BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABA57806.1 noce0 ABA57806.1 GIB00281CH01 "1-Cys peroxiredoxin"
         (212 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1prxB [c.47.1] HORF6                                                  201   1e-54
1prxA [c.47.1] HORF6                                                  200   4e-54
2v2gD [x.x.x] PEROXIREDOXIN 6                                         199   5e-54
2v2gB [x.x.x] PEROXIREDOXIN 6                                         199   5e-54
2v2gA [x.x.x] PEROXIREDOXIN 6                                         199   5e-54
2v41C [x.x.x] PEROXIREDOXIN 6.                                        195   1e-52
1xccB [c.47.1] 1-CYS PEROXIREDOXIN                                    149   7e-39
1xccA [c.47.1] 1-CYS PEROXIREDOXIN                                    149   7e-39
1xccD [c.47.1] 1-CYS PEROXIREDOXIN                                    146   6e-38
2e2gB [x.x.x] PROBABLE PEROXIREDOXIN                                  117   4e-29
2e2gC [x.x.x] PROBABLE PEROXIREDOXIN                                  115   1e-28
2e2gA [x.x.x] PROBABLE PEROXIREDOXIN                                  113   4e-28
1x0rA [x.x.x] PROBABLE PEROXIREDOXIN                                  111   2e-27
1vgsE [c.47.1] PEROXIREDOXIN                                          111   2e-27
1vgsD [c.47.1] PEROXIREDOXIN                                          111   2e-27
1vgsA [c.47.1] PEROXIREDOXIN                                          111   2e-27
2e2mC [x.x.x] PROBABLE PEROXIREDOXIN                                  111   2e-27
2nvlB [x.x.x] PROBABLE PEROXIREDOXIN                                  110   4e-27
2nvlC [x.x.x] PROBABLE PEROXIREDOXIN                                  107   2e-26
2e2mH [x.x.x] PROBABLE PEROXIREDOXIN                                  107   2e-26
2zctD [x.x.x] PROBABLE PEROXIREDOXIN                                  107   3e-26
2zctH [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2zctG [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2zctE [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2zctC [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2zctB [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2zctA [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2e2mE [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2e2mD [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2e2mA [x.x.x] PROBABLE PEROXIREDOXIN                                  105   1e-25
2cv4E [x.x.x] PEROXIREDOXIN                                           103   5e-25
2cv4D [x.x.x] PEROXIREDOXIN                                           103   5e-25
2cv4A [x.x.x] PEROXIREDOXIN                                           103   5e-25
1uulA [c.47.1] TRYPAREDOXIN PEROXIDASE HOMOLOGUE                       89   9e-21
2h01A [x.x.x] 2-CYS PEROXIREDOXIN                                      89   9e-21
2riiB [x.x.x] PEROXIREDOXIN-1                                          88   3e-20
2riiA [x.x.x] PEROXIREDOXIN-1                                          88   3e-20
2fegA [x.x.x] 2-CYS PEROXIREDOXIN                                      87   3e-20
1qmvA [c.47.1] HUMAN THIOREDOXIN PEROXIDASE-B                          86   8e-20
2z9sA [x.x.x] PEROXIREDOXIN-1                                          86   1e-19
1zofB [x.x.x] ALKYL HYDROPEROXIDE-REDUCTASE                            84   5e-19
2i81B [x.x.x] 2-CYS PEROXIREDOXIN                                      83   6e-19
2i81A [x.x.x] 2-CYS PEROXIREDOXIN                                      83   6e-19
2h66I [x.x.x] PV-PF14_0368                                             83   6e-19
3hy2B [x.x.x] PEROXIREDOXIN-1                                          82   1e-18
3hy2A [x.x.x] PEROXIREDOXIN-1                                          82   1e-18
1qq2A [c.47.1] THIOREDOXIN PEROXIDASE 2                                80   7e-18
2bmxB [x.x.x] ALKYL HYDROPEROXIDASE C                                  79   9e-18
2bmxA [x.x.x] ALKYL HYDROPEROXIDASE C                                  79   9e-18
1zofA [x.x.x] ALKYL HYDROPEROXIDE-REDUCTASE                            79   1e-17
2c0dB [x.x.x] THIOREDOXIN PEROXIDASE 2                                 79   2e-17
2h66B [x.x.x] PV-PF14_0368                                             76   8e-17
2pn8H [x.x.x] PEROXIREDOXIN-4                                          75   1e-16
2pn8A [x.x.x] PEROXIREDOXIN-4                                          75   1e-16
2h66F [x.x.x] PV-PF14_0368                                             75   2e-16
2h66D [x.x.x] PV-PF14_0368                                             75   2e-16
2h66C [x.x.x] PV-PF14_0368                                             75   2e-16
2h66A [x.x.x] PV-PF14_0368                                             75   2e-16
2h66J [x.x.x] PV-PF14_0368                                             74   5e-16
2h66E [x.x.x] PV-PF14_0368                                             74   5e-16
2i81D [x.x.x] 2-CYS PEROXIREDOXIN                                      72   2e-15
1n8jA [c.47.1] ALKYL HYDROPEROXIDE REDUCTASE C22 PROTEIN               70   4e-15
1e2yG [c.47.1] TRYPAREDOXIN PEROXIDASE                                 70   4e-15
2c0dA [x.x.x] THIOREDOXIN PEROXIDASE 2                                 69   1e-14
1zyeA [x.x.x] THIOREDOXIN-DEPENDENT PEROXIDE REDUCTASE                 67   5e-14
1yepD [c.47.1 (1kygA)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C         67   5e-14
1yepC [c.47.1 (1kygC)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C         67   5e-14
1yepB [c.47.1 (1kygB)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C         67   5e-14
1yepA [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   5e-14
3empB [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   5e-14
3empA [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   5e-14
1yexD [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   6e-14
1yexC [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   6e-14
1yexB [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   6e-14
1yexA [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  67   6e-14
1yf1C [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1yf1B [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1yf1A [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1yf0D [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1yf0C [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1yf0B [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1yf0A [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C                  66   1e-13
1e2yB [c.47.1] TRYPAREDOXIN PEROXIDASE                                 64   3e-13
1e2yC [c.47.1] TRYPAREDOXIN PEROXIDASE                                 64   4e-13
1e2yH [c.47.1] TRYPAREDOXIN PEROXIDASE                                 62   1e-12
1e2yE [c.47.1] TRYPAREDOXIN PEROXIDASE                                 62   1e-12
1e2yD [c.47.1] TRYPAREDOXIN PEROXIDASE                                 62   1e-12
1e2yA [c.47.1] TRYPAREDOXIN PEROXIDASE                                 62   1e-12
1e2yF [c.47.1] TRYPAREDOXIN PEROXIDASE                                 61   3e-12
1we0A [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE C                          59   1e-11
2cx3B [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN                     55   2e-10
2cx3A [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN                     55   2e-10
3gknA [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN                     48   3e-08
3gkmA [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN                     48   3e-08
3gkkA [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN                     45   3e-07
3c71A [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      42   1e-06
1xxuA [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298                      42   2e-06
1st9A [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA                     41   4e-06
2h1aB [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      40   6e-06
2h1aA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      40   6e-06
3drnB [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY              40   6e-06
3drnA [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY              40   6e-06
1su9B [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA                     40   8e-06
1su9A [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA                     40   8e-06
1st9B [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA                     40   8e-06
2h1bC [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      40   8e-06
2h1bA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      40   8e-06
3c73B [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      39   1e-05
3c73A [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      39   1e-05
2h1gB [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      37   7e-05
2h1gA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      37   7e-05
2h19B [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      36   9e-05
2h19A [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      36   9e-05
2f9sA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      35   2e-04
2f9sB [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA                      34   3e-04
1xvwB [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298                      34   4e-04
1xvwA [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298                      34   4e-04

>1prxB [c.47.1] HORF6
          Length = 217

 Score =  201 bits (512), Expect = 1e-54
 Identities = 109/217 (50%), Positives = 147/217 (67%), Gaps = 12/217 (5%)

Query: 3   LHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           L +GDVAP+F   +T+G + FHD++G+ W +L+SHP D+TPV TTELG  AKLA EF KR
Sbjct: 4   LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPV-TTELGRAAKLAPEFAKR 62

