RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE00441.1 lsal0 ABE00441.1 GIB00337CH01 "Zinc-transporting
ATPase"
         (643 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1rlmA [c.108.1.10] PHOSPHATASE                                        107   9e-27
1iwoA4 [f.33.1.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:1...   106   3e-26
1v93A [c.1.23.1] 5,10-METHYLENETETRAHYDROFOLATE REDUCTASE              99   3e-24
1rkqA [c.108.1.10] HYPOTHETICAL PROTEIN YIDA                           93   3e-22
1qwgA [c.1.27.1] (2R)-PHOSPHO-3-SULFOLACTATE SYNTHASE                  92   5e-22
1iwoA2 [c.108.1.7] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:...    92   6e-22
1v6tA [c.6.2.5] HYPOTHETICAL UPF0271 PROTEIN PH0986                    92   7e-22
1np7A2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 204                            85   8e-20
2b8eA1 [c.108.1.7] CATION-TRANSPORTING ATPASE A:416 -- 434 A:548...    82   4e-19
1judA [c.108.1.1] L-2-HALOACID DEHALOGENASE                            80   3e-18
1dioG [a.23.2.1] PROTEIN (DIOL DEHYDRATASE)                            77   1e-17
1te2A [c.108.1.6] PUTATIVE PHOSPHATASE                                 75   1e-16
2feaA1 [c.108.1.20] 2-HYDROXY-3-KETO-5-METHYLTHIOPENTENYL-1- A:2...    72   5e-16
1owlA2 [c.28.1.1] DEOXYRIBODIPYRIMIDINE PHOTOLYASE A:3 -- 204          70   2e-15
1nf2A [c.108.1.10] PHOSPHATASE                                         68   1e-14
2b0cA1 [c.108.1.2] PUTATIVE PHOSPHATASE A:8 -- 204                     68   1e-14
1gdhA2 [c.23.12.1] D-GLYCERATE DEHYDROGENASE A:2 -- 100 A:292 --...    67   2e-14
1un8A1 [a.208.1.1] DIHYDROXYACETONE KINASE A:336 -- 550                67   3e-14
2b8eA2 [d.220.1.1] CATION-TRANSPORTING ATPASE A:435 -- 547             66   5e-14
2go7A1 [c.108.1.6] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY ...    65   7e-14
2pjuA1 [c.92.3.1] PROPIONATE CATABOLISM OPERON REGULATORY PROTEI...    64   2e-13
2fi1A1 [c.108.1.3] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY ...    63   4e-13
1s2oA1 [c.108.1.10] SUCROSE-PHOSPHATASE A:1 -- 244                     63   4e-13
1f5sA [c.108.1.4] PHOSPHOSERINE PHOSPHATASE (PSP)                      62   5e-13
1rkuA [c.108.1.11] HOMOSERINE KINASE                                   60   2e-12
1iwoA1 [b.82.7.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:1...    60   3e-12
1j49A2 [c.23.12.1] D-LACTATE DEHYDROGENASE A:1 -- 103 A:301 -- 332     59   4e-12
2a0mA1 [c.42.1.1] ARGINASE SUPERFAMILY PROTEIN A:13 -- 310             59   4e-12
1j8dA [c.108.1.5] DEOXY-D-MANNOSE-OCTULOSONATE 8-PHOSPHATE             59   5e-12
1lplA [b.34.10.1] HYPOTHETICAL 25.4 KDA PROTEIN F53F4.3 IN             59   5e-12
1a9xA2 [c.24.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A...    59   7e-12
1xviA [c.108.1.10] PUTATIVE MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE    58   1e-11
2bduA1 [c.108.1.21] CYTOSOLIC 5'-NUCLEOTIDASE III A:7 -- 297           58   1e-11
1aonO [b.35.1.1] GROEL/GROES COMPLEX                                   58   1e-11
2b30A1 [c.108.1.10] PVIVAX HYPOTHETICAL PROTEIN A:18 -- 300            53   3e-10
1lvhA [c.108.1.6] BETA-PHOSPHOGLUCOMUTASE                              52   8e-10
2gmwA1 [c.108.1.19] D,D-HEPTOSE 1,7-BISPHOSPHATE PHOSPHATASE A:2...    47   2e-08
1ymqA1 [c.108.1.10] SUGAR-PHOSPHATE PHOSPHATASE BT4131 A:2 -- 261      46   4e-08
1g61A [d.126.1.1] TRANSLATION INITIATION FACTOR 6                      45   7e-08
1dgsA2 [b.40.4.6] DNA LIGASE A:315 -- 400                              44   2e-07
1kytA [c.108.1.10] HYPOTHETICAL PROTEIN TA0175                         43   3e-07
1wzcA1 [c.108.1.10] MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE A:1 ...    43   4e-07
1u2zA [c.66.1.31] HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-79     40   2e-06
1xpjA [c.108.1.18] HYPOTHETICAL PROTEIN                                40   2e-06
1wr8A [c.108.1.10] PHOSPHOGLYCOLATE PHOSPHATASE                        40   3e-06
1zq1A1 [b.38.3.1] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT D ...    40   3e-06
1nrwA [c.108.1.10] HYPOTHETICAL PROTEIN, HALOACID DEHALOGENASE-LIKE    40   3e-06
1ynsA1 [c.108.1.22] E-1 ENZYME A:4 -- 256                              39   6e-06
2g80A1 [c.108.1.22] PROTEIN UTR4 A:17 -- 241                           38   1e-05
1svjA [d.220.1.1] POTASSIUM-TRANSPORTING ATPASE B CHAIN                38   1e-05
1l8lA [c.108.1.4] L-3-PHOSPHOSERINE PHOSPHATASE                        35   6e-05
1iwoA3 [d.220.1.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:...    33   3e-04
2fdrA1 [c.108.1.6] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 224           32   6e-04

>1rlmA [c.108.1.10] PHOSPHATASE
          Length = 269

 Score =  107 bits (268), Expect = 9e-27
 Identities = 33/259 (12%), Positives = 73/259 (28%), Gaps = 15/259 (5%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNY-PGNI 373
           K ++ D  GT         Q        + +   +  +  S + +    S          
Sbjct: 3   KVIVTDMDGTFLNDAKTYNQPRFMAQYQELKKRGIKFVVASGNQYYQLISFFPELKDEIS 62

Query: 374 ARVSNVEELVGLG---VRAEYQGDTISVGNMKLMNKLNIDGVSTIEDT------TGTVVY 424
               N   +   G      E       +   +L+    ++ V+    +            
Sbjct: 63  FVAENGALVYEHGKQLFHGELTRHESRIVIGELLKDKQLNFVACGLQSAYVSENAPEAFV 122

Query: 425 VALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVK 484
             +   Y     V D  + D  +    L       + ++     +    + + +      
Sbjct: 123 ALMAKHYHRLKPVKDYQEIDDVLFKFSLNLPDEQ-IPLVIDKLHVALDGIMKPVTSGFGF 181

Query: 485 TELLPQ--DKVTEVERIKSEIGDKGKV-IFVGDGLNDTPVLASADVGVAMGALGSDAAVE 541
            +L+     K   + R+        +  + +GD  ND  +L  A    AMG   ++   +
Sbjct: 182 IDLIIPGLHKANGISRLLKRWDLSPQNVVAIGDSGNDAEMLKMARYSFAMGN-AAENIKQ 240

Query: 542 VADVVLMKDNPTAVTRVIK 560
           +A      +N      VI+
Sbjct: 241 IARYATDDNNHEGALNVIQ 259


>1iwoA4 [f.33.1.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:1 --
           124 A:240 -- 343 A:751 -- 994
          Length = 472

 Score =  106 bits (264), Expect = 3e-26
 Identities = 19/207 (9%), Positives = 57/207 (27%), Gaps = 9/207 (4%)

