BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABA57001.1 noce0 ABA57001.1 GIB00281CH01 "NADH dehydrogenase
(quinone)"
         (548 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

NU5C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;...   195   7e-52
NU5C1_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit...   193   3e-51
NU5M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   191   2e-50
NU5C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;...   189   4e-50
NU5M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   189   6e-50
NUOL_RICFE RecName: Full=NADH-quinone oxidoreductase subunit L; ...   188   8e-50
NQO12_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 12...   188   8e-50
NU5M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   185   7e-49
NU5C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   185   7e-49
NU5M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   185   9e-49
NU5C_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   182   5e-48
NUOL_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit L; ...   182   6e-48
NU5M_DICDI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   182   8e-48
NUOL_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit L; ...   181   1e-47
NU5M_RABIT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   180   2e-47
NU5M_DICCI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   180   2e-47
NU5C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   179   4e-47
NU5C_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   179   7e-47
NU5C_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   179   7e-47
NU5C_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   179   7e-47
NU5M_HIPAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   178   9e-47
NU5C_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   178   9e-47
NU5C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   178   9e-47
NU5M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   177   1e-46
NU5M_HALGR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   177   1e-46
NU5C_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   177   1e-46
NU5M_PHOVI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   177   2e-46
NU5C_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   177   3e-46
NU5C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_TECST RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   3e-46
NU5C_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   176   6e-46
NUOL_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit L; ...   175   7e-46
NU5C_CICIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   175   7e-46
NU5C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   175   1e-45
NU5M_SORFM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   174   2e-45
NU5C_BRADI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   174   2e-45
NU5C_ATHGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   174   2e-45
NU5C_AMBTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   174   2e-45
NU5C_ADEHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   174   2e-45
NU5M_PIG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;  ...   173   3e-45
NU5M_CRYPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   173   3e-45
NU5C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   3e-45
NU5C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   3e-45
NU5C_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   3e-45
NU5M_CANLU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   173   4e-45
NU5C_GERJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   4e-45
NU5C_DIGGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   4e-45
NU5C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   4e-45
NU5C_ATRJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   173   4e-45
NU5M_RHIST RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   172   5e-45
NU5C_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   172   5e-45
NU5M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   172   6e-45
NU5C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   172   8e-45
NU5M_PHYIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   171   1e-44
NU5C_SESIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   171   1e-44
NUOL_RICPR RecName: Full=NADH-quinone oxidoreductase subunit L; ...   171   1e-44
NU5M_POLOR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   171   1e-44
NU5C_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   171   1e-44
NU5C_FLARA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   171   1e-44
NU5C_DAMDI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   171   1e-44
NU5M_ALLMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   171   2e-44
NU5C_GUIAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   171   2e-44
NU5C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   170   2e-44
NU5M_SCYCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   170   3e-44
NU5M_DASNO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   170   3e-44
NU5C_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   170   3e-44
NUOL_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit L; ...   169   4e-44
NU5M_RHIUN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   169   4e-44
NU5M_DUGDU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   169   4e-44
NU5C_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   169   4e-44
NU5C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   169   4e-44
NU5M_LEMCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   169   5e-44
NU5M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   169   7e-44
NU5M_GEOPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   169   7e-44
NU5C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   168   9e-44
NU5M_PENMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   168   1e-43
NU5C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   168   1e-43
NU5M_HORSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   167   2e-43
NU5M_BOSIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   167   2e-43
NU5C_LEMMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   167   2e-43
NU5C_CAPBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   167   2e-43
NU5M_SHEEP RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   167   2e-43
NU5M_EQUAS RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   167   2e-43
NU5M_BOVIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   167   2e-43
NU5C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   167   2e-43
NU5M_PODAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   167   3e-43
NU5M_BALPH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   166   3e-43
NU5M_BALMU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   166   3e-43
NU5M_ASPNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   166   3e-43
NU5C_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   166   3e-43
NU5M_CANFA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   166   4e-43
NU5C_POAPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   166   4e-43
NU5C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   166   4e-43
NU5C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   166   4e-43
NUOL_RICTY RecName: Full=NADH-quinone oxidoreductase subunit L; ...   165   8e-43
NU5C_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   165   8e-43
NU5C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   165   8e-43
NUOL_RICCN RecName: Full=NADH-quinone oxidoreductase subunit L; ...   164   1e-42
NUOL_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit L; ...   164   1e-42
NUOL_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit L; ...   164   1e-42
NU5M_TRIRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   164   1e-42
NU5M_MACRO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   164   1e-42
NU5M_GORGO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   164   1e-42
NU5M_PANTR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   164   2e-42
NU5M_FELCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   164   2e-42
NU5C_CARTI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   164   2e-42
NU5M_CERSI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   164   2e-42
NU5M_MYOGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   163   3e-42
NU5M_HYLLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   163   3e-42
NU5M_DIDMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   163   3e-42
NU5C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   163   3e-42
NU5C_MALAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   163   3e-42
NU5M_PANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   163   4e-42
NU5C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   163   4e-42
NU5C_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   163   4e-42
NQO12_PARDE RecName: Full=NADH-quinone oxidoreductase chain 12; ...   163   4e-42
NU5M_SCHCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   162   5e-42
NU5C_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
NU5C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   5e-42
PHAAB_RHIME RecName: Full=Probable K(+)/H(+) antiporter subunit ...   162   6e-42
NU5M_ROUAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   162   8e-42
NU5C_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   8e-42
NU5C_ASTCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   162   8e-42
NU5C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   161   1e-41
NU5C_MUTAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   161   1e-41
NU5M_PETMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   161   1e-41
NU5C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   160   2e-41
NU5C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   160   2e-41
NU5C_CARCG RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   160   2e-41
NU5M_RAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;  ...   160   2e-41
NU5C_PACAQ RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   160   2e-41
NU5C_ANIIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   160   2e-41
NU5M_TRIRU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   160   3e-41
NU5M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   160   3e-41
NU5C_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   159   4e-41
NU5M_PAPHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   159   7e-41
NU5C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   159   7e-41
NU5M_ORNAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   158   9e-41
NU5C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   158   9e-41
NU5C_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   158   9e-41
MRPA_BACSU RecName: Full=Na(+)/H(+) antiporter subunit A;AltName...   158   9e-41
NUOL_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit L; ...   158   1e-40
NUOL_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit L; ...   158   1e-40
NU5M_SQUAC RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   156   4e-40
NU5C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   156   4e-40
NU5M_CHIMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   156   5e-40
NU5C_LIGVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   156   5e-40
NU5C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   155   6e-40
NU5C_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   155   8e-40
NU5C_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   155   1e-39
NU5M_CRYNV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   154   1e-39
NU5C_VICFA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   154   1e-39
NU5C_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   154   1e-39
NU5C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   154   2e-39
NU5C_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   154   2e-39
NU5M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   154   2e-39
NU5M_EMENI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   154   2e-39
NU5M_DEBHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   153   3e-39
NU5C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   153   3e-39
NU5C_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   153   3e-39
NUOL_STRCO RecName: Full=NADH-quinone oxidoreductase subunit L; ...   152   5e-39
NU5M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   152   7e-39
MNHA2_STAES RecName: Full=Putative antiporter subunit mnhA2;AltN...   152   7e-39
MNHA2_STAEQ RecName: Full=Putative antiporter subunit mnhA2;AltN...   152   7e-39
NU5C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   152   9e-39
NU5M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   151   1e-38
NU5C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   151   1e-38
NU5M_MOUSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   150   2e-38
NU5C_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   150   2e-38
NU5C_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   150   2e-38
NU5C_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   150   2e-38
NU5C_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   150   2e-38
NU5C_CICAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   150   3e-38
NU5M_LOXAF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   149   4e-38
NU5M_DINSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   149   4e-38
NU5M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   149   7e-38
NU5M_CYPCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   148   1e-37
NU5M_PONPY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   148   1e-37
NU5M_LATCH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   147   2e-37
NU5M_STRCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   147   2e-37
NU5C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   147   3e-37
NU5C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   146   4e-37
NU5C_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   146   4e-37
NU5C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   146   4e-37
NUOL_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit L; ...   145   6e-37
NU5M_ONCMY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   145   6e-37
NU5M_HUMAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   145   6e-37
NU5C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   145   6e-37
NU5C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   145   6e-37
NU5C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   145   6e-37
NU5C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   145   8e-37
NU5M_PONAB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   145   1e-36
NU5M_GADMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   145   1e-36
NU5M_XENLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   144   1e-36
MNHA2_STAS1 RecName: Full=Putative antiporter subunit mnhA2;AltN...   144   1e-36
NU5M_CHICK RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   144   2e-36
NU5M_TETNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   144   2e-36
NU5C_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   143   3e-36
NU5C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   142   5e-36
MNHA1_STAES RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   142   5e-36
MNHA1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   142   5e-36
NUOL_RICBR RecName: Full=NADH-quinone oxidoreductase subunit L; ...   142   7e-36
NU5C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   142   7e-36
NU5C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   142   9e-36
NU5M_CROLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   141   1e-35
NU5M_CHLRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   141   1e-35
NU5M_SALSA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   140   2e-35
NU5C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   140   2e-35
MRPA_BACPF RecName: Full=Na(+)/H(+) antiporter subunit A;AltName...   140   2e-35
MNHA1_STAS1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   140   2e-35
NU5M_ELEMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   140   3e-35
NU5C_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   140   3e-35
NU5C_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   139   6e-35
NU5C_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   139   6e-35
NU5M_MAMPR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   138   1e-34
MNHA2_STAHJ RecName: Full=Putative antiporter subunit mnhA2;AltN...   138   1e-34
NU5C_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   136   5e-34
NU5M_BRALA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   135   6e-34
NU5C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   135   1e-33
NU5M_DANRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   134   1e-33
NU5M_PELSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   134   2e-33
NU5M_BRAFL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   134   2e-33
MNHA1_STAHJ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   132   9e-33
NU5M_PICCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   131   1e-32