Query: 63  DVKVAALSVDDVDSHKGWISDIN----ETQGCQVNFPIIADADRKVSELYDMIHPGASET 118
           +VK+ ALS+D V+ H  W  DIN    E    ++ FPII D +R+++ L  M+ P A   
Sbjct: 63  NVKLIALSIDSVEDHLAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDP-AEMP 121

Query: 119 VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           VT R V+   P+KK++  I YP +TGR+F EILRV+ SLQLT    VATPVDWKDGD  +
Sbjct: 122 VTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVM 181

Query: 179 IVPSLTDPEVLKEKFPKGY--EEI---KPYLRMTPQP 210
           ++P++ + E  K+ FPKG   +E+   K YLR TPQP
Sbjct: 182 VLPTIPEEEA-KKLFPKGVFTKELPSGKKYLRYTPQP 217


>1prxA [c.47.1] HORF6
          Length = 219

 Score =  200 bits (508), Expect = 4e-54
 Identities = 108/221 (48%), Positives = 147/221 (66%), Gaps = 15/221 (6%)

Query: 3   LHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           L +GDVAP+F   +T+G + FHD++G+ W +L+SHP D+TPV TTELG  AKLA EF KR
Sbjct: 1   LLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPV-TTELGRAAKLAPEFAKR 59

Query: 63  DVKVAALSVDDVDSHKGWISDIN----ETQGCQVNFPIIADADRKVSELYDMIHPGASET 118
           +VK+ ALS+D V+ H  W  DIN    E    ++ FPII D +R+++ L  M+ P   + 
Sbjct: 60  NVKLIALSIDSVEDHLAWSKDINAYNSEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDE 119

Query: 119 ----VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDG 174
               VT R V+   P+KK++  I YP +TGR+F EILRV+ SLQLT    VATPVDWKDG
Sbjct: 120 KGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDG 179

Query: 175 DDCVIVPSLTDPEVLKEKFPKGY--EEI---KPYLRMTPQP 210
           D  +++P++ + E  K+ FPKG   +E+   K YLR TPQP
Sbjct: 180 DSVMVLPTIPEEEA-KKLFPKGVFTKELPSGKKYLRYTPQP 219


>2v2gD [x.x.x] PEROXIREDOXIN 6
          Length = 219

 Score =  199 bits (507), Expect = 5e-54
 Identities = 105/216 (48%), Positives = 137/216 (63%), Gaps = 11/216 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           +G+V P+F  +STIG L FHDW+GN W VL+SHP D+TPV TTELG   +L  +FKKR V
Sbjct: 4   LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGV 63

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQ--VNFPIIADADRKVSELYDMIHP----GASET 118
           K+ ALS D+V  HK W  D+    G +  + +PIIAD  R+++    M+ P         
Sbjct: 64  KLIALSCDNVADHKEWSEDVKCLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMP 123

Query: 119 VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           +T R+V+ I P+KK++  I YP +TGR+F EILRVIDSLQLT    VATP DW+ GD C+
Sbjct: 124 LTCRAVFIIGPDKKLKLSILYPATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCM 183

Query: 179 IVPSLTDPEVLKEKFP----KGYEEIKPYLRMTPQP 210
           +VP ++  E  K  FP    K     K YLR TPQP
Sbjct: 184 VVPGVSAEEA-KTLFPNMEVKAVPSGKGYLRYTPQP 218


>2v2gB [x.x.x] PEROXIREDOXIN 6
          Length = 218

 Score =  199 bits (507), Expect = 5e-54
 Identities = 105/216 (48%), Positives = 137/216 (63%), Gaps = 11/216 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           +G+V P+F  +STIG L FHDW+GN W VL+SHP D+TPV TTELG   +L  +FKKR V
Sbjct: 4   LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGV 63

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQ--VNFPIIADADRKVSELYDMIHP----GASET 118
           K+ ALS D+V  HK W  D+    G +  + +PIIAD  R+++    M+ P         
Sbjct: 64  KLIALSCDNVADHKEWSEDVKCLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMP 123

Query: 119 VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           +T R+V+ I P+KK++  I YP +TGR+F EILRVIDSLQLT    VATP DW+ GD C+
Sbjct: 124 LTCRAVFIIGPDKKLKLSILYPATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCM 183

Query: 179 IVPSLTDPEVLKEKFP----KGYEEIKPYLRMTPQP 210
           +VP ++  E  K  FP    K     K YLR TPQP
Sbjct: 184 VVPGVSAEEA-KTLFPNMEVKAVPSGKGYLRYTPQP 218


>2v2gA [x.x.x] PEROXIREDOXIN 6
          Length = 220

 Score =  199 bits (507), Expect = 5e-54
 Identities = 105/216 (48%), Positives = 137/216 (63%), Gaps = 11/216 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           +G+V P+F  +STIG L FHDW+GN W VL+SHP D+TPV TTELG   +L  +FKKR V
Sbjct: 4   LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGV 63

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQ--VNFPIIADADRKVSELYDMIHP----GASET 118
           K+ ALS D+V  HK W  D+    G +  + +PIIAD  R+++    M+ P         
Sbjct: 64  KLIALSCDNVADHKEWSEDVKCLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMP 123

Query: 119 VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           +T R+V+ I P+KK++  I YP +TGR+F EILRVIDSLQLT    VATP DW+ GD C+
Sbjct: 124 LTCRAVFIIGPDKKLKLSILYPATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCM 183

Query: 179 IVPSLTDPEVLKEKFP----KGYEEIKPYLRMTPQP 210
           +VP ++  E  K  FP    K     K YLR TPQP
Sbjct: 184 VVPGVSAEEA-KTLFPNMEVKAVPSGKGYLRYTPQP 218


>2v41C [x.x.x] PEROXIREDOXIN 6.
          Length = 216

 Score =  195 bits (495), Expect = 1e-52
 Identities = 103/214 (48%), Positives = 135/214 (63%), Gaps = 11/214 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           +G+V P+F  +STIG L FHDW+GN W VL+SHP D+TPV TTELG   +L  +FKKR V
Sbjct: 4   LGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGV 63

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQ--VNFPIIADADRKVSELYDMIHP----GASET 118
           K+ ALS D+V  HK W  D+    G +  + +PIIAD  R+++    M+ P         
Sbjct: 64  KLIALSCDNVADHKEWSEDVKCLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMP 123

Query: 119 VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           +T R+V+ I P+KK++  I YP +TGR+F EILRVIDSLQLT    VATP DW+ GD C+
Sbjct: 124 LTCRAVFIIGPDKKLKLSILYPATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCM 183

Query: 179 IVPSLTDPEVLKEKFP----KGYEEIKPYLRMTP 208
           +VP ++  E  K  FP    K     K YLR TP
Sbjct: 184 VVPGVSAEEA-KTLFPNMEVKAVPSGKGYLRYTP 216


>1xccB [c.47.1] 1-CYS PEROXIREDOXIN
          Length = 218

 Score =  149 bits (376), Expect = 7e-39
 Identities = 76/194 (39%), Positives = 114/194 (58%), Gaps = 7/194 (3%)

Query: 4   HIGDVAPDFTQEST--IGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           H+G   P+FT +++   G    + +I N WA+L+SHP D+TPVCTTEL    K+ ++F K
Sbjct: 2   HLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLK 61

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGCQV-NFPIIADADRKVSELYDMIHPGASET-- 118
            + K+   S +  +SH  WI DI           PI+ D  R+++    ++     +   
Sbjct: 62  LNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITG 121

Query: 119 --VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDD 176
             +T R ++FI P KKI+A + YP +TGR+  EILRV+ SLQLT    VATPV+W +GD 
Sbjct: 122 LPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDK 181

Query: 177 CVIVPSLTDPEVLK 190
           C ++P+L D E+ K
Sbjct: 182 CCVIPTLQDDEISK 195


>1xccA [c.47.1] 1-CYS PEROXIREDOXIN
          Length = 219

 Score =  149 bits (376), Expect = 7e-39
 Identities = 76/194 (39%), Positives = 114/194 (58%), Gaps = 7/194 (3%)

Query: 4   HIGDVAPDFTQEST--IGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           H+G   P+FT +++   G    + +I N WA+L+SHP D+TPVCTTEL    K+ ++F K
Sbjct: 3   HLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLK 62