Query: 433 GAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDK 492
             + V      +  +                T  ++ + +   +   + ++    +    
Sbjct: 102 AIVGVWQERNAENAIEALKEYEPAAT-EQDKTPLQQKLDEFGEQLSKVISLICVAVWLIN 160

Query: 493 VTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGAL-GSDAAVEVADVVLMKDN 551
           +               +            LA A +   + A+  +  A+    +      
Sbjct: 161 IGHFNDPVHGGS---WIRGAIYYFKIAVALAVAAIPEGLPAVITTCLALGTRRMAKKNAI 217

Query: 552 PTAVTRVIKIARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFADVGVTFIAIL- 610
             ++  V  + R     + + I + +   V  ++   L  A         V + ++ ++ 
Sbjct: 218 VRSLPSVETLGRAIYNNMKQFIRYLISSNVGEVVCIFLTAALGLPEALIPVQLLWVNLVT 277

Query: 611 ---NALRLLKMKEENKKINKYPHSKTE 634
               A  L     +   +++ P S  E
Sbjct: 278 DGLPATALGFNPPDLDIMDRPPRSPKE 304


>1v93A [c.1.23.1] 5,10-METHYLENETETRAHYDROFOLATE REDUCTASE
          Length = 292

 Score = 99.5 bits (247), Expect = 3e-24
 Identities = 15/189 (7%), Positives = 39/189 (20%), Gaps = 9/189 (4%)

Query: 376 VSNVEELVGLGVRAEYQGDTISVGNMKLM--NKLNIDGVSTIEDTTGTVVYVALNNEYFG 433
                     G  A ++                    G +            +L      
Sbjct: 17  FEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLA 76

Query: 434 AIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKV 493
            + V+   + +    +      G++N+  L GD     +             EL+   + 
Sbjct: 77  HLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRE 136

Query: 494 TEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPT 553
                               +G  ++  L +           +     +  +     +  
Sbjct: 137 RYG------DRVSVGGAAYPEGHPESESLEADLRHFKAKV-EAGLDFAITQLFFNNAHYF 189

Query: 554 AVTRVIKIA 562
                 + A
Sbjct: 190 GFLERARRA 198


>1rkqA [c.108.1.10] HYPOTHETICAL PROTEIN YIDA
          Length = 271

 Score = 93.1 bits (230), Expect = 3e-22
 Identities = 45/264 (17%), Positives = 90/264 (34%), Gaps = 20/264 (7%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKN------ 368
           K +  D  GTL   +  ++  +  N ++      +  +  +  P+    + +K       
Sbjct: 5   KLIAIDMDGTLLLPDHTISPAVK-NAIAAARARGVNVVLTTGRPYAGVHNYLKELHMEQP 63

Query: 369 ----YPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNID--GVSTIEDTTGTV 422
                  N A V    +   +   A    D   +  +      +      +T+      +
Sbjct: 64  GDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANRDI 123

Query: 423 VYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPN 482
            Y  ++  +   I +            Q LK + ID   +L      + + V EK  +  
Sbjct: 124 SYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTVLK 183

Query: 483 VKTELL-----PQDKVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGALGS 536
                L       +K T V+ +   +G    +++ +GD  ND  ++  A VGVA+     
Sbjct: 184 SAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAVDN-AI 242

Query: 537 DAAVEVADVVLMKDNPTAVTRVIK 560
            +  EVA+ V   +    V   I+
Sbjct: 243 PSVKEVANFVTKSNLEDGVAFAIE 266


>1qwgA [c.1.27.1] (2R)-PHOSPHO-3-SULFOLACTATE SYNTHASE
          Length = 251

 Score = 92.4 bits (228), Expect = 5e-22
 Identities = 25/241 (10%), Positives = 53/241 (21%), Gaps = 29/241 (12%)

Query: 317 VIFDKTGTLTRG-EFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNI-- 373
           V+ DK        ++        +      +      +       +   I       I  
Sbjct: 17  VVLDKGLPPKFVEDYLKVCGDYID-----FVKFGWGTSAVIDRDVVKEKINYYKDWGIKV 71

Query: 374 -ARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNI------DGVSTIEDTTGTVVYVA 426
               +  E     G   E+  +   +G   +            +  + I+        V 
Sbjct: 72  YPGGTLFEYAYSKGKFDEFLNECEKLGFEAVEISDGSSDISLEERNNAIKRAKDNGFMVL 131

Query: 427 LNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTE 486
                    +   +   D    I    + G D   ++ G +   GK + +K         
Sbjct: 132 TEVGKKMPDKDKQLTIDDRIKLINFDLDAGAD-YVIIEGRESGKGKGLFDKEGKVKENEL 190

Query: 487 LLPQDKVTEVERIKSEIGDKGK-------------VIFVGDGLNDTPVLASADVGVAMGA 533
            +    V   + I        +                  D +     L     G   G 
Sbjct: 191 DVLAKNVDINKVIFEAPQKSQQVAFILKFGSSVNLANIAFDEVISLETLRRGLRGDTFGK 250

Query: 534 L 534
           +
Sbjct: 251 V 251


>1iwoA2 [c.108.1.7] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:344
           -- 360 A:600 -- 750
          Length = 168

 Score = 92.0 bits (228), Expect = 6e-22
 Identities = 36/159 (22%), Positives = 61/159 (38%), Gaps = 36/159 (22%)

Query: 433 GAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELL---- 488
                 D  + +   +IQ  ++ GI  V M+TGD K     +  ++ I     E+     
Sbjct: 13  LTTNQLDPPRKEVMGSIQLCRDAGIR-VIMITGDNKGTAIAICRRIGIFGENEEVADRAY 71

Query: 489 ---------------------------PQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPV 521
                                      P  K   VE ++S           GDG+ND P 
Sbjct: 72  TGREFDDLPLAEQREACRRACCFARVEPSHKSKIVEYLQSY---DEITAMTGDGVNDAPA 128

Query: 522 LASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK 560
           L  A++G+AMG+ G+  A   +++VL  DN + +   ++
Sbjct: 129 LKKAEIGIAMGS-GTAVAKTASEMVLADDNFSTIVAAVE 166


>1v6tA [c.6.2.5] HYPOTHETICAL UPF0271 PROTEIN PH0986
          Length = 249

 Score = 91.7 bits (227), Expect = 7e-22
 Identities = 31/256 (12%), Positives = 71/256 (27%), Gaps = 24/256 (9%)

Query: 320 DKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNIARVSNV 379
           D    L    F   ++     V K       A    +    + R  V+           V
Sbjct: 4   DLNSDLGES-FGRYKLGLDEEVMKYITSANVACGWHAGDPLVMRKTVRLAK---ENDVQV 59

Query: 380 EELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTT---GTVVYVALNNEYFGAIE 436
               G      +    + +   +  N +     +           + +V  +   + A+ 
Sbjct: 60  GAHPGYPDLMGFGRRYMKLTPEEARNYILYQVGALYAFAKAEGLELQHVKPHGALYNAMV 119

Query: 437 VSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEV 496
             + +       I       I  VT+       + + +  K+    V  +       T V
Sbjct: 120 KEEDLARAVIEGILDFDKDLIL-VTLSNSRVADIAEEMGLKV-AHEVFADRAYNPDGTLV 177

Query: 497 ERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVT 556
             +  +           + + +  +    D G+     G    ++V  + +  DNP A  
Sbjct: 178 PAVIED----------KEEIAERVISMVKDGGIRAIN-GEWVDLKVDTICVHGDNPKA-- 224

Query: 557 RVIKIARKTKMIVWEN 572
             ++I    + ++ E 
Sbjct: 225 --VEITSYIRKVLEEE 238


>1np7A2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 204
          Length = 204

 Score = 84.9 bits (209), Expect = 8e-20
 Identities = 16/159 (10%), Positives = 43/159 (27%), Gaps = 4/159 (2%)