NU5C_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit ...   131   2e-32
MNHA2_STAAR RecName: Full=Putative antiporter subunit mnhA2;AltN...   131   2e-32
NU5M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   130   2e-32
NU5M_YARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   129   6e-32
MNHA2_STAAN RecName: Full=Putative antiporter subunit mnhA2;AltN...   128   1e-31
MNHA2_STAAM RecName: Full=Putative antiporter subunit mnhA2;AltN...   128   1e-31
MNHA2_STAA9 RecName: Full=Putative antiporter subunit mnhA2;AltN...   128   1e-31
MNHA2_STAA2 RecName: Full=Putative antiporter subunit mnhA2;AltN...   128   1e-31
MNHA2_STAA1 RecName: Full=Putative antiporter subunit mnhA2;AltN...   128   1e-31
MNHA2_STAAW RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAAU RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAAT RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAAS RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAAE RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAAC RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAA8 RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA2_STAA3 RecName: Full=Putative antiporter subunit mnhA2;AltN...   127   2e-31
MNHA1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   1e-30
MNHA1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
MNHA1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   124   2e-30
NUOL_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit L; ...   124   3e-30
MNHA2_STAAB RecName: Full=Putative antiporter subunit mnhA2;AltN...   124   3e-30
MNHA1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit A1;AltNa...   123   3e-30
NU5M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   122   6e-30
NU5M_CANAL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   122   7e-30
NU5M_CANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   119   8e-29
NU5M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   119   8e-29
HYFD_ECOLI RecName: Full=Hydrogenase-4 component D;         EC=1...   115   9e-28
NU5M_ALBCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   114   3e-27
NU5M_DROME RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   111   2e-26
NU5M_DROYA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   110   2e-26
NU5C_PEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,...   109   5e-26
NU5H_NYCOV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   103   3e-24
NU5M_RHISA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   101   2e-23
NU5M_ARTSF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   101   2e-23
NU5M_MYTED RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...   100   3e-23
NU5M_ASCSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    98   1e-22
NU5M_AEDAE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    96   1e-21
NU5M_LOCMI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    95   1e-21
NU5C2_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit...    95   2e-21
NU5M_PARTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    93   6e-21
NU5M_PEA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;  ...    91   2e-20
NU5M_ANOGA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    91   2e-20
NU5M_ANOAR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    91   2e-20
NU5M_ANOQU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    87   3e-19
NU5M_APILI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    75   1e-15
MRPD_BACPF RecName: Full=Na(+)/H(+) antiporter subunit D;AltName...    73   7e-15
NUOM_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit M; ...    70   4e-14
Y051_MYCTU RecName: Full=Uncharacterized protein Rv0083/MT0090;        69   1e-13
NUOM_RICPR RecName: Full=NADH-quinone oxidoreductase subunit M; ...    68   2e-13
NU5M_CAEEL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    67   4e-13
HYFB_ECOLI RecName: Full=Hydrogenase-4 component B;         EC=1...    67   4e-13
NUOM_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit M; ...    66   6e-13
NUOM_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit M; ...    66   6e-13
NUOM_RICBR RecName: Full=NADH-quinone oxidoreductase subunit M; ...    65   1e-12
NU5M_ANOQN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    65   1e-12
NUOM_RICFE RecName: Full=NADH-quinone oxidoreductase subunit M; ...    65   2e-12
NQO13_PARDE RecName: Full=NADH-quinone oxidoreductase chain 13; ...    64   3e-12
MRPD_BACSU RecName: Full=Na(+)/H(+) antiporter subunit D;AltName...    64   3e-12
NU5M_TRYBB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;...    62   9e-12
NUOM_RICCN RecName: Full=NADH-quinone oxidoreductase subunit M; ...    60   3e-11
NUOM_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit M; ...    60   5e-11
MNHD2_STAS1 RecName: Full=Putative antiporter subunit mnhD2;AltN...    60   5e-11
HYCC_ECOLI RecName: Full=Formate hydrogenlyase subunit 3;       ...    60   5e-11
MNHD1_STAES RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    60   6e-11
MNHD1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    60   6e-11
NUOM_RICTY RecName: Full=NADH-quinone oxidoreductase subunit M; ...    59   8e-11
NU4C2_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    59   1e-10
MNHD2_STAAR RecName: Full=Putative antiporter subunit mnhD2;AltN...    59   1e-10
MNHD2_STAHJ RecName: Full=Putative antiporter subunit mnhD2;AltN...    58   2e-10
MNHD1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltNa...    58   2e-10
MNHD2_STAAW RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAU RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAT RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAS RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAN RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAM RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAE RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAC RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAAB RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAA9 RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAA8 RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAA3 RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAA2 RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
MNHD2_STAA1 RecName: Full=Putative antiporter subunit mnhD2;AltN...    57   3e-10
NU4C2_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    57   4e-10
NU4M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    56   7e-10
NU4C2_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    55   1e-09
NU4C1_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    55   1e-09
NU4C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    55   1e-09
NU4M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    54   2e-09
NUON_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit N; ...    54   3e-09
NU4M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    54   3e-09
NU4C3_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    54   3e-09
NU4C3_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    54   3e-09
NU4C2_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    54   3e-09
NU4C2_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    54   3e-09
NU4C2_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    54   3e-09
NU4C_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    54   4e-09
NU4C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    53   6e-09
NU4C2_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    53   6e-09
NDHF_BACSU RecName: Full=Probable NADH-quinone oxidoreductase su...    53   6e-09
MNHD2_STAES RecName: Full=Putative antiporter subunit mnhD2;AltN...    53   6e-09
MNHD2_STAEQ RecName: Full=Putative antiporter subunit mnhD2;AltN...    53   6e-09
NU4M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    53   7e-09
NU2C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    53   7e-09
NU4C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   9e-09
NU4C_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   9e-09
NU4C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   1e-08
NU4C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   1e-08
NU4C2_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    52   1e-08
NU4C2_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    52   1e-08
NU4C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   2e-08
NU4C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   2e-08
NU4C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   2e-08
NU4C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    52   2e-08
NU4C1_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    52   2e-08
NU4C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    51   2e-08
NU4C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    51   2e-08
NU4C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    51   2e-08
NU4C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    51   2e-08
NU4C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    51   2e-08
NU4C1_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    51   2e-08
NU4M_PROWI RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    51   3e-08
NU4C1_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    51   3e-08
NU4C1_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    51   3e-08
Y1309_METJA RecName: Full=Uncharacterized protein MJ1309;              50   5e-08
NU4M_BRACM RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    50   5e-08
NU4C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    50   5e-08
NU4C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    50   5e-08
NU4C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    50   5e-08
NU4C_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;...    50   5e-08
NU2C_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    50   6e-08
NU2C_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    50   6e-08
NUON2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit N ...    49   8e-08
NU4C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    49   8e-08
NU2C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    49   8e-08
NU4C2_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    49   1e-07
NU4C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    49   1e-07
NU4C2_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    49   1e-07
NU4C1_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    49   1e-07
NU4C1_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    48   2e-07
NU4C1_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    48   2e-07
NU2C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    48   2e-07
NU4C3_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    47   3e-07
NU4C1_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    47   3e-07
NU2C_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    47   3e-07
NUOM_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit M; ...    47   4e-07
NU2C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    47   4e-07
NUON_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit N; ...    47   5e-07
NUON_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit N; ...    47   5e-07
NU4C1_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    47   5e-07
NU2C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    47   5e-07
NU4M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    46   7e-07
NU4C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    46   9e-07
NU4C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    46   9e-07
NU2C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    45   2e-06
HYFF_ECOLI RecName: Full=Hydrogenase-4 component F;         EC=1...    45   2e-06
NU4M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    45   2e-06
NU2C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    45   2e-06
NU2C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    44   3e-06
NU2C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    44   3e-06
NU4C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    44   3e-06
NU4C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    44   3e-06
NU2C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    44   3e-06
NU2C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    44   3e-06
NU2C_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    44   3e-06
NUON_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit N; ...    44   4e-06
NU4M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    44   4e-06
NU2C_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    44   4e-06
NU2C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    44   4e-06
NU2C_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    43   7e-06
NU4M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    42   1e-05
NU4C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    42   1e-05
NU2C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    42   1e-05
NU2C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    42   1e-05
NU2C_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    42   1e-05
NU4C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    42   1e-05
NU2C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    42   1e-05
NU2C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    42   1e-05
NU2C_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    42   1e-05
NU2C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    42   1e-05
NU4M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    42   2e-05
NU4C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    42   2e-05
MNHD1_STAHJ RecName: Full=Na+/H+-antiporter, MnhD subunit;             42   2e-05
NU4C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    41   2e-05
NU2C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;...    41   2e-05
NU2C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    41   3e-05
NU4C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    40   4e-05
NU2M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 2;...    40   4e-05
NQO14_PARDE RecName: Full=NADH-quinone oxidoreductase chain 14; ...    40   4e-05
NUON_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit N; ...    40   5e-05
NU4C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    40   5e-05
NU4C1_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4...    40   5e-05
NU2C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    40   5e-05
NU2C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    40   5e-05
NU4C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    40   6e-05
NU4C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    40   6e-05
NU4M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    39   8e-05
NU4C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    39   1e-04
NU4C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    39   1e-04
NU4C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    39   1e-04
NU4C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    39   1e-04
NU2C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    39   1e-04
NU2C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    39   1e-04
NUON_RICTY RecName: Full=NADH-quinone oxidoreductase subunit N; ...    38   2e-04
NU4M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 4;...    38   2e-04
NU4C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    38   2e-04
NU2M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 2;...    38   2e-04
NUOM_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit M; ...    37   3e-04
NUOM_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit M; ...    37   3e-04
NU4C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   3e-04
NU4C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   3e-04
NU4C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   3e-04
NU2C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,...    37   3e-04
NU4C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   4e-04
NU4C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   4e-04
NU4C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   5e-04
NU4C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   5e-04
NU4C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   5e-04
NU4C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   5e-04
NU4C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   5e-04
NU4C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    37   5e-04
NU2M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 2;...    37   5e-04
NUON_RICPR RecName: Full=NADH-quinone oxidoreductase subunit N; ...    36   7e-04
NUOM_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit M; ...    36   7e-04
NU4C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    36   7e-04
NU4C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    36   7e-04
NU4C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    36   7e-04
NU4C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    36   7e-04
NU4C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    36   0.001
NU4C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,...    36   0.001
NU2M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 2;...    36   0.001