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGCQV-NFPIIADADRKVSELYDMIHPGASET-- 118
            + K+   S +  +SH  WI DI           PI+ D  R+++    ++     +   
Sbjct: 63  LNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITG 122

Query: 119 --VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDD 176
             +T R ++FI P KKI+A + YP +TGR+  EILRV+ SLQLT    VATPV+W +GD 
Sbjct: 123 LPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDK 182

Query: 177 CVIVPSLTDPEVLK 190
           C ++P+L D E+ K
Sbjct: 183 CCVIPTLQDDEISK 196


>1xccD [c.47.1] 1-CYS PEROXIREDOXIN
          Length = 216

 Score =  146 bits (368), Expect = 6e-38
 Identities = 75/193 (38%), Positives = 113/193 (58%), Gaps = 7/193 (3%)

Query: 5   IGDVAPDFTQEST--IGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           +G   P+FT +++   G    + +I N WA+L+SHP D+TPVCTTEL    K+ ++F K 
Sbjct: 1   LGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVCTTELAELGKMHEDFLKL 60

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQV-NFPIIADADRKVSELYDMIHPGASET--- 118
           + K+   S +  +SH  WI DI           PI+ D  R+++    ++     +    
Sbjct: 61  NCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITGL 120

Query: 119 -VTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDC 177
            +T R ++FI P KKI+A + YP +TGR+  EILRV+ SLQLT    VATPV+W +GD C
Sbjct: 121 PLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKC 180

Query: 178 VIVPSLTDPEVLK 190
            ++P+L D E+ K
Sbjct: 181 CVIPTLQDDEISK 193


>2e2gB [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 239

 Score =  117 bits (292), Expect = 4e-29
 Identities = 70/197 (35%), Positives = 106/197 (53%), Gaps = 9/197 (4%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPVCTTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRL 64

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++H     T TVR
Sbjct: 65  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH----ATHTVR 120

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 121 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 180

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 181 VPPPTTEDQARARMESG 197


>2e2gC [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 239

 Score =  115 bits (288), Expect = 1e-28
 Identities = 70/197 (35%), Positives = 106/197 (53%), Gaps = 9/197 (4%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPVCTTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRL 64

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++    S T TVR
Sbjct: 65  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL----SATHTVR 120

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 121 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 180

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 181 VPPPTTEDQARARMESG 197


>2e2gA [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 238

 Score =  113 bits (283), Expect = 4e-28
 Identities = 70/197 (35%), Positives = 104/197 (52%), Gaps = 10/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPVCTTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVCTTEFVSFARRYEDFQRL 64

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+        G   T TVR
Sbjct: 65  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVAR-----RLGLLATHTVR 119

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 120 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 179

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 180 VPPPTTEDQARARMESG 196


>1x0rA [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 240

 Score =  111 bits (278), Expect = 2e-27
 Identities = 63/161 (39%), Positives = 91/161 (56%), Gaps = 7/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPVCTTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 93

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 94  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 150

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 151 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 191


>1vgsE [c.47.1] PEROXIREDOXIN
          Length = 236

 Score =  111 bits (278), Expect = 2e-27
 Identities = 63/161 (39%), Positives = 91/161 (56%), Gaps = 7/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPVCTTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 93

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 94  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 150

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 151 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 191


>1vgsD [c.47.1] PEROXIREDOXIN
          Length = 238

 Score =  111 bits (278), Expect = 2e-27
 Identities = 63/161 (39%), Positives = 91/161 (56%), Gaps = 7/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPVCTTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 93

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 94  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 150

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 151 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 191


>1vgsA [c.47.1] PEROXIREDOXIN
          Length = 237

 Score =  111 bits (278), Expect = 2e-27
 Identities = 63/161 (39%), Positives = 91/161 (56%), Gaps = 7/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPVCTTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPVCTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 93

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 94  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 150

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 151 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 191


>2e2mC [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 241

 Score =  111 bits (277), Expect = 2e-27
 Identities = 70/197 (35%), Positives = 106/197 (53%), Gaps = 7/197 (3%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++H   S T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH-AESATHTVR 122

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 123 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 182

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 183 VPPPTTEDQARARMESG 199


>2nvlB [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 239

 Score =  110 bits (275), Expect = 4e-27
 Identities = 69/197 (35%), Positives = 107/197 (54%), Gaps = 9/197 (4%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++H   +E+ TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLH---AESHTVR 120

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 121 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 180

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 181 VPPPTTEDQARARMESG 197


>2nvlC [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 239

 Score =  107 bits (268), Expect = 2e-26
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 9/197 (4%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++    S T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLE---SATHTVR 120

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 121 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 180

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 181 VPPPTTEDQARARMESG 197


>2e2mH [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 240

 Score =  107 bits (268), Expect = 2e-26
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 8/197 (4%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++    S T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL--AESATHTVR 121

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 122 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 181

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 182 VPPPTTEDQARARMESG 198


>2zctD [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 237

 Score =  107 bits (267), Expect = 3e-26
 Identities = 69/197 (35%), Positives = 105/197 (53%), Gaps = 10/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++    S T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL----SATHTVR 119

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 120 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 179

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 180 VPPPTTEDQARARMESG 196


>2zctH [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 234

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 4   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 62

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 63  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 117

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 118 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 177

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 178 VPPPTTEDQARARMESG 194


>2zctG [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 236

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 118

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 119 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 178

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 179 VPPPTTEDQARARMESG 195


>2zctE [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 235

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 4   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 62

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 63  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 117

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 118 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 177

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 178 VPPPTTEDQARARMESG 194


>2zctC [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 236

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 4   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 62

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 63  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 117

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 118 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 177

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 178 VPPPTTEDQARARMESG 194


>2zctB [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 233

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 3   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 61

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 62  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 116

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 117 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 176

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 177 VPPPTTEDQARARMESG 193


>2zctA [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 235

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 3   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 61

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 62  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 116

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 117 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 176

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 177 VPPPTTEDQARARMESG 193


>2e2mE [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 237

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 118

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 119 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 178

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 179 VPPPTTEDQARARMESG 195


>2e2mD [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 232

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 3   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 61

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 62  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 116

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 117 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 176

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 177 VPPPTTEDQARARMESG 193


>2e2mA [x.x.x] PROBABLE PEROXIREDOXIN
          Length = 235

 Score =  105 bits (262), Expect = 1e-25
 Identities = 68/197 (34%), Positives = 104/197 (52%), Gaps = 11/197 (5%)

Query: 5   IGDVAPDFTQESTIGPLHFHD-WIGNG-WAVLYSHPADYTPVCTTELGTTAKLADEFKKR 62
           IG+  P+    +  G +   D ++  G W VL+SHPAD+TPV TTE  + A+  ++F++ 
Sbjct: 5   IGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPV-TTEFVSFARRYEDFQRL 63

Query: 63  DVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            V +  LSVD V SH  W   I    G ++ FPIIAD    V+    ++      T TVR
Sbjct: 64  GVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLL-----ATHTVR 118

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGD---DCVI 179
            V+ +D    IR ++ YP   GR   EILR++ +L+L D+   A P DW + +   + +I
Sbjct: 119 GVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLI 178

Query: 180 VPSLTDPEVLKEKFPKG 196
           VP  T  +  + +   G
Sbjct: 179 VPPPTTEDQARARMESG 195


>2cv4E [x.x.x] PEROXIREDOXIN
          Length = 235

 Score =  103 bits (257), Expect = 5e-25
 Identities = 62/161 (38%), Positives = 90/161 (55%), Gaps = 8/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPV TTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 92

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 93  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 149

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 150 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 190


>2cv4D [x.x.x] PEROXIREDOXIN
          Length = 237

 Score =  103 bits (257), Expect = 5e-25
 Identities = 62/161 (38%), Positives = 90/161 (55%), Gaps = 8/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPV TTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 92

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 93  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 149

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 150 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 190


>2cv4A [x.x.x] PEROXIREDOXIN
          Length = 236

 Score =  103 bits (257), Expect = 5e-25
 Identities = 62/161 (38%), Positives = 90/161 (55%), Gaps = 8/161 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W VL+SHPAD+TPV TTE  + A+  ++F++  V +  LSVD V SH  W   I    G 
Sbjct: 34  WFVLFSHPADFTPV-TTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGV 92