Query: 421 TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNI 480
                            S+ ++   +   + L+ VG   + + TG  + V   +A+++N 
Sbjct: 43  RQFAQTHQGFAKTGPWRSNFLQQSVQNLAESLQKVGNK-LLVTTGLPEQVIPQIAKQINA 101

Query: 481 PNVKTELLPQDKVTEVER--IKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDA 538
             +        +  +VER  +K       +           P      +      L +  
Sbjct: 102 KTIYYHREVTQEELDVERNLVKQLTILGIEAKGYWGSTLCHPEDLPFSIQDLPD-LFTKF 160

Query: 539 AVEVADVVLMKDNPTAVTRVIKIARKTKMIVWENIIFAL 577
             ++    +           +  +   K+ +        
Sbjct: 161 RKDIEKKKISIRPCFFAPSQLLPSPNIKLELTAPPPEFF 199


>2b8eA1 [c.108.1.7] CATION-TRANSPORTING ATPASE A:416 -- 434 A:548 --
           663
          Length = 127

 Score = 82.4 bits (203), Expect = 4e-19
 Identities = 46/140 (32%), Positives = 68/140 (48%), Gaps = 14/140 (10%)

Query: 421 TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNI 480
            V  V  +          D +K  AK A+Q LK  GI  V  +TGD     + ++ +LN+
Sbjct: 2   KVTAVIFDKTGTLTKGKPDTLKESAKPAVQELKRXGI-KVGXITGDNWRSAEAISRELNL 60

Query: 481 PNVKTELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAV 540
             V  E+LP  K         ++  K  V FVGDG+ND P LA AD+G+A+G+       
Sbjct: 61  DLVIAEVLPHQKS----EEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGS------- 109

Query: 541 EVADVVLMKDNPTAVTRVIK 560
              D+VL++D+   V   I+
Sbjct: 110 --GDIVLIRDDLRDVVAAIQ 127


>1judA [c.108.1.1] L-2-HALOACID DEHALOGENASE
          Length = 220

 Score = 79.7 bits (195), Expect = 3e-18
 Identities = 23/247 (9%), Positives = 53/247 (21%), Gaps = 53/247 (21%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNIA 374
           K + FD  GTL                               S               I+
Sbjct: 3   KGIAFDLYGTLFDVH---------------------------SVVGRCDEAFPGRGREIS 35

Query: 375 RVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGA 434
            +   ++L    +R+            +   +               +   A        
Sbjct: 36  ALWRQKQLEYTWLRSLMNRYVNFQQATEDALRFTCRH--------LGLDLDARTRSTLCD 87

Query: 435 IEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELL------ 488
             +     ++   +++ LK  G   + +L+         V     + +    LL      
Sbjct: 88  AYLRLAPFSEVPDSLRELKRRG-LKLAILSNGSPQSIDAVVSHAGLRDGFDHLLSVDPVQ 146

Query: 489 -----PQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAM---GALGSDAAV 540
                 +      + +     D+  ++FV     D                     +   
Sbjct: 147 VYKPDNRVYELAEQALGL---DRSAILFVSSNAWDATGARYFGFPTCWINRTGNVFEEMG 203

Query: 541 EVADVVL 547
           +  D  +
Sbjct: 204 QTPDWEV 210


>1dioG [a.23.2.1] PROTEIN (DIOL DEHYDRATASE)
          Length = 137

 Score = 77.3 bits (190), Expect = 1e-17
 Identities = 12/118 (10%), Positives = 34/118 (28%), Gaps = 12/118 (10%)

Query: 255 LFLGQEFQVWLYRALIFLVISCPCALVISIP-----LSYFGGIGASSRAGILVKGSNYLE 309
               +  +    + L    +    +  ++               + ++     + +   E
Sbjct: 11  NKHPEWVKTATNKTLDDFTLENVLSNKVTAQDMRITPETLRLQASIAKDAGRDRLAMNFE 70

Query: 310 ALSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVK 367
             ++  AV  D+   +                 K+E++ +A   ES     I  + V+
Sbjct: 71  RAAELTAVPDDRILEIYNALRPYRST-------KEELLAIADDLESRYQAKICAAFVR 121


>1te2A [c.108.1.6] PUTATIVE PHOSPHATASE
          Length = 218

 Score = 74.7 bits (182), Expect = 1e-16
 Identities = 29/259 (11%), Positives = 63/259 (24%), Gaps = 59/259 (22%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVK---NYPG 371
            A IFD  G L   E                                 R+ +    +   
Sbjct: 4   LAAIFDXDGLLIDSE-----------------------------PLWDRAELDVXASLGV 34

Query: 372 NIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEY 431
           +I+R + + + +GL +                               +   V   +    
Sbjct: 35  DISRRNELPDTLGLRIDXVVDLWYARQP---------------WNGPSRQEVVERVIARA 79

Query: 432 FGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQD 491
              +E +  +    + A+   K  G+            + K +       +       + 
Sbjct: 80  ISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHXLEKVLTXFDLRDSFDALASAEK 139

Query: 492 KVTE-------VERIKSEIGDKGKVIFVGDGLNDTPVLASAD---VGVAMGALGSDAAVE 541
                      ++       D    + + D +N      +A    + V      +D    
Sbjct: 140 LPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGXIASKAARXRSIVVPAPEAQNDPRFV 199

Query: 542 VADVVLMKDNPTAVTRVIK 560
           +A+V L   + T +T    
Sbjct: 200 LANVKL--SSLTELTAKDL 216


>2feaA1 [c.108.1.20] 2-HYDROXY-3-KETO-5-METHYLTHIOPENTENYL-1- A:2 --
           227
          Length = 225

 Score = 72.2 bits (176), Expect = 5e-16
 Identities = 16/173 (9%), Positives = 47/173 (27%), Gaps = 30/173 (17%)

Query: 421 TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEK--- 477
            ++  +L  E    +     I+   +  +  +    I    +++G        + E    
Sbjct: 55  GLLPSSLKEEITSFVLEDAKIREGFREFVAFINEHEIP-FYVISGGXDFFVYPLLEGIVE 113

Query: 478 ---------------------LNIPNVKTELLPQDKVTEVERIKSEIGDKGKVIFVGDGL 516
                                 +     +      K + +  +         +I +GD +
Sbjct: 114 KDRIYCNHASFDNDYIHIDWPHSCKGTCSNQCGCCKPSVIHELS---EPNQYIIXIGDSV 170

Query: 517 NDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIKIARKT-KMI 568
            D      +D+  A      +   E     L   +   + + I+  ++  + +
Sbjct: 171 TDVEAAKLSDLCFAR-DYLLNECREQNLNHLPYQDFYEIRKEIENVKEVQEWL 222


>1owlA2 [c.28.1.1] DEOXYRIBODIPYRIMIDINE PHOTOLYASE A:3 -- 204
          Length = 202

 Score = 70.0 bits (170), Expect = 2e-15
 Identities = 19/180 (10%), Positives = 52/180 (28%), Gaps = 15/180 (8%)

Query: 421 TVVYVALNNEYFG----AIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAE 476
            +    L+ +       A      ++   +   Q  +  G   + +L GD + +   +A+
Sbjct: 29  LIGLFCLDPQILQSADMAPARVAYLQGCLQELQQRYQQAGS-RLLLLQGDPQHLIPQLAQ 87

Query: 477 KLNIPNVKTELLPQD--KVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGAL 534
           +L    V      +   +  + +   +      + + + D L  +P    +  G     +
Sbjct: 88  QLQAEAVYWNQDIEPYGRDRDGQVAAALKTAGIRAVQLWDQLLHSPDQILSGSGNPYS-V 146

Query: 535 GSDAAVEVADVVLMKDNPTAVTRVIKIARKTKMIVWENIIFALMVKVIFLLVGALGIATM 594
                         K  P A    +      ++     ++ + +  +       LG    
Sbjct: 147 YGPFWKNWQAQ--PKPTPVATPTELVDLSPEQLTAIAPLLLSELPTLK-----QLGFDWD 199