>NU5C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 5;
          Length = 664

 Score =  195 bits (496), Expect = 7e-52
 Identities = 144/382 (37%), Positives = 194/382 (50%), Gaps = 13/382 (3%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           L W   G F L +    D L   M+ +V  +AL V +Y+  YMA + G  RF+A+LS F 
Sbjct: 73  LEWAAAGDFHLQMGYTVDHLSALMSVIVTTVALLVMIYTDGYMAHDPGYVRFYAYLSIFS 132

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
             M            +I WE VG+ S++LIG  + +  A  A  KA +  R         
Sbjct: 133 SSMLGLVFSPNLVQVYIFWELVGMCSYLLIGFWYDRKAAADACQKAFVTNRVGDFXXXXX 192

Query: 152 XXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPE 207
                  TG+ +      ++ D                       + KSAQ PL  WLP+
Sbjct: 193 XXXXYWATGSFEFDLMGDRLMDLVSTGQISSXXXXXXXXXXXXGPVAKSAQFPLHVWLPD 252

Query: 208 AMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQ 267
           AM  PTP+SALIH+ATM AAGVFLV R++P+FE  P A+ V+ W GA TA + A +A  Q
Sbjct: 253 AMEGPTPISALIHAATMVAAGVFLVARMYPVFEPIPEAMNVIAWTGATTAFLGATIALTQ 312

Query: 268 YDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA----LERATG 323
            D+K+ LA+ST+SQ                 FHL  HA FK+ LFL  G+    +E   G
Sbjct: 313 NDIKKGLAYSTMSQLGYMVMAMGIGGYTAGLFHLMTHAYFKAMLFLGSGSVIHGMEEVVG 372

Query: 324 -----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWG 378
                 +D+R +GGL K +P T              P  +G+WS++E+L  A   +    
Sbjct: 373 HNAVLAQDMRLMGGLRKYMPITATTFLIGTLAICGIPPFAGFWSKDEILGLAFEANPVLW 432

Query: 379 VFMLVLILLAGIYIGRAAMATF 400
                   +   Y+ R    TF
Sbjct: 433 FIGWATAGMTAFYMFRMYFLTF 454


>NU5C1_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           organellar chromatophore 1;         EC=1.6.5.-;AltName:
           Full=NAD(P)H dehydrogenase subunit 5 1;
          Length = 666

 Score =  193 bits (490), Expect = 3e-51
 Identities = 142/387 (36%), Positives = 190/387 (49%), Gaps = 15/387 (3%)

Query: 28  AEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWL 87
           +EV  +W + G F L +    D +G  M  LV+ +A+ V VYS  YM+ +    RFF +L
Sbjct: 70  SEVLFSWASAGTFNLEMGYRVDPIGATMLALVSTVAILVMVYSDGYMSHDKSYVRFFTYL 129

Query: 88  SFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXX 147
             F   M            ++ WE VG+ S++LIG  + +  A  AA KA ++ R     
Sbjct: 130 GLFTSSMLALILSPNLLEIYVFWELVGMCSYLLIGFWYEREDAANAAQKAFVVNRVXXXX 189

Query: 148 XXXXXXXXXXITGTTQLP----PFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                      T +             + D                   + KSAQ PL  
Sbjct: 190 XXXXXXXXXWATNSFDFQIVATKMAASISDGSIPHWAAIALCLLLFMGPMAKSAQFPLHV 249

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALV 263
           WLP+AM  PTP+SALIH+ATM AAGVFLV RL PL+   P    +V  +G  T  + A +
Sbjct: 250 WLPDAMEGPTPISALIHAATMVAAGVFLVARLEPLYSQVPDVQIIVAVIGTITCFLGASI 309

Query: 264 ATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALE 319
           A  Q DLK+ LA+ST+SQ                 FHL  HA FK+ LFL  G    A+E
Sbjct: 310 ALIQMDLKKGLAYSTISQLGYMMLAMGCGAPVAGMFHLITHAFFKAMLFLGSGSVIHAME 369

Query: 320 RATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV-SV 373
              G      +D+R +GGL K +P T              P L+G+WS++E+L +A  S 
Sbjct: 370 EVVGHDPTLAQDMRLMGGLRKTMPITGITFFIGCVAISGIPPLAGFWSKDEILSKAFDSY 429

Query: 374 HTAWGVFMLVLILLAGIYIGRAAMATF 400
              WGV +    L A  Y+ R    TF
Sbjct: 430 PLLWGVGLFTAGLTA-FYMFRLYFLTF 455


>NU5M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 670

 Score =  191 bits (484), Expect = 2e-50
 Identities = 124/379 (32%), Positives = 178/379 (46%), Gaps = 12/379 (3%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W +   F+ +     D L   M  +V +I+  V +YS+ YM+++    RF  +LS F   
Sbjct: 64  WISSEMFDASWGFVFDSLTVVMLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLSIFTFF 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVGLAS++LI     + +A +AA KA+L+ R           
Sbjct: 124 MPMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGIL 183

Query: 154 XXXXITGTTQLPPFFQQVE-------DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLP 206
               +  T      F                               +GKSAQ+ L  WLP
Sbjct: 184 GCFTLFQTVDFSTIFACASAPRNSWISCNMRLNAITLICILLLIGAVGKSAQIGLHTWLP 243

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTPVSALIH+ATM  AGVF++ R  PLFE++P AL V+ + GA T+ +AA     
Sbjct: 244 DAMEGPTPVSALIHAATMVTAGVFMIARCSPLFEYSPTALIVITFAGAMTSFLAATTGIL 303

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TGTR 325
           Q DLKR++A+ST SQ                 FHL  HA FK+ LFLS G++  A +  +
Sbjct: 304 QNDLKRVIAYSTCSQLGYMIFACGISNYSVSVFHLMNHAFFKALLFLSAGSVIHAMSDEQ 363

Query: 326 DLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFML--- 382
           D+R++GGL    P+T              P L+G++S++ +L  A + +T  G F     
Sbjct: 364 DMRKMGGLASSFPFTYAMMLMGSLSLIGFPFLTGFYSKDVILELAYTKYTISGNFAFWLG 423

Query: 383 -VLILLAGIYIGRAAMATF 400
            V +L    Y  R    TF
Sbjct: 424 SVSVLFTSYYSFRLLFLTF 442


>NU5C_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 5;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 5;
          Length = 681

 Score =  189 bits (481), Expect = 4e-50
 Identities = 134/349 (38%), Positives = 184/349 (52%), Gaps = 13/349 (3%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           + W + G F L +    D L   M  +V  +AL V +Y+  YMA + G  RF+A+LS F 
Sbjct: 73  IEWASAGSFHLEMGYVIDHLSALMLVIVTSVALLVMIYTDGYMAHDPGYVRFYAYLSLFA 132