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ FPIIAD    V+    ++H   S T TVR V+ +D    IR +  Y P  GR   EI
Sbjct: 93  RIPFPIIADPQGTVARRLGLLH-AESATHTVRGVFIVDARGVIRTL--YYPELGRLVDEI 149

Query: 151 LRVIDSLQLTDNYSVATPVDWKD----GDDCVIVPSLTDPE 187
           LR++ +L+L D+   A P DW +    G+  ++ P  T+ +
Sbjct: 150 LRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQ 190


>1uulA [c.47.1] TRYPAREDOXIN PEROXIDASE HOMOLOGUE
          Length = 194

 Score = 89.4 bits (220), Expect = 9e-21
 Identities = 58/191 (30%), Positives = 90/191 (47%), Gaps = 13/191 (6%)

Query: 9   APDFTQES-----TIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRD 63
           APDF + +     T   +    + G  W VL+ +P D+T VC TE+   +    EF    
Sbjct: 9   APDFNETALMPNGTFKKVALTSYKGK-WLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIG 67

Query: 64  VKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETVTVR 122
            +V A S+D   SH  W S   +  G  Q+N PI+AD  + + + Y ++     + V  R
Sbjct: 68  CEVLACSMDSEYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKE--EDGVAYR 125

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPS 182
            ++ IDP + +R +       GRD  E LR++ + Q  + +    P +WK GD  +    
Sbjct: 126 GLFIIDPKQNLRQITVNDLPVGRDVDEALRLVKAFQFVEKHGEVCPANWKPGDKTM---- 181

Query: 183 LTDPEVLKEKF 193
             DPE  KE F
Sbjct: 182 KPDPEKSKEYF 192


>2h01A [x.x.x] 2-CYS PEROXIREDOXIN
          Length = 174

 Score = 89.4 bits (220), Expect = 9e-21
 Identities = 52/172 (30%), Positives = 88/172 (51%), Gaps = 9/172 (5%)

Query: 9   APDFTQES-----TIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRD 63
           AP F  E+     T G +   D+IG  + +LY +P D+T VC +E+    K  D FK+R+
Sbjct: 6   APSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERN 65

Query: 64  VKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETVTVR 122
           V++   SVD   +H  W        G   +   +I+D  + ++  YD++    +E+V +R
Sbjct: 66  VELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLF---NESVALR 122

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDG 174
           +   ID    ++ ++    + GR   EILR+ID+LQ  + Y    P +W+ G
Sbjct: 123 AFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQKG 174


>2riiB [x.x.x] PEROXIREDOXIN-1
          Length = 185

 Score = 87.8 bits (216), Expect = 3e-20
 Identities = 51/179 (28%), Positives = 87/179 (48%), Gaps = 7/179 (3%)

Query: 5   IGDVAPDFTQESTIGPLHFHDW----IGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  AP+F   + +    F D         + V + +P D+T VC TE+   +  A+EFK
Sbjct: 6   IGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFK 65

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K + +V   SVD    H  W++   +  G   +N P+++D  R +++ Y ++   A E +
Sbjct: 66  KLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK--ADEGI 123

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           + R ++ ID    +R +       GR   E LR++ + Q TD +   +P  WK G D +
Sbjct: 124 SFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI 182


>2riiA [x.x.x] PEROXIREDOXIN-1
          Length = 184

 Score = 87.8 bits (216), Expect = 3e-20
 Identities = 51/179 (28%), Positives = 87/179 (48%), Gaps = 7/179 (3%)

Query: 5   IGDVAPDFTQESTIGPLHFHDW----IGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  AP+F   + +    F D         + V + +P D+T VC TE+   +  A+EFK
Sbjct: 6   IGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFK 65

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K + +V   SVD    H  W++   +  G   +N P+++D  R +++ Y ++   A E +
Sbjct: 66  KLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK--ADEGI 123

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           + R ++ ID    +R +       GR   E LR++ + Q TD +   +P  WK G D +
Sbjct: 124 SFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI 182


>2fegA [x.x.x] 2-CYS PEROXIREDOXIN
          Length = 169

 Score = 87.4 bits (215), Expect = 3e-20
 Identities = 51/170 (30%), Positives = 87/170 (51%), Gaps = 9/170 (5%)

Query: 9   APDFTQES-----TIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRD 63
           AP F  E+     T G +   D+IG  + +LY +P D+T VC +E+    K  D FK+R+
Sbjct: 3   APSFKAEAVFGDNTFGEVSLSDFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDSFKERN 62

Query: 64  VKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETVTVR 122
           V++   SVD   +H  W        G   +   +I+D  + ++  YD++    +E+V +R
Sbjct: 63  VELLGCSVDSKFTHLAWKKTPLSQGGIGNIKHTLISDISKSIARSYDVLF---NESVALR 119

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWK 172
           +   ID    ++ ++    + GR   EILR+ID+LQ  + Y    P +W+
Sbjct: 120 AFVLIDKQGVVQHLLVNNLALGRSVDEILRLIDALQHHEKYGDVCPANWQ 169


>1qmvA [c.47.1] HUMAN THIOREDOXIN PEROXIDASE-B
          Length = 195

 Score = 86.3 bits (212), Expect = 8e-20
 Identities = 60/196 (30%), Positives = 96/196 (48%), Gaps = 13/196 (6%)

Query: 5   IGDVAPDFTQESTIG----PLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  APDF   + +      +   D+ G  + VL+ +P D+T V  TE+   +  A++F+
Sbjct: 6   IGKPAPDFKATAVVDGAFKEVKLSDYKGK-YVVLFFYPLDFTFV-PTEIIAFSNRAEDFR 63

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K   +V  +SVD   +H  WI+   +  G   +N P++AD  R++SE Y ++     E +
Sbjct: 64  KLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLK--TDEGI 121

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVI 179
             R ++ ID    +R +       GR   E LR++ + Q TD +    P  WK G D  I
Sbjct: 122 AYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSD-TI 180

Query: 180 VPSLTDPEVLKEKFPK 195
            P++ D    KE F K
Sbjct: 181 KPNVDDS---KEYFSK 193


>2z9sA [x.x.x] PEROXIREDOXIN-1
          Length = 197

 Score = 85.5 bits (210), Expect = 1e-19
 Identities = 56/193 (29%), Positives = 90/193 (46%), Gaps = 13/193 (6%)

Query: 5   IGDVAPDFTQESTIGPLHFHDW----IGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  AP F   + +    F D         + V + +P D+T V  TE+   +  A+EFK
Sbjct: 6   IGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVSPTEIIAFSDRAEEFK 65

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K + +V   SVD    H  WI+   +  G   +N P+++D  R +++ Y ++   A E +
Sbjct: 66  KLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK--ADEGI 123

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVI 179
           + R ++ ID    +R +       GR   EILR++ + Q TD +    P  WK G D + 
Sbjct: 124 SFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTI- 182

Query: 180 VPSLTDPEVLKEK 192
                 P+V K K
Sbjct: 183 -----KPDVNKSK 190


>1zofB [x.x.x] ALKYL HYDROPEROXIDE-REDUCTASE
          Length = 175

 Score = 83.6 bits (205), Expect = 5e-19
 Identities = 50/172 (29%), Positives = 84/172 (48%), Gaps = 10/172 (5%)

Query: 8   VAPDFTQESTIG----PLHFH--DWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           +APDF   + +G      HF     +G    +L+  P D+T VC TE+    K   +F +
Sbjct: 6   LAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHE 65

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETVT 120
           +   V  +S+D    H  W +   E  G  QV+FP++AD  + +S  YD++     E + 
Sbjct: 66  KGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLF---EEAIA 122

Query: 121 VRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWK 172
           +R  + ID N K+R  +      GR+  E+LR++D+L   + +    P  W+
Sbjct: 123 LRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWR 174


>2i81B [x.x.x] 2-CYS PEROXIREDOXIN
          Length = 193

 Score = 83.2 bits (204), Expect = 6e-19
 Identities = 49/177 (27%), Positives = 91/177 (51%), Gaps = 9/177 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 2   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 61

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 62  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 118

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDG 174
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y    P +W+ G
Sbjct: 119 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKYGDVCPANWQKG 175