>1nf2A [c.108.1.10] PHOSPHATASE
          Length = 267

 Score = 68.0 bits (164), Expect = 1e-14
 Identities = 35/259 (13%), Positives = 80/259 (30%), Gaps = 15/259 (5%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNIA 374
           +  +FD  GTL      +++    N         +   A             K +     
Sbjct: 3   RVFVFDLDGTLLNDNLEISEKDRRNIEKLSRKCYV-VFASGRMLVSTLNVEKKYFKRTFP 61

Query: 375 RVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGA 434
            ++    +V L        + I     K + +         +     V+Y   +NE   +
Sbjct: 62  TIAYNGAIVYLPEEGVILNEKIPPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKS 121

Query: 435 IEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELL------ 488
                 +    +  +  L +       +L    + + +             ++       
Sbjct: 122 YARHSNVDYRVEPNLSELVSKMGTTKLLLIDTPERLDELKEILSERFKDVVKVFKSFPTY 181

Query: 489 ------PQDKVTEVERIKSEIGDKGK-VIFVGDGLNDTPVLASADVGVAMGALGSDAAVE 541
                   DK   +  ++  +  K + ++  GD  ND  +   A + VAM     +   E
Sbjct: 182 LEIVPKNVDKGKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVAMEN-AIEKVKE 240

Query: 542 VADVVLMKDNPTAVTRVIK 560
            +D+V + +N + V+ V++
Sbjct: 241 ASDIVTLTNNDSGVSYVLE 259


>2b0cA1 [c.108.1.2] PUTATIVE PHOSPHATASE A:8 -- 204
          Length = 197

 Score = 67.8 bits (164), Expect = 1e-14
 Identities = 13/178 (7%), Positives = 44/178 (24%), Gaps = 16/178 (8%)

Query: 380 EELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGAIEVSD 439
            +L  + + +  +   +     +       D            + ++      G   V  
Sbjct: 24  SDLTRIPLASLKKSFHMGEAFHQHERGEISDEAFAEALCHEMALPLSYEQFSHGWQAVFV 83

Query: 440 MIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELL----------- 488
            ++ +    +  L+  G   V +L+   ++      E+        + +           
Sbjct: 84  ALRPEVIAIMHKLREQGHR-VVVLSNTNRLHTTFWPEEYPEIRDAADHIYLSQDLGMRKP 142

Query: 489 -PQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADV 545
             +     ++            +F  D  ++        +   +    +      A V
Sbjct: 143 EARIYQHVLQAEGF---SPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAKV 197


>1gdhA2 [c.23.12.1] D-GLYCERATE DEHYDROGENASE A:2 -- 100 A:292 --
           321
          Length = 129

 Score = 66.7 bits (162), Expect = 2e-14
 Identities = 12/125 (9%), Positives = 34/125 (27%), Gaps = 4/125 (3%)

Query: 441 IKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEVERIK 500
                + A+   +      +      K  + + +    ++  +   L  + +   ++RI 
Sbjct: 7   TWPLPEAAMARARESYDV-IAHGDDPKITIDEMIETAKSVDALLITLNEKCRKEVIDRIP 65

Query: 501 SEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK 560
             I     +     G +   + A    G+ +G     A     D+    ++         
Sbjct: 66  ENIK---CISTYSIGFDHIDLDACKARGIKVGNAPHGATQAREDMAHQANDLIDALFGGA 122

Query: 561 IARKT 565
                
Sbjct: 123 DMSYA 127


>1un8A1 [a.208.1.1] DIHYDROXYACETONE KINASE A:336 -- 550
          Length = 207

 Score = 66.5 bits (162), Expect = 3e-14
 Identities = 23/151 (15%), Positives = 36/151 (23%), Gaps = 23/151 (15%)

Query: 463 LTGDKKIVGKNVAEKLNI-PNVKTELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPV 521
           +T           E       +   ++     T  +              VGDG      
Sbjct: 1   ITCVVSSHASARVEFQPSANALVAGIVELVTATLSDLETHL---NALDAKVGDG------ 51

Query: 522 LASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIKIARKTKM---------IVWEN 572
               D G    A   + A  +    L  +N   +  +I       M         I +  
Sbjct: 52  ----DTGSTFAAAAREIASLLHRQQLPLNNLATLFALIGERLTVVMGGSSGVLMSIFFTA 107

Query: 573 IIFALMVKVIFLLVGALGIATMWEAVFADVG 603
               L      +     G+A M     AD G
Sbjct: 108 AGQKLEQGANVVEALNTGLAQMKFYGGADEG 138


>2b8eA2 [d.220.1.1] CATION-TRANSPORTING ATPASE A:435 -- 547
          Length = 113

 Score = 65.7 bits (160), Expect = 5e-14
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 15/117 (12%)

Query: 332 VTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIV---KNYPGNIARVSNVEELVGLGVR 388
           VT ++P NG  ++E+++LAAIAE  S HPIA +IV     +   +     VE + G GV 
Sbjct: 2   VTDLVPLNG-DERELLRLAAIAERRSEHPIAEAIVKKALEHGIELGEPEKVEVIAGEGVV 60

Query: 389 AEYQGDTISVGNMKLMNKLNID-------GVSTIEDTTGTVVYVALNNEYFGAIEVS 438
           A+       VGN +L     +         +  +E    T V VA N    G I VS
Sbjct: 61  ADGIL----VGNKRLXEDFGVAVSNEVELALEKLEREAKTAVIVARNGRVEGIIAVS 113


>2go7A1 [c.108.1.6] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:3
           -- 206
          Length = 204

 Score = 65.1 bits (157), Expect = 7e-14
 Identities = 19/242 (7%), Positives = 53/242 (21%), Gaps = 59/242 (24%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNIA 374
            A I+D  GTL                                   I   I + +     
Sbjct: 2   TAFIWDLDGTLLDSY-----------------------------EAILSGIEETFAQFSI 32

Query: 375 RVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGA 434
                +    +         ++    +++    N+D            V   +  +    
Sbjct: 33  PYDKEKVREFIF------KYSVQDLLVRVAEDRNLD----------VEVLNQVRAQSLAE 76

Query: 435 IEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNV----------K 484
                ++   A+  +      GI    + T         + +                  
Sbjct: 77  KNAQVVLXPGAREVLAWADESGIQ-QFIYTHKGNNAFTILKDLGVESYFTEILTSQSGFV 135

Query: 485 TELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVAD 544
            +  P+     +++ +    +     ++GD   D     ++ +        +        
Sbjct: 136 RKPSPEAATYLLDKYQL---NSDNTYYIGDRTLDVEFAQNSGIQSINFLESTYEGNHRIQ 192

Query: 545 VV 546
            +
Sbjct: 193 AL 194


>2pjuA1 [c.92.3.1] PROPIONATE CATABOLISM OPERON REGULATORY PROTEIN
           A:11 -- 196
          Length = 186

 Score = 63.9 bits (154), Expect = 2e-13
 Identities = 17/179 (9%), Positives = 47/179 (26%), Gaps = 6/179 (3%)

Query: 372 NIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTT---GTVVYVALN 428
           ++ R+  +   + L          I +G  K +  +     +   D     G+      +
Sbjct: 8   SVTRLFELFRDISLEFDHLANITPIQLGFEKAVTYIRKKLANERCDAIIAAGSNGAYLKS 67

Query: 429 NEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELL 488
                 I +        +   +  K      V         +           + ++ + 
Sbjct: 68  RLSVPVILIKPSGYDVLQFLAKAGKLTSSIGVVTYQETIPALVAFQKTFNLRLDQRSYIT 127

Query: 489 PQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVL 547
            +D   ++  +K+   +   V+  G   +         + +   A     A   A  + 
Sbjct: 128 EEDARGQINELKANGTEA--VVGAGLITDLAEEAGMTGIFIYSAA-TVRQAFSDALDMT 183