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
             M            +I WE VG+ S++LIG  + +  A  A  KA +  R         
Sbjct: 133 SSMLGLVISPNLVQVYIFWELVGMCSYLLIGFWYDRKAAADACQKAFVTNRVGDFXXXXX 192

Query: 152 XXXXXXITGTTQLPPFFQQVE----DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPE 207
                  TG+       +++E                        + KSAQ PL  WLP+
Sbjct: 193 XXXXYWATGSFDFGTIGERLEGLVSSGVLSGXXXXXXXXXVFLGPVAKSAQFPLHVWLPD 252

Query: 208 AMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQ 267
           AM  PTP+SALIH+ATM AAGVFLV R++P+FE  P+ +  + + G FTA + A +A  Q
Sbjct: 253 AMEGPTPISALIHAATMVAAGVFLVARMYPVFEPIPVVMNTIAFTGCFTAFLGATIALTQ 312

Query: 268 YDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA----LERATG 323
            D+K+ LA+ST+SQ                 FHL  HA FK+ LFL  G+    +E   G
Sbjct: 313 NDIKKGLAYSTISQLGYMVMAMGIGAYSAGLFHLMTHAYFKAMLFLCSGSVIHGMEGVVG 372

Query: 324 -----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
                 +D+R +GGL K +P T              P  +G+WS++E+L
Sbjct: 373 HDPILAQDMRIMGGLRKYMPITATCFLIGTLAICGIPPFAGFWSKDEIL 421


>NU5M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 670

 Score =  189 bits (479), Expect = 6e-50
 Identities = 125/379 (32%), Positives = 177/379 (46%), Gaps = 12/379 (3%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W +   F+ +     D L   M  +V +I+  V +YS+ YM+++    RF  +LS F   
Sbjct: 64  WISSEMFDASWGFLFDSLTVVMLIVVTFISSLVHLYSISYMSEDPHSPRFMCYLSIFTFF 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVGLAS++LI     + +A +AA KA+L+ R           
Sbjct: 124 MLMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGIF 183

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI-------GKSAQLPLTAWLP 206
               +  T      F                        I       GKSAQ+ L  WLP
Sbjct: 184 GCFTLFQTVDFSTIFACASAPRNEWIFCNMRLNAITLICILLFIGAVGKSAQIGLHTWLP 243

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTPVSALIH+ATM  AGVF++ R  PLFE++P AL V+ + GA T+ +AA     
Sbjct: 244 DAMEGPTPVSALIHAATMVTAGVFMIARCSPLFEYSPTALIVITFAGAMTSFLAATTGIL 303

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TGTR 325
           Q DLKR++A+ST SQ                 FHL  HA FK+ LFLS G++  A +  +
Sbjct: 304 QNDLKRVIAYSTCSQLGYMIFACGISNYSVSVFHLMNHAFFKALLFLSAGSVIHAMSDEQ 363

Query: 326 DLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFML--- 382
           D+R++GGL    P T              P L+G++S++ +L  A + +T  G F     
Sbjct: 364 DMRKMGGLASSFPLTYAMMLMGSLSLIGFPFLTGFYSKDVILELAYTKYTISGNFAFWLG 423

Query: 383 -VLILLAGIYIGRAAMATF 400
            V +L    Y  R    TF
Sbjct: 424 SVSVLFTSYYSFRLLFLTF 442


>NUOL_RICFE RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 645

 Score =  188 bits (478), Expect = 8e-50
 Identities = 129/405 (31%), Positives = 187/405 (46%), Gaps = 12/405 (2%)

Query: 8   LAVGGIFISALAVLPL---SGADAEVA----LTWFTVGPFELTVSLAADRLGWWMATLVA 60
           +A G + +SAL  L +   +G D  +     L W  VG F++  S+  D+L   M   V 
Sbjct: 35  IATGFLSLSALFSLVIFCDAGLDGNIIHIKLLPWIEVGNFKVNWSIYIDQLTSIMFIAVT 94

Query: 61  WIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVL 120
           W++  V +YS+ YMA++ G  R                        F  WEGVG+ S++L
Sbjct: 95  WVSSVVHIYSLGYMAEDKGIIRXXXXXXXXXXXXXXXVSADNFLQLFFGWEGVGVCSYLL 154

Query: 121 IGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVE-----DXX 175
           IG  + +  A +AA KA +  R                 G+      F   E        
Sbjct: 155 IGFWYSKESANKAAIKAFITNRASDFAFILGIITIIVYCGSANYKDVFSSAELLSNTKIF 214

Query: 176 XXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL 235
                            +GKSAQ+ L  WLP+AM  PTPVSALIH+ATM  AGVFLV R 
Sbjct: 215 LQFSILDVICLLLFIGCMGKSAQIGLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARC 274

Query: 236 FPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXX 295
             LFE++PL L  +  +G  T L AA +A  Q D+K+++A+ST SQ              
Sbjct: 275 SYLFEYSPLVLQFITIIGGVTCLFAASIAIMQSDIKKIIAYSTCSQLGYMFMACGVSAYN 334

Query: 296 XXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
              FHL  HA FK+ LFLS G++  A   +D+ ++G L  ++P T               
Sbjct: 335 SGIFHLVTHAFFKALLFLSAGSIIHAVHEQDIFKMGDLRNKMPVTYGNSLIGSLALIGIY 394

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+G++S++ +L  A S  +   +F +   +L  IY  +  M  F
Sbjct: 395 PLAGFYSKDSILEAAYSSGSFMFIFGIAAAILTAIYSMKIIMLVF 439


>NQO12_THET8 RecName: Full=NADH-quinone oxidoreductase subunit 12;  
                 EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           chain 12;AltName: Full=NDH-1 subunit 12;
          Length = 606

 Score =  188 bits (478), Expect = 8e-50
 Identities = 148/370 (40%), Positives = 196/370 (52%), Gaps = 6/370 (1%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W    PF    SL  D L  +M  +V  +   + VY++ YM  + G  RFFA+ + F+ M
Sbjct: 59  WLPGIPF----SLLLDNLSGFMLLIVTGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAM 114

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVGLASF+LIG  +   +   +A KA ++ R           
Sbjct: 115 MLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFIVNRIGDLGFMLGMA 174

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
               + GT  +    + +E                      KSAQ+PL  WLP+AMA PT
Sbjct: 175 ILWALYGTLSISELKEAMEGPLKNPDXXXXXXXXXXXXXXXKSAQIPLMVWLPDAMAGPT 234

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSALIH+ATM  AGV+L+ R   L+   P     +  VG  TA   AL A  Q D+K++
Sbjct: 235 PVSALIHAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKI 294

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERAT-GTRDLRQLGG 332
           +A+ST+SQ                 FH+  HA FK+ LFL+ G++  A  G +D+R++GG
Sbjct: 295 VAYSTISQLGYMFLAAGVGAYWVALFHVFTHAFFKALLFLASGSVIHALGGEQDVRKMGG 354

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYI 392
           L K LP T                 SG+WS++ +L  A   +   GV   V  LL  +  
Sbjct: 355 LWKHLPQTRWHXXXXXXXXXXXXXXSGFWSKDAIL-AATLTYPFGGVGFYVGALLVAVLT 413

Query: 393 GRAAMATFGL 402
              AM  F L
Sbjct: 414 AMYAMRWFVL 423


>NU5M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 669

 Score =  185 bits (470), Expect = 7e-49
 Identities = 125/379 (32%), Positives = 175/379 (46%), Gaps = 12/379 (3%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W +   F+ +     D L   M  +V  I+  V +YS+ YM+++    RF  +LS F   
Sbjct: 64  WISSEMFDASWGFLFDSLTVVMLIVVTSISSLVHLYSISYMSEDPHSPRFMCYLSIFTFF 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVGLAS++LI     + +A +AA KA+L+ R           
Sbjct: 124 MLMLVTGDNFLQLFLGWEGVGLASYLLIHFWFTRLQADKAAIKAMLVNRVGDFGLALGIL 183

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI-------GKSAQLPLTAWLP 206
               +  T      F                        I       GKSAQ+ L  WLP
Sbjct: 184 GCFTLFQTVDFSTIFACASVPRNSWIFCNMRLNAISLICILLFIGAVGKSAQIGLHTWLP 243

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTPVSALIH+ATM  AGVF++ R  PLFE++P AL V+   GA T+ +AA     
Sbjct: 244 DAMEGPTPVSALIHAATMVTAGVFMIARCSPLFEYSPTALIVITSAGAMTSFLAATTGIL 303

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TGTR 325
           Q DLKR++A+ST SQ                 FHL  HA FK+ LFLS G++  A +  +
Sbjct: 304 QNDLKRVIAYSTCSQLGYMIFACGISNYSVSVFHLMNHAFFKALLFLSAGSVIHAMSDEQ 363