>2i81A [x.x.x] 2-CYS PEROXIREDOXIN
          Length = 193

 Score = 83.2 bits (204), Expect = 6e-19
 Identities = 49/177 (27%), Positives = 91/177 (51%), Gaps = 9/177 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 3   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 62

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 63  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 119

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDG 174
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y    P +W+ G
Sbjct: 120 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKYGDVCPANWQKG 176


>2h66I [x.x.x] PV-PF14_0368
          Length = 177

 Score = 83.2 bits (204), Expect = 6e-19
 Identities = 49/177 (27%), Positives = 91/177 (51%), Gaps = 9/177 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 4   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 63

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 64  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 120

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDG 174
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y    P +W+ G
Sbjct: 121 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKYGDVCPANWQKG 177


>3hy2B [x.x.x] PEROXIREDOXIN-1
          Length = 184

 Score = 82.4 bits (202), Expect = 1e-18
 Identities = 50/179 (27%), Positives = 86/179 (48%), Gaps = 7/179 (3%)

Query: 5   IGDVAPDFTQESTIGPLHFHDW----IGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  AP+F   + +    F D         + V + +P D+T V  TE+   +  A+EFK
Sbjct: 6   IGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVDPTEIIAFSDRAEEFK 65

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K + +V   SVD    H  W++   +  G   +N P+++D  R +++ Y ++   A E +
Sbjct: 66  KLNSQVIGASVDSHFEHLEWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK--ADEGI 123

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           + R ++ ID    +R +       GR   E LR++ + Q TD +   +P  WK G D +
Sbjct: 124 SFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI 182


>3hy2A [x.x.x] PEROXIREDOXIN-1
          Length = 185

 Score = 82.4 bits (202), Expect = 1e-18
 Identities = 50/179 (27%), Positives = 86/179 (48%), Gaps = 7/179 (3%)

Query: 5   IGDVAPDFTQESTIGPLHFHDW----IGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  AP+F   + +    F D         + V + +P D+T V  TE+   +  A+EFK
Sbjct: 6   IGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVDPTEIIAFSDRAEEFK 65

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K + +V   SVD    H  W++   +  G   +N P+++D  R +++ Y ++   A E +
Sbjct: 66  KLNSQVIGASVDSHFEHLEWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK--ADEGI 123

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCV 178
           + R ++ ID    +R +       GR   E LR++ + Q TD +   +P  WK G D +
Sbjct: 124 SFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTI 182


>1qq2A [c.47.1] THIOREDOXIN PEROXIDASE 2
          Length = 173

 Score = 79.7 bits (195), Expect = 7e-18
 Identities = 50/169 (29%), Positives = 82/169 (48%), Gaps = 7/169 (4%)

Query: 5   IGDVAPDFTQESTIGPLHFHDW----IGNGWAVLYSHPADYTPVCTTELGTTAKLADEFK 60
           IG  AP F   + +    F D         + V + +P D+T VC TE+   +  A+EFK
Sbjct: 6   IGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFK 65

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETV 119
           K + +V   SVD   SH  WI+   +  G   +N P+++D  R +++ Y ++   A E +
Sbjct: 66  KLNCQVIGASVDSHFSHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK--ADEGI 123

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATP 168
           + R ++ ID    +R +       GR   EILR++ + Q TD +    P
Sbjct: 124 SFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCP 172


>2bmxB [x.x.x] ALKYL HYDROPEROXIDASE C
          Length = 177

 Score = 79.3 bits (194), Expect = 9e-18
 Identities = 43/128 (33%), Positives = 76/128 (59%), Gaps = 6/128 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W V++  P D+T VC TE+   +KL DEF+ RD ++  +S+D   +H  W +  N+ +  
Sbjct: 46  WRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLK-- 103

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
            + FP ++D  R++S+   +++   ++ V  R  + +DPN +I+ V     S GR+  E+
Sbjct: 104 TLPFP-LSDIKRELSQAAGVLN---ADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEV 159

Query: 151 LRVIDSLQ 158
           LRV+D+LQ
Sbjct: 160 LRVLDALQ 167


>2bmxA [x.x.x] ALKYL HYDROPEROXIDASE C
          Length = 168

 Score = 79.3 bits (194), Expect = 9e-18
 Identities = 43/128 (33%), Positives = 76/128 (59%), Gaps = 6/128 (4%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W V++  P D+T VC TE+   +KL DEF+ RD ++  +S+D   +H  W +  N+ +  
Sbjct: 46  WRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLK-- 103

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
            + FP ++D  R++S+   +++   ++ V  R  + +DPN +I+ V     S GR+  E+
Sbjct: 104 TLPFP-LSDIKRELSQAAGVLN---ADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEV 159

Query: 151 LRVIDSLQ 158
           LRV+D+LQ
Sbjct: 160 LRVLDALQ 167


>1zofA [x.x.x] ALKYL HYDROPEROXIDE-REDUCTASE
          Length = 170

 Score = 79.0 bits (193), Expect = 1e-17
 Identities = 49/168 (29%), Positives = 82/168 (48%), Gaps = 10/168 (5%)

Query: 8   VAPDFTQESTIG----PLHFH--DWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           +APDF   + +G      HF     +G    +L+  P D+T VC TE+    K   +F +
Sbjct: 6   LAPDFKAPAVLGNNEVDEHFELSKNLGKNGVILFFWPKDFTFVCPTEIIAFDKRVKDFHE 65

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASETVT 120
           +   V  +S+D    H  W +   E  G  QV+FP++AD  + +S  YD++     E + 
Sbjct: 66  KGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVSFPMVADITKSISRDYDVLF---EEAIA 122

Query: 121 VRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATP 168
           +R  + ID N K+R  +      GR+  E+LR++D+L   + +    P
Sbjct: 123 LRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCP 170


>2c0dB [x.x.x] THIOREDOXIN PEROXIDASE 2
          Length = 175

 Score = 78.6 bits (192), Expect = 2e-17
 Identities = 45/150 (30%), Positives = 79/150 (52%), Gaps = 4/150 (2%)

Query: 26  WIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDIN 85
           +IG  +  L  +P +YT VC TE+    K   +F+ ++V++  +SVD V SH  W +   
Sbjct: 28  FIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGISVDSVYSHLAWKNMPI 87

Query: 86  ETQGC-QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTG 144
           E  G   V F +++D ++ +S+ Y++++     +  +R ++ ID N  +R         G
Sbjct: 88  EKGGIGNVEFTLVSDINKDISKNYNVLY---DNSFALRGLFIIDKNGCVRHQTVNDLPIG 144

Query: 145 RDFGEILRVIDSLQLTDNYSVATPVDWKDG 174
           R+  E+LR IDS+   D      P++WK G
Sbjct: 145 RNVQEVLRTIDSIIHVDTSGEVCPINWKKG 174


>2h66B [x.x.x] PV-PF14_0368
          Length = 171

 Score = 76.3 bits (186), Expect = 8e-17
 Identities = 47/171 (27%), Positives = 87/171 (50%), Gaps = 9/171 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 3   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 62

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 63  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 119

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNYSVATP 168
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y    P
Sbjct: 120 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKYGDVCP 170


>2pn8H [x.x.x] PEROXIREDOXIN-4
          Length = 190

 Score = 75.5 bits (184), Expect = 1e-16
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + V + +P D+T VC TE+       +EF+  + +V A SVD   +H  WI+      G 
Sbjct: 32  YLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGL 91

Query: 91  -QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGE 149
             +  P+++D   ++S+ Y +    +  T+  R ++ ID    +R +       GR   E
Sbjct: 92  GPIRIPLLSDLTHQISKDYGVYLEDSGHTL--RGLFIIDDKGILRQITLNDLPVGRSVDE 149

Query: 150 ILRVIDSLQLTDNYSVATPVDWKDGDDCVI 179
            LR++ + Q TD +    P  WK G + +I
Sbjct: 150 TLRLVQAFQYTDKHGEVCPAGWKPGSETII 179


>2pn8A [x.x.x] PEROXIREDOXIN-4
          Length = 191

 Score = 75.5 bits (184), Expect = 1e-16
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + V + +P D+T VC TE+       +EF+  + +V A SVD   +H  WI+      G 
Sbjct: 32  YLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGL 91