>2fi1A1 [c.108.1.3] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:4
           -- 190
          Length = 187

 Score = 62.8 bits (151), Expect = 4e-13
 Identities = 13/133 (9%), Positives = 35/133 (26%), Gaps = 13/133 (9%)

Query: 421 TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNI 480
              ++    E         ++       ++ + N G     +++     V + + +    
Sbjct: 60  LENFLEKYKENEARELEHPILFEGVSDLLEDISNQGGR-HFLVSHRNDQVLEILEKTSIA 118

Query: 481 PN--------VKTELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMG 532
                        +  P  +     R K         + +GD   D     +A +   + 
Sbjct: 119 AYFTEVVTSSSGFKRKPNPESMLYLREKY---QISSGLVIGDRPIDIEAGQAAGLDTHLF 175

Query: 533 ALGSDAAVEVADV 545
                   +V D+
Sbjct: 176 T-SIVNLRQVLDI 187


>1s2oA1 [c.108.1.10] SUCROSE-PHOSPHATASE A:1 -- 244
          Length = 244

 Score = 62.8 bits (151), Expect = 4e-13
 Identities = 25/244 (10%), Positives = 62/244 (25%), Gaps = 20/244 (8%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNIA 374
             +I D   T    +  +  +    G  +        +A ++     +    +     + 
Sbjct: 4   LLLISDLDNTWVGDQQALEHLQEYLGDRRGNF----YLAYATGRSYHS---ARELQKQVG 56

Query: 375 RVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGA 434
            +     L  +G    +           L      D +  I D    +   +   +    
Sbjct: 57  LMEPDYWLTAVGSEIYHPEGLDQHWADYLSEHWQRDILQAIADGFEALKPQSPLEQNPWK 116

Query: 435 IEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVT 494
           I      +    V  Q  +   +   T +            + L            +K  
Sbjct: 117 ISYHLDPQACPTVIDQLTE---MLKETGIPVQVIFSSGKDVDLLPQR--------SNKGN 165

Query: 495 EVERIKSEIGDKGKV-IFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPT 553
             + ++  +  +    +  GD  ND  +  ++  GV +        +   D      +  
Sbjct: 166 ATQYLQQHLAMEPSQTLVCGDSGNDIGLFETSARGVIVRN-AQPELLHWYDQWGDSRHYR 224

Query: 554 AVTR 557
           A + 
Sbjct: 225 AQSS 228


>1f5sA [c.108.1.4] PHOSPHOSERINE PHOSPHATASE (PSP)
          Length = 210

 Score = 62.4 bits (150), Expect = 5e-13
 Identities = 28/161 (17%), Positives = 47/161 (29%), Gaps = 27/161 (16%)

Query: 421 TVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNI 480
             +   L  E              A+  I+ LKN G   V +++G   I    + EKL +
Sbjct: 56  VSLLKDLPIEKVEKAIKRITPTEGAEETIKELKNRGYV-VAVVSGGFDIAVNKIKEKLGL 114

Query: 481 PNVKTEL---------------------LPQDKVTEVERIKSEIGDKGKVIFVGDGLNDT 519
                                         +      +            + VGDG ND 
Sbjct: 115 DYAFANRLIVKDGKLTGDVEGEVLKENAKGEILEKIAKIEGIN---LEDTVAVGDGANDI 171

Query: 520 PVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK 560
            +   A + +A          E AD+ + K +   + + IK
Sbjct: 172 SMFKKAGLKIAFC--AKPILKEKADICIEKRDLREILKYIK 210


>1rkuA [c.108.1.11] HOMOSERINE KINASE
          Length = 206

 Score = 60.4 bits (145), Expect = 2e-12
 Identities = 21/163 (12%), Positives = 47/163 (28%), Gaps = 15/163 (9%)

Query: 415 IEDTTGTVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNV 474
           ++     +    L       +  +      A   +  L+        +L+       + +
Sbjct: 44  MKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWLRERFQVV--ILSDTFYEFSQPL 101

Query: 475 AEKLNIPNVKTELLPQDKVTE------------VERIKSEIGDKGKVIFVGDGLNDTPVL 522
             +L  P +    L  D                 + + +      +VI  GD  NDT +L
Sbjct: 102 MRQLGFPTLLCHKLEIDDSDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTML 161

Query: 523 ASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIKIARKT 565
           + A  G+   A   +   E      +          +K + ++
Sbjct: 162 SEAHAGILFHA-PENVIREFPQFPAVHTYEDLKREFLKASSRS 203


>1iwoA1 [b.82.7.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:125
           -- 239
          Length = 115

 Score = 59.7 bits (144), Expect = 3e-12
 Identities = 20/106 (18%), Positives = 43/106 (40%), Gaps = 16/106 (15%)

Query: 128 NGKLQQVKPELLNKGDIIIVNPGEKIAVDGV---VESGEAYLNTAALTGETNPLLVT--- 181
              +Q++K   +  GDI+ V  G+K+  D     ++S    ++ + LTGE+  ++     
Sbjct: 10  RKSVQRIKARDIVPGDIVEVAVGDKVPADIRILSIKSTTLRVDQSILTGESVSVIKHTEP 69

Query: 182 ----------KDSQVLSGMIVENSALRIRVSKEYKDSTVVKILELV 217
                     K + + SG  +        V+     + + KI + +
Sbjct: 70  VPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGVSTEIGKIRDQM 115


>1j49A2 [c.23.12.1] D-LACTATE DEHYDROGENASE A:1 -- 103 A:301 -- 332
          Length = 135

 Score = 59.4 bits (143), Expect = 4e-12
 Identities = 17/139 (12%), Positives = 41/139 (29%), Gaps = 12/139 (8%)

Query: 441 IKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEVERIK 500
           I+ D K  ++  ++   D V +   DK +  + VA       V            ++ + 
Sbjct: 9   IREDEKPFLKEWEDAHKD-VEVEYTDKLLTPETVALAKGADGVVVYQQLDYIAETLQALA 67

Query: 501 SEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAVTRVIK 560
                  K+     G+++  +  + ++G  +       +     V  M      V     
Sbjct: 68  DN--GITKMSLRNVGVDNIDMAKAKELGFQITN-VPVYSYTTHAVRNM-----VVKAFDN 119

Query: 561 IARKTKMIVWENIIFALMV 579
                  +  +     + V
Sbjct: 120 NLEL---VEGKEAETPVKV 135


>2a0mA1 [c.42.1.1] ARGINASE SUPERFAMILY PROTEIN A:13 -- 310
          Length = 298

 Score = 59.4 bits (143), Expect = 4e-12
 Identities = 13/198 (6%), Positives = 44/198 (22%), Gaps = 23/198 (11%)

Query: 440 MIKTDAKV---AIQGLKNVGIDNVTMLTGDK--KIVGKNVAEKLNIPNVKTELLPQDKVT 494
           +I           + +      +V ++  D    +       +++      +LL +   +
Sbjct: 105 VIGGGNDQSAPNGRAMLRAFPGDVGVINVDSHLDVRPPLQDGRVHSGTPFRQLLEESSFS 164

Query: 495 EVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAV-------------E 541
               ++                          + ++        A               
Sbjct: 165 GKRFVEFACQ---GSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTGKNTFF 221

Query: 542 VADVVLMKDNPTAVTRVIKIARKTKMIVWENIIFALMVKVIFLLVGALGIATMWEAVFAD 601
             DV  +K +             +    ++    A     + ++  +     + E     
Sbjct: 222 SFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAGKTPTVMMMDMSELNPLVEEYRSPR 281