Query: 326 DLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFML--- 382
           D+R++GGL    P T              P L+G++S++ +L  A + +T  G F     
Sbjct: 364 DMRKMGGLASSFPLTYAMMLIGSLSLIGFPFLTGFYSKDVILELAYTKYTISGNFAFWLG 423

Query: 383 -VLILLAGIYIGRAAMATF 400
            V +L    Y  R    TF
Sbjct: 424 SVSVLFTSYYSFRLLFLTF 442


>NU5C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 720

 Score =  185 bits (470), Expect = 7e-49
 Identities = 135/381 (35%), Positives = 185/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W      +  +    D L   M  L+  + + V +YS  YM+ + G  RFFA+LS F  
Sbjct: 74  SWIFDNKIDFKIGFLIDPLTSIMLVLITTVGVLVMIYSDSYMSYDQGYVRFFAYLSLFTA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVLSPNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVTNRXXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +    F++  D                       I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFEILFKRFNDLVINHEVNLYFANFCALLLFLGPIAKSAQFPLHIWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV R FPLF+  P  + ++ WVGA TA + A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARWFPLFQLLPFVMTIISWVGAITAFLGATIALAQT 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           DLK+ LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DLKKGLAYSTMSQLGYMMLALGIGSYQAGLFHLITHAYSKALLFLGSGSVIHSVESIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P T              P  + +WS++E++  +    +  G 
Sbjct: 374 SPNKCQNMAFMGGLRKYMPITGITFLLGTFSLCGIPPFACFWSKDEIITDSWLYSSTLGS 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
             LV   L   Y+ R    TF
Sbjct: 434 ISLVTAGLTAFYMFRIYFLTF 454


>NU5M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 669

 Score =  185 bits (469), Expect = 9e-49
 Identities = 114/324 (35%), Positives = 159/324 (49%), Gaps = 11/324 (3%)

Query: 68  VYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQ 127
           +YS+ YM+++    RFF +LS F   M            F+ WEGVGLAS++LI     +
Sbjct: 98  IYSISYMSEDPHSPRFFCYLSIFTFFMLMLVTGDNFIQLFLGWEGVGLASYLLINFWFTR 157

Query: 128 AKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXX 187
            +A +AA KA+L+ R               I  T      F                   
Sbjct: 158 IQANKAAIKAMLINRVGDFGLALGIMGCFTIFQTVDFSTIFACASAFSEPHHYFLFCNMG 217

Query: 188 XXXXXI----------GKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                +          GKSAQ+ L  WLP+AM  PTPVSALIH+ATM  AGVF++ R  P
Sbjct: 218 FHAITVICILVFIGAVGKSAQIGLHTWLPDAMEGPTPVSALIHAATMVTAGVFMIARCSP 277

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
           LFE++P AL V+ +VGA T+  AA     Q DLKR++A+ST SQ                
Sbjct: 278 LFEYSPNALIVITFVGAMTSFFAATTGILQNDLKRVIAYSTCSQLGYMIFACGISNYSVS 337

Query: 298 XFHLTVHATFKSALFLSVGALERA-TGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
            FHL  HA FK+ LFLS G++  A +  +D+R++GGL   LP+T              P 
Sbjct: 338 VFHLMNHACFKALLFLSAGSVIHAMSDEQDMRKMGGLASLLPFTYAMMLIGSLSLIGFPF 397

Query: 357 LSGYWSEEELLRQAVSVHTAWGVF 380
           L+G++S++ +L  A + +T  G F
Sbjct: 398 LTGFYSKDVILELAYTKYTISGNF 421


>NU5C_SPIOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 742

 Score =  182 bits (463), Expect = 5e-48
 Identities = 147/407 (36%), Positives = 208/407 (51%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPL-SGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   LA+  + S +  +   +W     F L      D L   M+ L+  +A+ V
Sbjct: 48  LSIVMIFSMKLAIQQINSNSIYQYLWSWTINNDFSLEFGYLMDPLTSIMSMLITTVAILV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     +++         
Sbjct: 168 RPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIFNNLIKNNEVNSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + V+ ++G  T L+ A +A AQ D+KR LA+ T+SQ                 FHL 
Sbjct: 288 PYIMYVISFIGIITVLLGATLALAQKDIKRSLAYYTMSQLGYMMLALGMGSYRTALFHLI 347

Query: 303 VHATFKSALFLSVGALERATGT---------RDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL+ G+L  + GT         +++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLASGSLIHSMGTIVGYSPDKSQNMVLMGGLTKHVPITKTSFLIGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWVYSPIFAIIAYFTAGLTAFYMFRIYLLTF 454


>NUOL_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 615

 Score =  182 bits (462), Expect = 6e-48
 Identities = 157/412 (38%), Positives = 210/412 (50%), Gaps = 14/412 (3%)

Query: 8   LAVGGIFISALAVL----------PLSGADAEVALTWFTVGPFELTVSLAADRLGWWMAT 57
           + VG + +SAL+            P  GA + V   W   G F    +L  D L   M  
Sbjct: 33  VGVGSVGLSALSAAWAIFSFHSSPPEGGAYSLVLWQWMAAGDFSTNFTLYLDGLSVTMLG 92

Query: 58  LVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLAS 117
           +V  +   + +++  YM  E G  RFFA+ + F+  M               WEGVGL S
Sbjct: 93  VVTGVGFLIHLFASWYMRGETGYSRFFAYTNLFIASMXXXXXXXXXXXXXXGWEGVGLCS 152

Query: 118 FVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQV-EDXXX 176
           ++LIG ++       AA KA ++TR                 GT  +        +    
Sbjct: 153 YLLIGFYYSNRNNGNAALKAFIVTRVGDVFMAFGLFILFQQFGTLNIQELLVLAPQKFPE 212

Query: 177 XXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLF 236
                           +GKSAQLPL  WL +AMA PTPVSALIH+ATM  AGV+L+ R  
Sbjct: 213 GNLWXXXXXXXXXXXXVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARCH 272

Query: 237 PLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXX 296
            LF  AP  L +V  VGA T ++A   A  Q D+KR+LA+ST+SQ               
Sbjct: 273 GLFTLAPDILELVGIVGAVTLVLAGFAALVQTDIKRILAYSTMSQIGYMFLALGVGAWDA 332

Query: 297 XXFHLTVHATFKSALFLSVGALERAT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
             FHL  HA FK+ LFL+ GA+  A    +++ ++GGL K+LP                P
Sbjct: 333 AIFHLMTHAFFKALLFLASGAVIVACHHEQNIFKMGGLWKKLPLAYASFVVGGAALAALP 392

Query: 356 LL-SGYWSEEELLRQA-VSVHTAWGVFMLVLILLAGIYIGRAAMATFGLAPQ 405
            L +G++S++E+L +A  S H    +  LV   L  IY  R     F   P+
Sbjct: 393 FLTAGFYSKDEILWEAFASGHRELLIAGLVGAFLTSIYTFRLIFVAFHGEPK 444


>NU5M_DICDI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 670

 Score =  182 bits (461), Expect = 8e-48
 Identities = 134/386 (34%), Positives = 195/386 (50%), Gaps = 13/386 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           TW  VG   +   L  D L   M  ++  I+  V +YS+ YM ++  + RFF++LS F  
Sbjct: 63  TWMQVGSLNVEYGLLYDSLTSIMIIVITCISSMVHLYSMDYMKEDPHKTRFFSYLSLFTF 122

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            F  WEGVG+ S++LI   + + +A ++A KA+++ R          
Sbjct: 123 FMMLLVTADNFVQLFFGWEGVGIMSYLLINFWYTRLQANKSALKAVILNRXXXXXXXXXX 182

Query: 153 XXXXXITGTTQ------LPPFFQQ--VEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAW 204
                   +        + PF  +  +                     +GKSAQL L  W
Sbjct: 183 XXXXXXXKSVDFSVIFTIAPFITEYTINLLGYEVNAITLIGSFIVIGVVGKSAQLGLHMW 242

Query: 205 LPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVA 264
           LP+AM  PTPVSAL+H+ATM  AGVFLVLR  PL  ++   L ++  +GA T L A  + 
Sbjct: 243 LPDAMEGPTPVSALLHAATMVTAGVFLVLRTSPLLSYSITILNILTIIGALTTLFATTIG 302

Query: 265 TAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATG 323
             Q D+KR++A+ST SQ                 +HLT HA FK+ LFLS G+ +     
Sbjct: 303 IVQNDIKRVIAYSTCSQLGYMIFACGLLNYNASIYHLTTHAFFKALLFLSAGSVIHGLND 362

Query: 324 TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLV 383
            +D+R++GGL   +P T              P LSGY+S++ +L  + + +   G F  +
Sbjct: 363 EQDMRKMGGLVNLMPLTYQCMLIGTLALTGFPFLSGYYSKDIILETSYATYYWEGTFAAI 422

Query: 384 LILLAG----IYIGRAAMATFGLAPQ 405
           +  +A      Y  R  + TF   P+
Sbjct: 423 IGYVAAFGTTFYSFRLLILTFFNKPR 448