Query: 91  -QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGE 149
             +  P+++D   ++S+ Y +    +  T+  R ++ ID    +R +       GR   E
Sbjct: 92  GPIRIPLLSDLTHQISKDYGVYLEDSGHTL--RGLFIIDDKGILRQITLNDLPVGRSVDE 149

Query: 150 ILRVIDSLQLTDNYSVATPVDWKDGDDCVI 179
            LR++ + Q TD +    P  WK G + +I
Sbjct: 150 TLRLVQAFQYTDKHGEVCPAGWKPGSETII 179


>2h66F [x.x.x] PV-PF14_0368
          Length = 168

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 46/166 (27%), Positives = 86/166 (51%), Gaps = 9/166 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 2   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 61

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 62  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 118

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNY 163
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y
Sbjct: 119 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKY 164


>2h66D [x.x.x] PV-PF14_0368
          Length = 169

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 46/166 (27%), Positives = 86/166 (51%), Gaps = 9/166 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 3   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 62

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 63  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 119

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNY 163
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y
Sbjct: 120 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKY 165


>2h66C [x.x.x] PV-PF14_0368
          Length = 170

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 46/166 (27%), Positives = 86/166 (51%), Gaps = 9/166 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 4   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 63

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 64  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 120

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNY 163
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y
Sbjct: 121 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKY 166


>2h66A [x.x.x] PV-PF14_0368
          Length = 167

 Score = 75.1 bits (183), Expect = 2e-16
 Identities = 46/166 (27%), Positives = 86/166 (51%), Gaps = 9/166 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 3   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 62

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 63  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 119

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNY 163
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y
Sbjct: 120 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQHHEKY 165


>2h66J [x.x.x] PV-PF14_0368
          Length = 163

 Score = 73.6 bits (179), Expect = 5e-16
 Identities = 45/161 (27%), Positives = 84/161 (52%), Gaps = 9/161 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 3   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 62

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 63  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 119

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQ 158
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q
Sbjct: 120 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQ 160


>2h66E [x.x.x] PV-PF14_0368
          Length = 161

 Score = 73.6 bits (179), Expect = 5e-16
 Identities = 45/161 (27%), Positives = 84/161 (52%), Gaps = 9/161 (5%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 3   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 62

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 63  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 119

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQ 158
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q
Sbjct: 120 SVSLRAFVLIDMNGIVQHLLVNNLAIGRSVDEILRIIDAIQ 160


>2i81D [x.x.x] 2-CYS PEROXIREDOXIN
          Length = 163

 Score = 71.6 bits (174), Expect = 2e-15
 Identities = 46/166 (27%), Positives = 86/166 (51%), Gaps = 10/166 (6%)

Query: 4   HIGDVAPDFTQESTIGPLHFHD-----WIGNGWAVLYSHPADYTPVCTTELGTTAKLADE 58
           ++G  AP F  E+  G   F +     +IG  + +LY +P D+T VC +E+    K  D 
Sbjct: 2   YVGKEAPFFKAEAVFGDNSFGEVNLTQFIGKKYVLLYFYPLDFTFVCPSEIIALDKALDA 61

Query: 59  FKKRDVKVAALSVDDVDSHKGWISDINETQGC-QVNFPIIADADRKVSELYDMIHPGASE 117
           F +R+V++   SVD   +H  W        G   +   +++D  + +S+ Y+++     +
Sbjct: 62  FHERNVELLGCSVDSKYTHLAWKKTPLAKGGIGNIKHTLLSDITKSISKDYNVLF---DD 118

Query: 118 TVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLTDNY 163
           +V++R+   ID N  ++ ++    + GR   EILR+ID++Q  + Y
Sbjct: 119 SVSLRAFVLIDMNGIVQHLLV-NNAIGRSVDEILRIIDAIQHHEKY 163


>1n8jA [c.47.1] ALKYL HYDROPEROXIDE REDUCTASE C22 PROTEIN
          Length = 186

 Score = 70.5 bits (171), Expect = 4e-15
 Identities = 47/154 (30%), Positives = 79/154 (51%), Gaps = 6/154 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T V  TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVSPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ-LTDNYSVATPVDWKDGDDCVIVPSL 183
           LR I + Q +  +     P  WK+G +  + PSL
Sbjct: 148 LRKIKAAQYVAAHPGEVCPAKWKEG-EATLAPSL 180


>1e2yG [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 167

 Score = 70.5 bits (171), Expect = 4e-15
 Identities = 43/142 (30%), Positives = 74/142 (52%), Gaps = 5/142 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 31  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P+ AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 90  GPAIPL-ADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 145

Query: 151 LRVIDSLQLTDNYSVATPVDWK 172
           +R++++LQ  + +    P +WK
Sbjct: 146 IRLVEALQFVEEHGEVCPANWK 167


>2c0dA [x.x.x] THIOREDOXIN PEROXIDASE 2
          Length = 168

 Score = 68.9 bits (167), Expect = 1e-14
 Identities = 42/144 (29%), Positives = 74/144 (51%), Gaps = 4/144 (2%)

Query: 26  WIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDIN 85
           +IG  +  L  +P +YT VC TE+    K   +F+ ++V++  +SVD V SH  W +   
Sbjct: 28  FIGQKYCCLLFYPLNYTFVCPTEIIEFNKHIKDFENKNVELLGISVDSVYSHLAWKNMPI 87

Query: 86  ETQGC-QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTG 144
           E  G   V F +++D ++ +S+ Y++++     +  +R ++ ID N  +R         G
Sbjct: 88  EKGGIGNVEFTLVSDINKDISKNYNVLY---DNSFALRGLFIIDKNGCVRHQTVNDLPIG 144

Query: 145 RDFGEILRVIDSLQLTDNYSVATP 168
           R+  E+LR IDS+   D      P
Sbjct: 145 RNVQEVLRTIDSIIHVDTSGEVCP 168


>1zyeA [x.x.x] THIOREDOXIN-DEPENDENT PEROXIDE REDUCTASE
          Length = 162

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 3/132 (2%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A EF   + +V A+SVD   SH  WI+   +  G 
Sbjct: 32  YLVLFFYPLDFTFVCPTEIIAFSDKASEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGL 91

Query: 91  -QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGE 149
             +N  +++D  +++S  Y ++  G    + +R ++ IDPN  I+ +       GR   E
Sbjct: 92  GHMNIALLSDLTKQISRDYGVLLEGPG--LALRGLFIIDPNGVIKHLSVNDLPVGRSVEE 149

Query: 150 ILRVIDSLQLTD 161
            LR++ + Q  +
Sbjct: 150 TLRLVKAFQFVE 161


>1yepD [c.47.1 (1kygA)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 166

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yepC [c.47.1 (1kygC)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 163

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yepB [c.47.1 (1kygB)] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 165

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yepA [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 168

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>3empB [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 162

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>3empA [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 161

 Score = 67.0 bits (162), Expect = 5e-14
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D   +HK W S  +ET   
Sbjct: 31  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFTHKAWHSS-SETI-A 88

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 89  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 146

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 147 LRKIKAAQ 154


>1yexD [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 166

 Score = 66.6 bits (161), Expect = 6e-14
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFDHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yexC [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 163

 Score = 66.6 bits (161), Expect = 6e-14
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFDHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yexB [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 165

 Score = 66.6 bits (161), Expect = 6e-14
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFDHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yexA [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 167

 Score = 66.6 bits (161), Expect = 6e-14
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFDHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf1C [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 163

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFVHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf1B [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 165

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFVHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf1A [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 166

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFVHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf0D [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 166

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFIHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf0C [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 163

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFIHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf0B [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 165

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFIHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1yf0A [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT C
          Length = 167

 Score = 65.9 bits (159), Expect = 1e-13
 Identities = 41/128 (32%), Positives = 67/128 (52%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+V + +PAD+T VC TELG  A   +E +K  V V ++S D    HK W S  +ET   
Sbjct: 32  WSVFFFYPADFTFVCPTELGDVADHYEELQKLGVDVYSVSTDTHFIHKAWHSS-SETI-A 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
           ++ + +I D    ++  +D +     E +  R+ + +DP   I+A+       GRD  ++
Sbjct: 90  KIKYAMIGDPTGALTRNFDNMR--EDEGLADRATFVVDPQGIIQAIEVTAEGIGRDASDL 147