Query: 602 VGVTFIAILNALRLLKMK 619
           V V      + +     +
Sbjct: 282 VAVYM--FYHFVLGFATR 297


>1j8dA [c.108.1.5] DEOXY-D-MANNOSE-OCTULOSONATE 8-PHOSPHATE
          Length = 180

 Score = 59.0 bits (143), Expect = 5e-12
 Identities = 31/151 (20%), Positives = 53/151 (35%), Gaps = 17/151 (11%)

Query: 400 NMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDN 459
           N+K +   ++DGV      T   ++   N E   +  V D +       I+ L +  I  
Sbjct: 7   NIKFV-ITDVDGV-----LTDGQLHYDANGEAIKSFHVRDGL------GIKXLXDADIQ- 53

Query: 460 VTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEVERIKSEIG-DKGKVIFVGDGLND 518
           V +L+G    + +     L I       L  +K T    +  + G    +  ++GD   D
Sbjct: 54  VAVLSGRDSPILRRRIADLGIKLFFLGKL--EKETACFDLXKQAGVTAEQTAYIGDDSVD 111

Query: 519 TPVLASADVGVAMGALGSDAAVEVADVVLMK 549
            P  A+     A+            D VL  
Sbjct: 112 LPAFAACGTSFAVAD-APIYVKNAVDHVLST 141


>1lplA [b.34.10.1] HYPOTHETICAL 25.4 KDA PROTEIN F53F4.3 IN
          Length = 95

 Score = 58.9 bits (142), Expect = 5e-12
 Identities = 13/92 (14%), Positives = 26/92 (28%), Gaps = 5/92 (5%)

Query: 129 GKLQQVKPELLNKGDIIIVNPGEKIAVDGV-VESGEAYLNTAALTGETNPLLVTKDSQVL 187
            KL +   + +  G+   V  G ++A  G     G          G      V K+   +
Sbjct: 2   DKLNEEAAKNIMVGNRCEVTVGAQMARRGEVAYVGATKFKEGVWVGVKYDEPVGKNDGSV 61

Query: 188 SGMIV----ENSALRIRVSKEYKDSTVVKILE 215
           +G+            +R             ++
Sbjct: 62  AGVRYFDCDPKYGGFVRPVDVKVGDFPELSID 93


>1a9xA2 [c.24.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN)
           A:936 -- 1073
          Length = 138

 Score = 58.5 bits (141), Expect = 7e-12
 Identities = 9/124 (7%), Positives = 26/124 (20%), Gaps = 10/124 (8%)

Query: 425 VALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVK 484
             +       + V +  K         L       +    G   ++      +  I    
Sbjct: 2   STMKKHGRALLSVREGDKERVVDLAAKLLKQ-GFELDATHGTAIVL-----GEAGINPRL 55

Query: 485 TELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVAD 544
              + + +    +RIK    +      +        +  S  +  +           +  
Sbjct: 56  VNKVHEGRPHIQDRIK----NGEYTYIINTTSGRRAIEDSRVIRRSALQYKVHYDTTLNG 111

Query: 545 VVLM 548
               
Sbjct: 112 GFAT 115


>1xviA [c.108.1.10] PUTATIVE MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE
          Length = 232

 Score = 57.7 bits (137), Expect = 1e-11
 Identities = 28/232 (12%), Positives = 63/232 (27%), Gaps = 13/232 (5%)

Query: 311 LSQAKAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYP 370
           + Q   V  D  GTL     +  Q         +E      +  SS        + K   
Sbjct: 1   IQQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPVILC-SSKTSAEMLYLQKTLG 59

Query: 371 GNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNE 430
                +      V        + D        + +      ++T+ +           ++
Sbjct: 60  LQGLPLIAENGAVIQLAEQWQEIDGFPRIISGISHGEISLVLNTLREKEH--FKFTTFDD 117

Query: 431 YFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTEL--- 487
              A        + ++ A+  L    +  +   + ++         +L +  ++      
Sbjct: 118 VDDATIAEWTGLSRSQAALTQLHEASVTLIWRDSDERMAQFTARLNELGLQFMQGARFWH 177

Query: 488 ------LPQDKVTEVERIKSEIGDKG-KVIFVGDGLNDTPVLASADVGVAMG 532
                         +     ++  K    + +GDG ND P+L   D  V + 
Sbjct: 178 VLDASAGKDQAANWIIATYQQLSGKRPTTLGLGDGPNDAPLLEVMDYAVIVK 229


>2bduA1 [c.108.1.21] CYTOSOLIC 5'-NUCLEOTIDASE III A:7 -- 297
          Length = 291

 Score = 57.5 bits (138), Expect = 1e-11
 Identities = 25/161 (15%), Positives = 53/161 (32%), Gaps = 35/161 (21%)

Query: 433 GAIEVSDM-IKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELL--- 488
             +  SD+ +K   +     L+  GI  V + +     V + V  +  + +   +++   
Sbjct: 127 EIVADSDVXLKEGYENFFGKLQQHGIP-VFIFSAGIGDVLEEVIRQAGVYHSNVKVVSNF 185

Query: 489 ---------------------PQDKVTEVERIKSEIGDKGKVIFVGDGLND---TPVLAS 524
                                  D   +     S++ D   +I +GD   D      +A+
Sbjct: 186 XDFDENGVLKGFKGELIHVFNKHDGALKNTDYFSQLKDNSNIILLGDSQGDLRXADGVAN 245

Query: 525 ADVGVAMGALGSDA------AVEVADVVLMKDNPTAVTRVI 559
            +  + +G L            +  D+VL+K+    V   I
Sbjct: 246 VEHILKIGYLNDRVDELLEKYXDSYDIVLVKEESLEVVNSI 286


>1aonO [b.35.1.1] GROEL/GROES COMPLEX
          Length = 97

 Score = 57.5 bits (139), Expect = 1e-11
 Identities = 19/103 (18%), Positives = 39/103 (37%), Gaps = 7/103 (6%)

Query: 116 LDIRPEYANLELNGKLQQVKPELLNKGDIIIVNPGEKIAVDGVVESGEAYLNTAALTGET 175
           ++IRP +  + +    ++ + E  + G I++       +  G V +           GE 
Sbjct: 1   MNIRPLHDRVIV----KRKEVETKSAGGIVLTGSAAAKSTRGEVLAVGN--GRILENGEV 54

Query: 176 NPLLVTKDSQVLSGMIVENSALRIRVSKEYKDSTVVKILELVQ 218
            PL V     V+        + +I   +E    +   IL +V+
Sbjct: 55  KPLDVKVGDIVIFNDGYGVKSEKIDN-EEVLIMSESDILAIVE 96


>2b30A1 [c.108.1.10] PVIVAX HYPOTHETICAL PROTEIN A:18 -- 300
          Length = 283

 Score = 53.2 bits (126), Expect = 3e-10
 Identities = 18/71 (25%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 492 KVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKD 550
           K T +  +         +V+ VGD  ND  +L++     A+    +D+A   A  VL   
Sbjct: 208 KYTGINYLLKHYNISNDQVLVVGDAENDIAMLSNFKYSFAVAN-ATDSAKSHAKCVLPVS 266

Query: 551 NP-TAVTRVIK 560
           +   AV  ++K
Sbjct: 267 HREGAVAYLLK 277


>1lvhA [c.108.1.6] BETA-PHOSPHOGLUCOMUTASE
          Length = 221

 Score = 51.6 bits (122), Expect = 8e-10
 Identities = 29/263 (11%), Positives = 61/263 (23%), Gaps = 57/263 (21%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPG-NI 373
           KAV+F   G +T                           +++  H  A   +    G N 
Sbjct: 3   KAVLFXLDGVIT---------------------------DTAEYHFRAWKALAEEIGING 35

Query: 374 ARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFG 433
                 E+L G+      Q          +++  +     + E+          N     
Sbjct: 36  VDRQFNEQLKGVSREDSLQK---------ILDLADKK--VSAEEFKELAKRKNDNYVKMI 84