>NUOL_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 613

 Score =  181 bits (459), Expect = 1e-47
 Identities = 126/375 (33%), Positives = 179/375 (47%), Gaps = 10/375 (2%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           TW +VG F +  +L  D L   M ++V  +   + +Y+  YM  E G  RFFA+ + F+ 
Sbjct: 66  TWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYTNLFIA 125

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            ++ WEGVGL S++LIG ++   K   AA KA ++TR          
Sbjct: 126 SMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFAL 185

Query: 153 XXXXXITGTTQLPPFFQQVE----DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                  GT     F + VE                        +GKSAQLPL  WL +A
Sbjct: 186 FILYNELGTLN---FREMVELAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLADA 242

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           MA PTPVSALIH+ATM  AGV+L+ R   LF   P  L +V  VGA T L+A   A  Q 
Sbjct: 243 MAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVLHLVGIVGAVTLLLAGFAALVQT 302

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERAT-GTRDL 327
           D+KR+LA+ST+SQ                 FHL  HA FK+ LFL+ G++  A    +++
Sbjct: 303 DIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASGSVILACHHEQNI 362

Query: 328 RQLGGLGKRLPWTXXXXXXXXXXXXXXPLL-SGYWSEEELLRQAV-SVHTAWGVFMLVLI 385
            ++GGL K +P                PL+ +G++S++E+L  A+ + H    V  LV  
Sbjct: 363 FKMGGLRKSIPLVYLCFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLVGA 422

Query: 386 LLAGIYIGRAAMATF 400
            +  +Y  R     F
Sbjct: 423 FMTSLYTFRMIFIVF 437


>NU5M_RABIT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  180 bits (457), Expect = 2e-47
 Identities = 119/380 (31%), Positives = 174/380 (45%), Gaps = 11/380 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +LT S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WMTIHTLKLTTSFKLDYFSMLFTPIALFVTWSIMEFSMWYMHSDPKINQFFKYLLMFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  HG+  A  AA +A+L  R           
Sbjct: 128 MLILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAILYNRIGDIGFIMALA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T +L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFAINLNTWELQQIF------ILDNNITILPLMGLILAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R +PL E+   A  ++L +GA T L  AL A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFYPLLENNKTAQTLILCLGAITTLFTALCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWG-VFMLVLILLAGI 390
           L K +P+T              P L+G++S++ ++  A + +T AW  +  L+   L  +
Sbjct: 362 LYKTMPFTASALTIGSLALTGMPFLTGFYSKDLIIESANTSNTNAWALIITLIATSLTAV 421

Query: 391 YIGRAAMATFGLAPQAVMPA 410
           Y  R  +  F L  Q   PA
Sbjct: 422 YSTR--IIFFALLGQPRYPA 439


>NU5M_DICCI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 668

 Score =  180 bits (457), Expect = 2e-47
 Identities = 142/421 (33%), Positives = 209/421 (49%), Gaps = 26/421 (6%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL----------TWFTVGPFELTVSLAADRLGWWMAT 57
           +AVG + ++AL+ L +     E+ L          TW  VG   +   L  D L   M  
Sbjct: 31  IAVGCMMLTALSSLYIG---YEILLCNSVVHFKLSTWMQVGSLNVEYGLLYDSLTSIMII 87

Query: 58  LVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLAS 117
           ++  I+  V +YS+ YM  +  + RFF++LS F   M            F  WEGVG+ S
Sbjct: 88  VITCISSMVHLYSMDYMKADPHKTRFFSYLSLFTFFMMLLVTADNFVQLFFGWEGVGIMS 147

Query: 118 FVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQ------LPPFFQQ- 170
           ++LI   + + +A ++A KA+++ R                  +        + PF  + 
Sbjct: 148 YLLINFWYTRLQANKSALKAVILNRXXXXXXXXXXXXXXXXXKSVDFSVIFTVAPFITEY 207

Query: 171 -VEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGV 229
            +                     +GKSAQL L  WLP+AM  PTPVSAL+H+ATM  AGV
Sbjct: 208 TINLLGYEVNAITLIGSFIVIGVVGKSAQLGLHMWLPDAMEGPTPVSALLHAATMVTAGV 267

Query: 230 FLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXX 289
           FLVLR  PL  ++   L ++  +GA T L A  +   Q D+KR++A+ST SQ        
Sbjct: 268 FLVLRTSPLLSYSITILNILTIIGALTTLFATTIGIVQNDIKRVIAYSTCSQLGYMIFAC 327

Query: 290 XXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXX 348
                    +HLT HA FK+ LFLS G+ +      +D+R++GGL   +P T        
Sbjct: 328 GLLNYNASIYHLTTHAFFKALLFLSAGSVIHGLNDEQDMRKMGGLVNLMPLTYQCMLIGT 387

Query: 349 XXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAG----IYIGRAAMATFGLAP 404
                 P LSGY+S++ +L  + + +   G F  ++  +A      Y  R  + TF   P
Sbjct: 388 LALTGFPFLSGYYSKDIILETSYATYYWEGTFAAIIGYVAAFGTTFYSFRLLILTFFNKP 447

Query: 405 Q 405
           +
Sbjct: 448 R 448


>NU5C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 670

 Score =  179 bits (455), Expect = 4e-47
 Identities = 162/384 (42%), Positives = 215/384 (55%), Gaps = 21/384 (5%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W +     L +    D L   M  LV  +A+ V +YS  YM  + G  RFFA+LS F   
Sbjct: 75  WLSTKNLTLDIGYLIDPLTSIMLVLVTSVAVTVMIYSDGYMLHDQGYIRFFAYLSLFTAS 134

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            ++ WE +G+ S++L+G    +  A  A  KA +  R           
Sbjct: 135 MLGLIVSPNLIQVYVFWELIGMCSYLLVGFWSTRPTAASACQKAFITNRVXXXXXXXXXX 194

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX--------IGKSAQLPLTAWL 205
               +TG+ Q    F  ++D                           I KSAQ PL  WL
Sbjct: 195 XXYWLTGSFQ----FDIIQDRXXXXXXXXXXXXXXXIISSVLLFLGPIAKSAQFPLHIWL 250

Query: 206 PEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVAT 265
           P+AM  PTP+SALIH+ATM AAG+FLV RL P+F+ +PL + ++ + GA TAL+ A +A 
Sbjct: 251 PDAMEGPTPISALIHAATMVAAGIFLVARLLPIFQLSPLLMILIAFTGAITALLGACLAV 310

Query: 266 AQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERA 321
           AQ DLKR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E  
Sbjct: 311 AQTDLKRGLAYSTMSQXXXXXXXXXXXXXQAAIFHLITHAYSKALLFLGSGSVIHSMEPV 370

Query: 322 TG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTA 376
            G     ++++  +GGL K +P T              P  + +WS++E++  A      
Sbjct: 371 VGYDPNKSQNIDYMGGLRKYMPITGVTFLIGTLSLCGIPPFACFWSKDEIIADAFFHLPL 430

Query: 377 WGVFMLVLILLAGIYIGRAAMATF 400
            G    +   L G Y+ R  + TF
Sbjct: 431 LGFIAWLTAGLTGFYMFRLYLLTF 454


>NU5C_SOLTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  179 bits (453), Expect = 7e-47
 Identities = 135/407 (33%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YMA + G  RFFA++SFF   M            +I WE VGL S++LIG    
Sbjct: 108 LIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFRVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMYLISVIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVGALERATGT---------RDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G++  +  T         +++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMETIVGYSPAKSQNMGLMGGLRKHVPITKITFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTF 454


>NU5C_SOLLC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 737

 Score =  179 bits (453), Expect = 7e-47
 Identities = 135/407 (33%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YMA + G  RFFA++SFF   M            +I WE VGL S++LIG    
Sbjct: 108 LIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNELNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFRVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMYLISVIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVGALERATGT---------RDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G++  +  T         +++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMETIVGYSPAKSQNMGLMGGLRKHVPITKITFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTF 454


>NU5C_SOLBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  179 bits (453), Expect = 7e-47
 Identities = 135/407 (33%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YMA + G  RFFA++SFF   M            +I WE VGL S++LIG    
Sbjct: 108 LIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAVSKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFRVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMYLISVIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVGALERATGT---------RDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G++  +  T         +++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMETIVGYSPAKSQNMGLMGGLRKHVPITKITFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTF 454


>NU5M_HIPAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 594

 Score =  178 bits (452), Expect = 9e-47
 Identities = 115/386 (29%), Positives = 178/386 (46%), Gaps = 12/386 (3%)

Query: 15  ISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSV 71
           IS + ++  +    E+ ++   W T+   +LT+S  AD      A +  ++   +  +S+
Sbjct: 46  ISLVPMIAFTNTGQEMIISNWHWITIQTLKLTLSFKADYFSIVFAPVALFVTWSIMEFSM 105

