3e-18
PF08708 PriCT_1 "Primase C terminal 1 (PriCT-1)"                       33   4e-04

>PF09250 Prim-Pol "Bifunctional DNA primase/polymerase, N-terminal"
          Length = 163

 Score = 80.1 bits (197), Expect = 3e-18
 Identities = 53/155 (34%), Positives = 77/155 (49%), Gaps = 14/155 (9%)

Query: 13  RGLYVYPIVPNGKQPIKDYSYLKATQDIALIKRWFMDEPNINIGLNLAKSNLIIVDIDNH 72
           RG  V P+ P GK+P+  + +  AT D   I+RW+   P  NIGL    S L+++D+D  
Sbjct: 7   RGWPVLPLDPGGKRPLSPHGWQDATTDPEQIRRWWTRYPGANIGLATGPSGLVVIDVDTK 66

Query: 73  NNDLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIPATRKTKFID-----GVDL 127
                  L +L   G  LP     RT SGG H Y+R  DG+   R   F+      G+D+
Sbjct: 67  AG--ADALAALEAAGGPLPPTLTVRTPSGGRHIYFRVPDGVELPRNLGFLTNGGDPGIDI 124

Query: 128 LSD--FVVTSPSTN----YKILNG-ATLDDIPQTP 155
            +D  +VV  PS +    Y+ L G + + D+P  P
Sbjct: 125 RADGGYVVAPPSIHPGGPYEWLPGPSPVADLPLLP 159


>PF08708 PriCT_1 "Primase C terminal 1 (PriCT-1)"
          Length = 66

 Score = 33.2 bits (75), Expect = 4e-04
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 194 GVDAGNRNNWIASIFGKLLRAGASPKNAYSLLQLINDNYVQPPLPAKELDNVAESILK 251
           G+  G RN  +  +  +L   G   +  Y+L    N N + PPLP  E+  +A+SI K
Sbjct: 6   GIVEGGRNCTLFELARRLAYRGVREERVYALALAANSN-LSPPLPESEVRAIAKSIAK 62


  Database: Pfam-A
    Posted date:  Oct 30, 2009  9:48 AM
  Number of letters in database: 2,039,872
  Number of sequences in database:  11,912
  
Lambda     K      H
   0.332    0.150    0.433 

Gapped
Lambda     K      H
   0.267   0.0554    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 11912
Number of Hits to DB: 6,782,403
Number of extensions: 352146
Number of successful extensions: 47143
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 1515
Number of HSP's successfully gapped: 386
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.4 bits)