Query: 434 AIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIP---------NVK 484
                  +       ++ L++  I  + + +  K          L               
Sbjct: 85  QDVSPADVYPGILQLLKDLRSNKI-KIALASASKNGPFLLERMNLTGYFDAIADPAEVAA 143

Query: 485 TELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDA---AVE 541
           ++  P   +     +        + I + D       +  +           D     V 
Sbjct: 144 SKPAPDIFIAAAHAVGV---APSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVI 200

Query: 542 VADVVLMKDNPTAVTRVIKIARK 564
           V D          +  V    +K
Sbjct: 201 VPDTSH--YTLEFLKEVWLQKQK 221


>2gmwA1 [c.108.1.19] D,D-HEPTOSE 1,7-BISPHOSPHATE PHOSPHATASE A:24
           -- 205
          Length = 182

 Score = 47.4 bits (111), Expect = 2e-08
 Identities = 25/184 (13%), Positives = 50/184 (27%), Gaps = 15/184 (8%)

Query: 386 GVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTT-----GTVVYVALNNEYFGAIEVSDM 440
            +  +  G                     I+        G  + V  N       + ++ 
Sbjct: 4   AIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEA 63

Query: 441 IKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEVERIK 500
                   +         ++  +         +V E         +  P   ++  + + 
Sbjct: 64  QFETLTEWMDWSLADRDVDLDGIYYCPHHPQGSVEE-FRQVCDCRKPHPGMLLSARDYLH 122

Query: 501 SEIGDKGKVIFVGDGLNDTPVLASADVGVAM----GALGSDAAVEVADVVLMKDNPTAVT 556
               D      VGD L D     +A+VG  +    G   +  A   AD VL  ++   + 
Sbjct: 123 I---DMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPEAENAADWVL--NSLADLP 177

Query: 557 RVIK 560
           + IK
Sbjct: 178 QAIK 181


>1ymqA1 [c.108.1.10] SUGAR-PHOSPHATE PHOSPHATASE BT4131 A:2 -- 261
          Length = 260

 Score = 45.9 bits (108), Expect = 4e-08
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 2/71 (2%)

Query: 491 DKVTEVERIKSEIGDKGK-VIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMK 549
            K   ++ I    G K +  +  GDG ND  +L  A +GVAMG    +     AD V   
Sbjct: 186 TKQKGIDEIIRHFGIKLEETMSFGDGGNDISMLRHAAIGVAMGQ-AKEDVKAAADYVTAP 244

Query: 550 DNPTAVTRVIK 560
            +   +++ +K
Sbjct: 245 IDEDGISKAMK 255


>1g61A [d.126.1.1] TRANSLATION INITIATION FACTOR 6
          Length = 225

 Score = 45.3 bits (106), Expect = 7e-08
 Identities = 23/194 (11%), Positives = 52/194 (26%), Gaps = 30/194 (15%)

Query: 377 SNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFGAIE 436
           + V E++         G +  VG++ + NK    G+   +      +    N      ++
Sbjct: 36  NEVSEVLETKCLQTNIGGSSLVGSLSVANKY---GLLLPKIVEDEELDRIKNFLKENNLD 92

Query: 437 VSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKVTEV 496
           ++  I      A+  L         +++ + K   K++ + LN+      +     V   
Sbjct: 93  LNVEIIKSKNTALGNLILTNDKGA-LISPELKDFKKDIEDSLNVEVEIGTIAELPTVGSN 151

Query: 497 ERIKSEIG--------------------DKGKVIFVGDGLNDTPV-----LASADVGVAM 531
             + ++                      +         G              A VG   
Sbjct: 152 AVVTNKGCLTHPLVEDDELEFLKSLFKVEYIGKGTANKGTTSVGACIIANSKGAVVGGDT 211

Query: 532 GALGSDAAVEVADV 545
                   +E A  
Sbjct: 212 TG-PELLIIEDALG 224


>1dgsA2 [b.40.4.6] DNA LIGASE A:315 -- 400
          Length = 86

 Score = 43.6 bits (103), Expect = 2e-07
 Identities = 7/61 (11%), Positives = 17/61 (27%), Gaps = 1/61 (1%)

Query: 112 ITNLLDIRPEYANLELNGKLQQVKPELLNKGDIIIVN-PGEKIAVDGVVESGEAYLNTAA 170
           +   + I     +         ++   +  GD ++V+  G  I     V           
Sbjct: 26  VLEPVFIEGSEVSRVTLHNESYIEELDIRIGDWVLVHKAGGVIPEVLRVLKERRTGKERP 85

Query: 171 L 171
           +
Sbjct: 86  I 86


>1kytA [c.108.1.10] HYPOTHETICAL PROTEIN TA0175
          Length = 225

 Score = 42.9 bits (101), Expect = 3e-07
 Identities = 14/72 (19%), Positives = 27/72 (37%), Gaps = 2/72 (2%)

Query: 490 QDKVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLM 548
           +DK   V ++K     +  +++ +GD  ND P               +D    V+D V  
Sbjct: 150 EDKAFAVNKLKEXYSLEYDEILVIGDSNNDXPXFQLPVRKACPA-NATDNIKAVSDFVSD 208

Query: 549 KDNPTAVTRVIK 560
                 + ++ K
Sbjct: 209 YSYGEEIGQIFK 220


>1wzcA1 [c.108.1.10] MANNOSYL-3-PHOSPHOGLYCERATE PHOSPHATASE A:1 --
           243
          Length = 233

 Score = 42.6 bits (99), Expect = 4e-07
 Identities = 14/58 (24%), Positives = 23/58 (39%), Gaps = 2/58 (3%)

Query: 491 DKVTEVERIKSEIGDKGK--VIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVV 546
           DK    + +       G+     VGD  ND P+    D    +G+L    A  V+ ++
Sbjct: 169 DKGKAAKILLDFYKRLGQIESYAVGDSYNDFPMFEVVDKVFIVGSLKHKKAQNVSSII 226


>1u2zA [c.66.1.31] HISTONE-LYSINE N-METHYLTRANSFERASE, H3 LYSINE-79
          Length = 380

 Score = 40.3 bits (94), Expect = 2e-06
 Identities = 15/68 (22%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 481 PNVKTELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAV 540
             V  ELLP       ++ + + GD    + +G G+ +  V A+ + G A+ + G +   
Sbjct: 176 NYVYGELLPNFLSDVYQQCQLKKGDT--FMDLGSGVGNCVVQAALECGCAL-SFGCEIMD 232

Query: 541 EVADVVLM 548
           + +D+ ++
Sbjct: 233 DASDLTIL 240


>1xpjA [c.108.1.18] HYPOTHETICAL PROTEIN
          Length = 124

 Score = 40.3 bits (93), Expect = 2e-06
 Identities = 8/110 (7%), Positives = 26/110 (23%), Gaps = 17/110 (15%)

Query: 430 EYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLP 489
           +   +   + + + D    ++    +G + + + T       +    K+NI  +      
Sbjct: 14  QANTSDYRNVLPRLDVIEQLREYHQLGFE-IVISTARNMRTYEGNVGKINIHTLPIITEW 72

Query: 490 QDKVTEVER----------------IKSEIGDKGKVIFVGDGLNDTPVLA 523
            DK                          +          + ++      
Sbjct: 73  LDKHQVPYDEILVGKPWCGHDGFYIDDRAVRPSEFASMNLEEIHQLFEKE 122


>1wr8A [c.108.1.10] PHOSPHOGLYCOLATE PHOSPHATASE
          Length = 230

 Score = 40.0 bits (93), Expect = 3e-06
 Identities = 18/70 (25%), Positives = 26/70 (37%), Gaps = 2/70 (2%)

Query: 491 DKVTEVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMK 549
           +K + +E+    +G    +V  VGDG ND          VA+         E AD V  K
Sbjct: 152 NKGSGIEKASEFLGIKPKEVAHVGDGENDLDAFKVVGYKVAVAQ-APKILKENADYVTKK 210