Query: 72  PYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKAR 131
            YM  +    +FF +L  F+  M            FI WEGVG+ SF+LIG  HG+  A 
Sbjct: 106 WYMHSDPHINQFFKYLLLFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDAN 165

Query: 132 QAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXX 191
            AA +A+L  R                  T  +   F                       
Sbjct: 166 TAAIQAILYNRIGDVGFIMAMAWFLSNLNTWDMQQIFM------INPTHSNLPLMGLILA 219

Query: 192 XIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW 251
             GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AGVFL++R +P+ E+  L   + + 
Sbjct: 220 ATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIRFYPMMENNNLMQTITMC 279

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           +GA T L  A+ A  Q D+K+++A+ST SQ                  H+  HA FK+ L
Sbjct: 280 LGAITTLFTAMCALTQNDIKKIIAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAML 339

Query: 312 FLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           F+  G+ +      +D+R++GGL K +P+T              P L+G++S++ ++  A
Sbjct: 340 FMCSGSIIHNLNNEQDIRKMGGLFKTMPFTTTTLIVGSMALTGVPFLTGFYSKDLIIEAA 399

Query: 371 -VSVHTAWGVFM-LVLILLAGIYIGR 394
             S   AW + + LV   L  +Y  R
Sbjct: 400 NTSYSNAWALLITLVATSLTAVYSTR 425


>NU5C_PIPCE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  178 bits (452), Expect = 9e-47
 Identities = 143/381 (37%), Positives = 194/381 (50%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M  L+  + + V +YS  YM+ + G  RFFA+L+FF  
Sbjct: 74  SWTINNDFSLEFGYLIDSLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFAYLNFFNA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVTNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     V +                   I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFEIFNILVHNNTINXXXXXXXXXXXXXGAIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RLFPLF + P  +  +  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLFPLFINLPYIMYFISLIGIITVLLGATLALAQR 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRSLAYSTMSQLGYIMLAMGIGSYRAALFHLITHAYSKALLFLGSGSIIHSMEPIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMVLMGGLTKYVPITKTTFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAYSTAGLTAFYMFRVYLLTF 454


>NU5C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 710

 Score =  178 bits (452), Expect = 9e-47
 Identities = 134/386 (34%), Positives = 184/386 (47%), Gaps = 18/386 (4%)

Query: 25  GADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFF 84
           G+  +   +W     F L      D L   M+ LV  + + V +YS  YMA + G  RFF
Sbjct: 66  GSIYQYVWSWIINNDFSLEFGYLIDPLTSIMSILVTTVGILVLIYSDNYMAHDQGYLRFF 125

Query: 85  AWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXX 144
            ++SFF   M            +I WE VGL S++LIG    +  A  A  KA +  R  
Sbjct: 126 TYMSFFCAAMLGLVTSSNFIQIYIFWELVGLCSYLLIGFWFTRPGAANACQKAFVTNRVX 185

Query: 145 XXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLP 200
                        ITG+ +    FQ     +                     I KSAQ P
Sbjct: 186 XXXXXXXXXXXYWITGSFEFRELFQILNNLISSKEVNLLFVTLCAALLFVGAIAKSAQFP 245

Query: 201 LTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIA 260
           L  WLP+AM  PTP+SALIH+AT+ AAG+FLV RL PLF   P  +  +  +G  T L+ 
Sbjct: 246 LHVWLPDAMEGPTPISALIHAATLVAAGIFLVARLLPLFLVIPYIMYFISLIGIITVLLG 305

Query: 261 ALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALER 320
           A +A AQ D+KR LA+ST+SQ                 FHL  HA  K+ LFL+ G++  
Sbjct: 306 ATLALAQQDIKRGLAYSTMSQLGYMMVALGMGSYRSALFHLITHAYSKALLFLAAGSVIH 365

Query: 321 ATGT---------RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA- 370
           +  T         +++  +GGL K +P T              P L+ +WS++E+L  + 
Sbjct: 366 SMETIIGYSPEKSQNMVIMGGLTKHVPITKGAFLLGTLSLCGIPPLACFWSKDEILNDSW 425

Query: 371 ----VSVHTAWGVFMLVLILLAGIYI 392
               +    AWG   L    +  IY+
Sbjct: 426 LYSPIFALIAWGTVGLTAFYMFRIYL 451


>NU5M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 600

 Score =  177 bits (450), Expect = 1e-46
 Identities = 127/361 (35%), Positives = 171/361 (47%), Gaps = 11/361 (3%)

Query: 46  LAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXX 105
           L  D L   M  +V  I+  V ++S  YM  +    RF ++LS F   M           
Sbjct: 76  LQFDSLTAVMLIVVTSISTLVHIFSTAYMDGDPHVPRFMSYLSLFTFFMILLVTSDNYPQ 135

Query: 106 XFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLP 165
            FI WEGVGL S++LI     + +A +AA KA+L+ R                 G     
Sbjct: 136 LFIGWEGVGLCSYLLINFWLTRIEANKAAIKAMLVNRVGDIGFVLAMLAIWDQFGCLDFA 195

Query: 166 PFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMA 225
             F  V                     +GKSAQL L  WLP+AM  PTPVSALIH+ATM 
Sbjct: 196 SVFNIVA--LAPSDNTTLICLFLFIGAVGKSAQLGLHTWLPDAMEGPTPVSALIHAATMV 253

Query: 226 AAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXX 285
            AGVFL++R  PL E AP+AL VV  VG+ TA +AA +   Q DLK+++A+ST SQ    
Sbjct: 254 TAGVFLLIRSSPLLEQAPMALMVVTIVGSLTAFMAATIGLVQNDLKKVIAYSTCSQLGYM 313

Query: 286 XXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TGTRDLRQLGGLGKRLPWTXXXX 344
                        FHL  HA FK+ LFLS G++  A    +D+R++GGL + +P+T    
Sbjct: 314 VMACGLSQYSISLFHLMNHAFFKALLFLSAGSVIHALADEQDMRKMGGLIRSIPFTYTMI 373

Query: 345 XXXXXXXXXXPLLSGYWSEEELLRQAVSVH----TAW-GVFMLVLILLAGIYIGRAAMAT 399
                     P L+G++S++ +L  A   +      W GVF     LL   Y  R    T
Sbjct: 374 VIGSLSLMGFPYLTGFYSKDLILELAYDQYYLAFAHWLGVFS---ALLTAAYSLRLIYLT 430

Query: 400 F 400
           F
Sbjct: 431 F 431


>NU5M_HALGR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 609

 Score =  177 bits (450), Expect = 1e-46
 Identities = 111/353 (31%), Positives = 163/353 (46%), Gaps = 8/353 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +LT+S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 71  WMTIQTMKLTLSFKLDHFSMIFVPVALFVTWSIMEFSMWYMHSDPFINRFFKYLLMFLIT 130

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  HG+  A  AA +A+L  R           
Sbjct: 131 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAVLYNRIGDVGFIMAMA 190

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T +L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 191 WFLINLNTWELQQIF------ISHHNNLNVPLMGLLLAATGKSAQFGLHPWLPSAMEGPT 244

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL EH  +     L +GA T L  A+ A  Q D+K++
Sbjct: 245 PVSALLHSSTMVVAGVFLLIRFHPLMEHNTMMQTTTLCLGAITTLFTAICALTQNDIKKI 304

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 305 IAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLFLCSGSIIHNLNDEQDIRKMGG 364

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFMLVL 384
           L K LP+T              P L+G++S++ ++  A + +T AW + + ++
Sbjct: 365 LYKVLPFTTTSLIVGSLALTGMPFLTGFYSKDLIIETANTSYTNAWALLLTLV 417


>NU5C_PLAOC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 748

 Score =  177 bits (450), Expect = 1e-46
 Identities = 134/407 (32%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF + L++  L+G+   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSADLSIQQLNGSSIYQYVWSWTINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            VYS  YM+ + G  RFFA++SF    M            +I WE VG+ S++LIG    
Sbjct: 108 LVYSDNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNRVNSLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RLFPLF   
Sbjct: 228 LCASLLFVGAVAKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGIFLVARLFPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISLIGIITVLLGATLALAQKDIKRSLAYSTMSQLGYTMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K  P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMETVVGYSPEKSQNMALMGGLTKYAPITKTAFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIACSTAGLTAFYMFRMYLLTF 454


>NU5M_PHOVI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 609

 Score =  177 bits (449), Expect = 2e-46
 Identities = 127/369 (34%), Positives = 179/369 (48%), Gaps = 9/369 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +LT+S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 71  WMTIQTMKLTLSFKLDHFSMIFVPVALFVTWSIMEFSMWYMHSDPFINRFFKYLLMFLIT 130

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  HG+  A  AA +A+L  R           
Sbjct: 131 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAVLYNRIGDVGFIMAMA 190

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T +L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 191 WFLINLNTWELQQIF------ISHHXXXXXXXXXXXXAATGKSAQFGLHPWLPSAMEGPT 244

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL EH  +     L +GA T L  A+ A  Q D+K++
Sbjct: 245 PVSALLHSSTMVVAGVFLLIRFHPLMEHNTMMQTTTLCLGAITTLFTAICALTQNDIKKI 304