Query: 151 LRVIDSLQ 158
           LR I + Q
Sbjct: 148 LRKIKAAQ 155


>1e2yB [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 165

 Score = 64.3 bits (155), Expect = 3e-13
 Identities = 41/140 (29%), Positives = 72/140 (51%), Gaps = 5/140 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 31  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 90  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 145

Query: 151 LRVIDSLQLTDNYSVATPVD 170
           +R++++LQ  + +    P +
Sbjct: 146 IRLVEALQFVEEHGEVCPAN 165


>1e2yC [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 164

 Score = 63.9 bits (154), Expect = 4e-13
 Identities = 41/138 (29%), Positives = 71/138 (51%), Gaps = 5/138 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 32  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 90

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 91  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 146

Query: 151 LRVIDSLQLTDNYSVATP 168
           +R++++LQ  + +    P
Sbjct: 147 IRLVEALQFVEEHGEVCP 164


>1e2yH [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 163

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 32  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 90

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 91  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 146

Query: 151 LRVIDSLQLTDNY 163
           +R++++LQ  + +
Sbjct: 147 IRLVEALQFVEEH 159


>1e2yE [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 159

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 31  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 90  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 145

Query: 151 LRVIDSLQLTDNY 163
           +R++++LQ  + +
Sbjct: 146 IRLVEALQFVEEH 158


>1e2yD [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 160

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 32  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 90

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 91  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 146

Query: 151 LRVIDSLQLTDNY 163
           +R++++LQ  + +
Sbjct: 147 IRLVEALQFVEEH 159


>1e2yA [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 161

 Score = 62.4 bits (150), Expect = 1e-12
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 33  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 91

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 92  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 147

Query: 151 LRVIDSLQLTDNY 163
           +R++++LQ  + +
Sbjct: 148 IRLVEALQFVEEH 160


>1e2yF [c.47.1] TRYPAREDOXIN PEROXIDASE
          Length = 155

 Score = 60.8 bits (146), Expect = 3e-12
 Identities = 40/128 (31%), Positives = 68/128 (53%), Gaps = 5/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           + VL+ +P D+T VC TE+   +  A  F + + +V + S D   SH  W S   +  G 
Sbjct: 31  YVVLFFYP-DFTFVCPTEIIQFSDDAKRFAEINTEVISCSCDSEYSHLQWTSVDRKKGGL 89

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
               P +AD  + ++  Y ++   +   V  R V+ IDPN K+R +I   P  GR+  E+
Sbjct: 90  GPAIP-LADKTKAIARAYGVLDEDSG--VAYRGVFIIDPNGKLRQIIINDP-IGRNVEEV 145

Query: 151 LRVIDSLQ 158
           +R++++LQ
Sbjct: 146 IRLVEALQ 153


>1we0A [x.x.x] ALKYL HYDROPEROXIDE REDUCTASE C
          Length = 166

 Score = 58.9 bits (141), Expect = 1e-11
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 4/128 (3%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W+++  +PAD++ VC TEL    K   E KK  V+V ++S D    HK W    N     
Sbjct: 33  WSIVVFYPADFSFVCPTELEDVQKEYAELKKLGVEVYSVSTDTHFVHKAWHE--NSPAVG 90

Query: 91  QVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEI 150
            + + +I D  + +S  +D+++      +  R  + IDP+  I+A+       GRD   +
Sbjct: 91  SIEYIMIGDPSQTISRQFDVLNEETG--LADRGTFIIDPDGVIQAIEINADGIGRDASTL 148

Query: 151 LRVIDSLQ 158
           +  + + Q
Sbjct: 149 INKVKAAQ 156


>2cx3B [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
          Length = 159

 Score = 54.7 bits (130), Expect = 2e-10
 Identities = 46/154 (29%), Positives = 81/154 (52%), Gaps = 11/154 (7%)

Query: 3   LHIGDVAPDFT-QESTIGPLHFHDWIGNGW-AVLYSHPADYTPVCTTELGTTAKLADEFK 60
           + +G+ APDFT       P++ ++ +  G  AVL   PA ++PVCT EL T    A + +
Sbjct: 3   VELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKA-QLE 61

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASE-TV 119
           K + +V A+SVD     K +  D N     ++ F +++D +R+V +LY++ H       V
Sbjct: 62  KANAEVLAISVDSPWCLKKF-KDEN-----RLAFNLLSDYNREVIKLYNVYHEDLKGLKV 115

Query: 120 TVRSVYFIDPNKKIR-AVITYPPSTGRDFGEILR 152
             R+V+ + P+  +    +T  P    D+ E++R
Sbjct: 116 AKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVR 149


>2cx3A [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
          Length = 158

 Score = 54.7 bits (130), Expect = 2e-10
 Identities = 46/154 (29%), Positives = 81/154 (52%), Gaps = 11/154 (7%)

Query: 3   LHIGDVAPDFT-QESTIGPLHFHDWIGNGW-AVLYSHPADYTPVCTTELGTTAKLADEFK 60
           + +G+ APDFT       P++ ++ +  G  AVL   PA ++PVCT EL T    A + +
Sbjct: 2   VELGEKAPDFTLPNQDFEPVNLYEVLKRGRPAVLIFFPAAFSPVCTKELCTFRDKA-QLE 60

Query: 61  KRDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASE-TV 119
           K + +V A+SVD     K +  D N     ++ F +++D +R+V +LY++ H       V
Sbjct: 61  KANAEVLAISVDSPWCLKKF-KDEN-----RLAFNLLSDYNREVIKLYNVYHEDLKGLKV 114

Query: 120 TVRSVYFIDPNKKIR-AVITYPPSTGRDFGEILR 152
             R+V+ + P+  +    +T  P    D+ E++R
Sbjct: 115 AKRAVFIVKPDGTVAYKWVTDNPLNEPDYDEVVR 148


>3gknA [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
          Length = 159

 Score = 47.8 bits (112), Expect = 3e-08
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W V+Y +P D TP  TTE      L  EF K   K+  +S D V SH  + +     QG 
Sbjct: 34  WLVIYFYPKDSTPGATTEGLDFNALLPEFDKAGAKILGVSRDSVKSHDNFCA----KQG- 88

Query: 91  QVNFPIIADADRKVSELYDMIHP----GASETVTVRSVYFIDPNKKI 133
              FP+++D D  +   +D+I      G       RS + + P  ++
Sbjct: 89  -FAFPLVSDGDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGQV 134


>3gkmA [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
          Length = 157

 Score = 47.8 bits (112), Expect = 3e-08
 Identities = 32/107 (29%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W V+Y +P D TP  TTE      L  EF K   K+  +S D V SH     + +  QG 
Sbjct: 32  WLVIYFYPKDSTPGSTTEGLDFNALLPEFDKAGAKILGVSRDSVKSH----DNFSAKQG- 86

Query: 91  QVNFPIIADADRKVSELYDMIHP----GASETVTVRSVYFIDPNKKI 133
              FP+++D D  +   +D+I      G       RS + + P  ++
Sbjct: 87  -FAFPLVSDGDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGQV 132


>3gkkA [x.x.x] BACTERIOFERRITIN COMIGRATORY PROTEIN
          Length = 156

 Score = 44.7 bits (104), Expect = 3e-07
 Identities = 31/107 (28%), Positives = 46/107 (42%), Gaps = 13/107 (12%)

Query: 31  WAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGWISDINETQGC 90
           W V+Y +P D TP CTTE      L  EF K   K+  +S D V        +    QG 
Sbjct: 35  WLVIYFYPKDSTPGCTTEGLDFNALLPEFDKAGAKILGVSRDSV-------KNFCAKQG- 86

Query: 91  QVNFPIIADADRKVSELYDMIHP----GASETVTVRSVYFIDPNKKI 133
              FP+++D D  +   +D+I      G       RS + + P  ++
Sbjct: 87  -FAFPLVSDGDEALCRAFDVIKEKNMYGKQVLGIERSTFLLSPEGQV 132


>3c71A [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 140

 Score = 42.4 bits (98), Expect = 1e-06
 Identities = 31/103 (30%), Positives = 48/103 (46%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    + P C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCPHCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>1xxuA [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298
          Length = 153

 Score = 42.0 bits (97), Expect = 2e-06
 Identities = 38/147 (25%), Positives = 61/147 (41%), Gaps = 11/147 (7%)