Query: 550 DNPTAVTRVI 559
           +        I
Sbjct: 211 EYGEGGAEAI 220


>1zq1A1 [b.38.3.1] GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT D A:2
           -- 75
          Length = 74

 Score = 39.8 bits (93), Expect = 3e-06
 Identities = 9/63 (14%), Positives = 21/63 (33%), Gaps = 8/63 (12%)

Query: 132 QQVKPELLNKGDIIIVNPGEK---IAVDGVVESG-----EAYLNTAALTGETNPLLVTKD 183
           + +K   +N GD + +   E    +  +G +           L      G    + + K 
Sbjct: 4   EFLKERNINVGDFVRITKEEDGEEVTYEGYIXPPYELSAGDTLVLKLENGYNIGIALEKI 63

Query: 184 SQV 186
            ++
Sbjct: 64  RRI 66


>1nrwA [c.108.1.10] HYPOTHETICAL PROTEIN, HALOACID DEHALOGENASE-LIKE
          Length = 285

 Score = 39.7 bits (92), Expect = 3e-06
 Identities = 22/118 (18%), Positives = 44/118 (37%), Gaps = 4/118 (3%)

Query: 437 VSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQ--DKVT 494
             ++ + D  +    +         +  G K+         ++      EL  +   K  
Sbjct: 157 FQELFEADEPIDFYNILGFSFFKEKLEAGWKRYEHAEDLTLVSSAEHNFELSSRKASKGQ 216

Query: 495 EVERIKSEIG-DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDN 551
            ++R+  ++     +   VGD LND   L +A  GVA G    +    +AD V + ++
Sbjct: 217 ALKRLAKQLNIPLEETAAVGDSLNDKSXLEAAGKGVAXGN-AREDIKSIADAVTLTND 273


>1ynsA1 [c.108.1.22] E-1 ENZYME A:4 -- 256
          Length = 253

 Score = 38.8 bits (89), Expect = 6e-06
 Identities = 28/227 (12%), Positives = 68/227 (29%), Gaps = 18/227 (7%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESSSPHPIARSIVKNYPGNIA 374
             ++ D  GT T   F    + P     ++ + +               S+++      A
Sbjct: 8   TVILLDIEGTTTPIAFVKDILFPY---IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDA 64

Query: 375 RVSNVEELVGL-GVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYVALNNEYFG 433
            +     +    G   +     I      +  ++++D  +T        ++       F 
Sbjct: 65  HLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMW----RAAFT 120

Query: 434 AIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKTELLPQDKV 493
           A  +      D   A++  +  G+  V + +       K +       ++   +      
Sbjct: 121 AGRMKAEFFADVVPAVRKWREAGMK-VYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDT 179

Query: 494 TEVERIKSEIG---------DKGKVIFVGDGLNDTPVLASADVGVAM 531
               +++SE               ++F+ D   +      ADV VA+
Sbjct: 180 KIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAV 226


>2g80A1 [c.108.1.22] PROTEIN UTR4 A:17 -- 241
          Length = 225

 Score = 37.9 bits (86), Expect = 1e-05
 Identities = 22/245 (8%), Positives = 51/245 (20%), Gaps = 41/245 (16%)

Query: 315 KAVIFDKTGTLTRGEFFVTQIIPANGVSKKEIVKLAAIAESS---------SPHPIARSI 365
              + D  GT+    F    + P       ++V+                       ++ 
Sbjct: 4   STYLLDIEGTVCPISFVKETLFPYFTNKVPQLVQQDTRDSPVSNILSQFHIDNKEQLQAH 63

Query: 366 VKNYPGNIARVSNVEELVGLGVRAEYQGDTISVGNMKLMNKLNIDGVSTIEDTTGTVVYV 425
           +        +   +++L G      Y+   I                     ++G+V   
Sbjct: 64  ILELVAKDVKDPILKQLQGYVWAHGYESGQIKAPVYADAIDFIKRKKRVFIYSSGSVKAQ 123

Query: 426 ALNNEYFGAIEVSDMIKTDAKVAIQGLKNVGIDNVTMLTGDKKIVGKNVAEKLNIPNVKT 485
            L   Y               + +    +   D  T     +     N+   +       
Sbjct: 124 KLLFGYVQD----PNAPAHDSLDLNSYIDGYFDINTSGKKTETQSYANILRDIGA----- 174

Query: 486 ELLPQDKVTEVERIKSEIGDKGKVIFVGDGLNDTPVLASAD---VGVAMGALGSDAAVEV 542
                                 +V+F+ D   +    A         +     +      
Sbjct: 175 -------------------KASEVLFLSDNPLELDAAAGVGIATGLASRPG-NAPVPDGQ 214

Query: 543 ADVVL 547
              V 
Sbjct: 215 KYQVY 219


>1svjA [d.220.1.1] POTASSIUM-TRANSPORTING ATPASE B CHAIN
          Length = 136

 Score = 37.8 bits (88), Expect = 1e-05
 Identities = 26/131 (19%), Positives = 46/131 (35%), Gaps = 21/131 (16%)

Query: 333 TQIIPANGVSKKEIVKLAAIAESSSPHPIARSIV---KNYPGNIARVSNVEELVGLGVRA 389
           ++ IPA GV +K +   A +A  +   P  RSIV   K       R         +   A
Sbjct: 5   SEFIPAQGVDEKTLADAAQLASLADETPEGRSIVILAKQRFNLRERDVQSLHATFVPFTA 64

Query: 390 E-------YQGDTISVGNMKLMNKL----------NIDG-VSTIEDTTGTVVYVALNNEY 431
           +            I  G++  + +           ++D  V  +     T + V   +  
Sbjct: 65  QSRMSGINIDNRMIRKGSVDAIRRHVEANGGHFPTDVDQKVDQVARQGATPLVVVEGSRV 124

Query: 432 FGAIEVSDMIK 442
            G I + D++K
Sbjct: 125 LGVIALKDIVK 135


>1l8lA [c.108.1.4] L-3-PHOSPHOSERINE PHOSPHATASE
          Length = 222

 Score = 35.5 bits (80), Expect = 6e-05
 Identities = 10/58 (17%), Positives = 20/58 (34%), Gaps = 3/58 (5%)

Query: 504 GDKGKVIFVGDGLNDTPVLASADVGVAMGA-LGSDAAVEVADVVLMKDNPTAVTRVIK 560
               K+I +GDG  D      AD  +  G  +      + A   +   +   +   ++
Sbjct: 166 FHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYI--TDFVELLGELE 221


>1iwoA3 [d.220.1.1] SARCOPLASMIC/ENDOPLASMIC RETICULUM CALCIUM A:361
           -- 599
          Length = 239

 Score = 33.1 bits (74), Expect = 3e-04
 Identities = 4/29 (13%), Positives = 9/29 (31%)

Query: 311 LSQAKAVIFDKTGTLTRGEFFVTQIIPAN 339
           + +   +        +  EF +T    A 
Sbjct: 3   VCKMFIIDKVDGDFCSLNEFSITGSTYAP 31


>2fdrA1 [c.108.1.6] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 224
          Length = 222

 Score = 32.1 bits (72), Expect = 6e-04
 Identities = 8/51 (15%), Positives = 14/51 (27%), Gaps = 1/51 (1%)

Query: 505 DKGKVIFVGDGLNDTPVLASADVGVAMGALGSDAAVEVADVVLMKDNPTAV 555
              +V+ V D ++      +A   V     G+          L       V
Sbjct: 157 SPDRVVVVEDSVHGIHGARAAGXRVIGF-TGASHTYPSHADRLTDAGAETV 206


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.320    0.140    0.423 

Gapped
Lambda     K      H
   0.267   0.0611    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 13,494,652
Number of extensions: 933690
Number of successful extensions: 3731
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 3613
Number of HSP's successfully gapped: 228
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)