RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 40scop73nmM 
           9549 sequences; 1,678,726 total letters

Searching..................................................done

Query= ABE00459.1 lsal0 ABE00459.1 GIB00337CH01 "Hypothetical protein,
phage associated"
         (256 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1rniA [d.264.1.2] ORF904                                               58   9e-12

>1rniA [d.264.1.2] ORF904
          Length = 210

 Score = 58.4 bits (141), Expect = 9e-12
 Identities = 26/118 (22%), Positives = 47/118 (39%), Gaps = 12/118 (10%)

Query: 3   RLDQVIEMVQRGLYVYPIVPNGKQPI----KDYSYLKATQDIALIKRWF-MDEPNINIGL 57
           R+      ++ G  + PI P  K+P+    + YS+   + +    +R+  M E   N  +
Sbjct: 4   RIRYAKWFLEHGFNIIPIDPESKKPVLKEWQKYSHEMPSDE--EKQRFLKMIEEGYNYAI 61

Query: 58  NLAKSNLIIVDIDNHNN-DLQAPLQSLSNLGYNLPSDYVERTKSGGLHFYYRCSDGIP 114
              +  L+I+D ++           +L  L           T  GG+H Y   S+ IP
Sbjct: 62  PGGQKGLVILDFESKEKLKAWIGESALEEL---CRKTLCTNTVHGGIHIYVL-SNDIP 115


  Database: 40scop73nmM
    Posted date:  Nov 2, 2009 11:39 AM
  Number of letters in database: 1,678,726
  Number of sequences in database:  9549
  
Lambda     K      H
   0.332    0.150    0.433 

Gapped
Lambda     K      H
   0.267   0.0611    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 9549
Number of Hits to DB: 6,729,049
Number of extensions: 455488
Number of successful extensions: 2187
Number of sequences better than 1.0e-03: 6
Number of HSP's gapped: 2182
Number of HSP's successfully gapped: 27
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.4 bits)