Query: 3   LHIGDVAPDFT-QESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           L++G  APDFT ++     +    + G    +L   P  +T +C  EL        EF+ 
Sbjct: 2   LNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFEN 61

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIAD--ADRKVSELYDMIHPGASETV 119
            D    A+SV    +HK W +    T      FP+++D      VS+ Y + +  A   +
Sbjct: 62  DDSAALAISVGPPPTHKIWATQSGFT------FPLLSDFWPHGAVSQAYGVFNEQAG--I 113

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRD 146
             R  + +D +  IR      P   RD
Sbjct: 114 ANRGTFVVDRSGIIRFAEMKQPGEVRD 140


>1st9A [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 137

 Score = 40.8 bits (94), Expect = 4e-06
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 6   GDVAPDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           G  AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V
Sbjct: 2   GSDAPNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGV 59

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           ++ A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 60  EIVAVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 100


>2h1aB [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 139

 Score = 40.0 bits (92), Expect = 6e-06
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWAEPCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2h1aA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 136

 Score = 40.0 bits (92), Expect = 6e-06
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWAEPCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>3drnB [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
          Length = 150

 Score = 40.0 bits (92), Expect = 6e-06
 Identities = 39/156 (25%), Positives = 62/156 (39%), Gaps = 13/156 (8%)

Query: 5   IGDVAPDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRD 63
           +GD AP F   +  G  +   D+IG    VLY +P D TP  T E        D  K   
Sbjct: 3   VGDKAPLFEGIADNGEKISLSDYIGKHNIVLYFYPKDDTPGSTREASAFRDNWDLLKXXX 62

Query: 64  VKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETV-TVR 122
                      +SHK +       +  ++ F +++D D+K+ ELY     GA   +   R
Sbjct: 63  XXXXXXXXXXXNSHKRF------KEKYKLPFILVSDPDKKIRELY-----GAKGFILPAR 111

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQ 158
             + ID    IR +     +      E L+ +  ++
Sbjct: 112 ITFVIDKKGIIRHIYNSQMNPANHVNEALKALKQIK 147


>3drnA [x.x.x] PEROXIREDOXIN, BACTERIOFERRITIN COMIGRATORY
          Length = 152

 Score = 40.0 bits (92), Expect = 6e-06
 Identities = 39/156 (25%), Positives = 62/156 (39%), Gaps = 13/156 (8%)

Query: 5   IGDVAPDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRD 63
           +GD AP F   +  G  +   D+IG    VLY +P D TP  T E        D  K   
Sbjct: 3   VGDKAPLFEGIADNGEKISLSDYIGKHNIVLYFYPKDDTPGSTREASAFRDNWDLLKXXX 62

Query: 64  VKVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETV-TVR 122
                      +SHK +       +  ++ F +++D D+K+ ELY     GA   +   R
Sbjct: 63  XXXXXXXXXXXNSHKRF------KEKYKLPFILVSDPDKKIRELY-----GAKGFILPAR 111

Query: 123 SVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQ 158
             + ID    IR +     +      E L+ +  ++
Sbjct: 112 ITFVIDKKGIIRHIYNSQMNPANHVNEALKALKQIK 147


>1su9B [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 136

 Score = 39.7 bits (91), Expect = 8e-06
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>1su9A [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 137

 Score = 39.7 bits (91), Expect = 8e-06
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>1st9B [c.47.1] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 135

 Score = 39.7 bits (91), Expect = 8e-06
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2h1bC [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 137

 Score = 39.7 bits (91), Expect = 8e-06
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 6   GDVAPDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           G  AP+F  E T G  +   D  G G  V  +    +   C  +    A     FK + V
Sbjct: 1   GSDAPNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKQFPYMANQYKHFKSQGV 58

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           ++ A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 59  EIVAVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 99


>2h1bA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 138

 Score = 39.7 bits (91), Expect = 8e-06
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 6   GDVAPDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           G  AP+F  E T G  +   D  G G  V  +    +   C  +    A     FK + V
Sbjct: 2   GSDAPNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKQFPYMANQYKHFKSQGV 59

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           ++ A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 60  EIVAVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 100


>3c73B [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 138

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEHCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>3c73A [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 136

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 30/103 (29%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEHCKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2h1gB [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 137

 Score = 36.6 bits (83), Expect = 7e-05
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +      E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWAEPAKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2h1gA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 136

 Score = 36.6 bits (83), Expect = 7e-05
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +      E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWAEPAKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2h19B [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 136

 Score = 36.2 bits (82), Expect = 9e-05
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +      E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2h19A [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 138

 Score = 36.2 bits (82), Expect = 9e-05
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 8/103 (7%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +      E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPAKKEFPYMANQYKHFKSQGVEIV 60

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +       I+  N  +   VNFP++ D DR+V + YD+
Sbjct: 61  AVNVGESK-----IAVHNFMKSYGVNFPVVLDTDRQVLDAYDV 98


>2f9sA [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 133

 Score = 35.4 bits (80), Expect = 2e-04
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 6   GDVAPDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDV 64
           G  AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V
Sbjct: 2   GSDAPNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKEF-PYANQYKHFKSQGV 58

Query: 65  KVAALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           ++ A++V +          ++  +   VNFP++ D DR+V + YD+
Sbjct: 59  EIVAVNVGESKIA------VHNFKSYGVNFPVVLDTDRQVLDAYDV 98


>2f9sB [x.x.x] THIOL-DISULFIDE OXIDOREDUCTASE RESA
          Length = 131

 Score = 34.3 bits (77), Expect = 3e-04
 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 10/103 (9%)

Query: 9   APDFTQESTIGP-LHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVA 67
           AP+F  E T G  +   D  G G  V  +    +   C  E    A     FK + V++ 
Sbjct: 3   APNFVLEDTNGKRIELSDLKGKG--VFLNFWGTWCEPCKKEF-PYANQYKHFKSQGVEIV 59

Query: 68  ALSVDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDM 110
           A++V +          ++  +   VNFP++ D DR+V + YD+
Sbjct: 60  AVNVGESKIA------VHNFKSYGVNFPVVLDTDRQVLDAYDV 96


>1xvwB [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298
          Length = 159

 Score = 33.9 bits (76), Expect = 4e-04
 Identities = 37/147 (25%), Positives = 60/147 (40%), Gaps = 12/147 (8%)

Query: 3   LHIGDVAPDFT-QESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           L++G  APDFT ++     +    + G    +L   P  +T +   EL        EF+ 
Sbjct: 9   LNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGI-QGELDQLRDHLPEFEN 67

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIAD--ADRKVSELYDMIHPGASETV 119
            D    A+SV    +HK W +    T      FP+++D      VS+ Y + +  A   +
Sbjct: 68  DDSAALAISVGPPPTHKIWATQSGFT------FPLLSDFWPHGAVSQAYGVFNEQAG--I 119

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRD 146
             R  + +D +  IR      P   RD
Sbjct: 120 ANRGTFVVDRSGIIRFAEMKQPGEVRD 146


>1xvwA [x.x.x] HYPOTHETICAL PROTEIN RV2238C/MT2298
          Length = 157

 Score = 33.9 bits (76), Expect = 4e-04
 Identities = 37/147 (25%), Positives = 60/147 (40%), Gaps = 12/147 (8%)

Query: 3   LHIGDVAPDFT-QESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKK 61
           L++G  APDFT ++     +    + G    +L   P  +T +   EL        EF+ 
Sbjct: 7   LNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGI-QGELDQLRDHLPEFEN 65

Query: 62  RDVKVAALSVDDVDSHKGWISDINETQGCQVNFPIIAD--ADRKVSELYDMIHPGASETV 119
            D    A+SV    +HK W +    T      FP+++D      VS+ Y + +  A   +
Sbjct: 66  DDSAALAISVGPPPTHKIWATQSGFT------FPLLSDFWPHGAVSQAYGVFNEQAG--I 117

Query: 120 TVRSVYFIDPNKKIRAVITYPPSTGRD 146
             R  + +D +  IR      P   RD
Sbjct: 118 ANRGTFVVDRSGIIRFAEMKQPGEVRD 144


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.317    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,011,890,949
Number of extensions: 41139943
Number of successful extensions: 96862
Number of sequences better than 1.0e-03: 1345
Number of HSP's gapped: 95759
Number of HSP's successfully gapped: 1535
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)