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 305 IAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNDEQDIRKMGG 364

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K LP+T              P L+G++S++ ++  A + +T AW + + LV   +   
Sbjct: 365 LYKVLPFTTTSLIVGSLALTGMPFLTGFYSKDLIIETANTSYTNAWALLLTLVATSMTAA 424

Query: 391 YIGRAAMAT 399
           Y  R    T
Sbjct: 425 YSTRIMFFT 433


>NU5C_ATRBE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  177 bits (448), Expect = 3e-46
 Identities = 131/381 (34%), Positives = 182/381 (47%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YMA + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VGL S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +    F+   +                       + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFEIFNNLSSNNEVNFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFRVIPYIMYLISVIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGY 373

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPAKSQNMGLMGGLRKHVPITQITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWATAGLTAFYMFRIYLLTF 454


>NU5C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  176 bits (447), Expect = 3e-46
 Identities = 130/381 (34%), Positives = 183/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YMA + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VGL S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFEIFNNLIYNNEVDFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFRVIPYIMYLISVIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGY 373

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P +              P L+ +WS++E+L  +      + +
Sbjct: 374 SPAKSQNMGLMGGLRKHVPISKITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWATAGLTAFYMFRIYLLTF 454


>NU5C_TECST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 750

 Score =  176 bits (447), Expect = 3e-46
 Identities = 148/407 (36%), Positives = 208/407 (51%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF + L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFATNLSIQQINTSSIYQYVWSWTLDNDFSLEFGYLIDPLTSIMSMLITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YMA + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMAHDQGYLRFFAYMSFFSTSMFGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPPAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNSPFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL  LF   
Sbjct: 228 LCAALLFAGAVAKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGIFLVARLLTLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  L ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYILNIISLIGLITVLLGATLALAQKDIKRGLAYSTMSQLGYMILALGIGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETIVGYSPDKSQNMVLMGGLTKHVPITKXXXXXXXXXXXX 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTF 454


>NU5C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  176 bits (447), Expect = 3e-46
 Identities = 130/381 (34%), Positives = 183/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YMA + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLDFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VGL S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFEIFNNLIYNNEVDFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFRVIPYIMYLISVIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGY 373

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P +              P L+ +WS++E+L  +      + +
Sbjct: 374 SPAKSQNMGLMGGLRKHVPISKITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWATAGLTAFYMFRIYLLTF 454


>NU5C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 648

 Score =  176 bits (447), Expect = 3e-46
 Identities = 122/412 (29%), Positives = 181/412 (43%), Gaps = 19/412 (4%)

Query: 8   LAVGGI---FISALAVL--PLSG-ADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAW 61
           LA+G +   F+ +L VL   L G A     + W     F L +    D            
Sbjct: 43  LAIGAMALSFVVSLGVLWNQLHGIAPVRWIIEWMLTDTFRLEIGYWVDPXXXXXXXXXXX 102

Query: 62  IALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLI 121
                 +YS  YM  + G  RFF +LS F   M            +  WE VG+ S++L+
Sbjct: 103 XXXXXXIYSDEYMHVDEGYVRFFVYLSIFTTSMLGLVLSPNLVQVYGFWELVGMCSYLLV 162

Query: 122 GQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXX 181
           G    +  A +A+ KA +  R               +TG+ +      ++ D        
Sbjct: 163 GFWFTRPTAAEASQKAFITNRVGDFGLLLGILALYWMTGSFEFASIADRLGDLLIAIPSL 222

Query: 182 XXXXXXXXXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                          I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAGVFLV R+FP
Sbjct: 223 RTIACIACILVFMGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVFLVARMFP 282

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
           +F+  PL + ++ W G  TA + A +A  Q D+K+ LA+ST+SQ                
Sbjct: 283 VFDQLPLVMELIAWTGTLTAFLGATMALTQSDIKKGLAYSTMSQLGYMIMALGTGAYSEA 342

Query: 298 XFHLTVHATFKSALFLSVGA----LERATG-----TRDLRQLGGLGKRLPWTXXXXXXXX 348
            FHLT HA  K+ LFL+ G+    +E   G      +++ ++GGL K +P T        
Sbjct: 343 LFHLTTHAYSKALLFLAAGSVIHGMEPVVGFSPMQNQNMHRMGGLRKYMPLTAMTFLLGT 402

Query: 349 XXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
                 P L+ +WS++ +L +  + H    +   +   + G Y+ R    TF
Sbjct: 403 CSICGIPPLACFWSKDAILAEVFATHPTCWLIAWLTAGMTGFYMFRIYFLTF 454


>NU5C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 757

 Score =  176 bits (447), Expect = 3e-46
 Identities = 133/407 (32%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + L+V  + G+     L +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMVFSADLSVQQIDGSSIYQYLWSWTINNDFSLEFGHLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SF    M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDKYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KAL+  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAANACQKALVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIFNNLIHNNGVNSLFAT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCASLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISLIGVITVLLGATLALAQRDIKRSLAYSTMSQLGYIMLAPGIGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPDKSQNMVLMGGLRKYVPITKMTFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIACATAGLTAFYMFRTYLLTF 454


>NU5C_COFAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  176 bits (447), Expect = 3e-46
 Identities = 133/381 (34%), Positives = 183/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YMA +    RFFA++ FF  
Sbjct: 74  SWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQAYLRFFAYMGFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVTNRXXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + D                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFEIFNNLIYDNEVNSLFVTLCAGLVFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLIPLFIVIPYIMNFISLIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAFSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +    T + +
Sbjct: 374 SPYKSQNMVLMGGLTKHIPITKNTFLLGTLSLCGIPPLACFWSKDEILNDSWLYSTIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   YI R  + TF
Sbjct: 434 IAWATAGLTAFYIFRIYLLTF 454


>NU5C_ACOCL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  176 bits (447), Expect = 3e-46
 Identities = 143/407 (35%), Positives = 205/407 (50%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + LA+  ++G+   + + +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIAMVFSADLAIQQINGSFIYQYSWSWTINNTFSLEFGYLIDPLTSIMLILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPTAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEILKNLIHNNEVNXXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 XXXXXXXVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNFISLIGIITVLLGATLALAQRDIKRSLAYSTMSQLGYIMLAPGIGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL + +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPEKSQNMILMGGLRRYVPITKTTFFLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L         + +       L   Y+ R  + TF
Sbjct: 408 MPPLACFWSKDEILNDTWLYSPIFAIIAWSTAGLTAFYMFRVYLLTF 454


>NU5C_ACOAM RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  176 bits (447), Expect = 3e-46
 Identities = 143/407 (35%), Positives = 205/407 (50%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + LA+  ++G+   + + +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIAMVFSADLAIQQINGSFIYQYSWSWTINNTFSLEFGYLIDPLTSIMLILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPTAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEILKNLIHNNEVNXXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 XXXXXXXVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNFISLIGIITVLLGATLALAQRDIKRSLAYSTMSQLGYIMLAPGIGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL + +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPEKSQNMILMGGLRRYVPITKTTFFLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L         + +       L   Y+ R  + TF
Sbjct: 408 MPPLACFWSKDEILNDTWLYSPIFAIIAWSTAGLTAFYMFRVYLLTF 454


>NU5C_LACSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 742

 Score =  176 bits (445), Expect = 6e-46
 Identities = 133/381 (34%), Positives = 183/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M  L+  + + V +YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLEFGYLIDPLTSIMLILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A +A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    FQ     + +                   I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFQIFNNLISNNEVNFLFVTLCAILLFAGAIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +  +G  T  + A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLMPLFIVIPHIMNFISLIGIITVFLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETLVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K LP T              P L+ +WS++E+L  +      +G+
Sbjct: 374 CPKKSQNMVLMGGLTKHLPITKNSFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFGI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWSTAGLTAFYMCRIYLLTF 454


>NUOL_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 633

 Score =  175 bits (444), Expect = 7e-46
 Identities = 116/345 (33%), Positives = 161/345 (46%), Gaps = 5/345 (1%)

Query: 23  LSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQR 82
           L  A  +   TW   G  ++   L  D+L      L++ +   + +YSV YMA++  R+R
Sbjct: 63  LERAIHQQVFTWIPAGGLQVDFGLQIDQLSMCFVLLISGVGSLIHIYSVGYMAEDPDRRR 122

Query: 83  FFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTR 142
           FF +L+ F+  M            ++ WEGVGLAS++LIG  + +  A  AA KA +M R
Sbjct: 123 FFGYLNLFLASMLLLVVADNYVLLYVGWEGVGLASYLLIGFWYHKPSAATAAKKAFVMNR 182

Query: 143 XXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLT 202
                            GT      F  V                       KSAQ+PL 
Sbjct: 183 VGDAGLAVGMFLTFSTFGTLSYAGVFAGVP--AASRAVLTAIGLLMLLGACAKSAQVPLQ 240

Query: 203 AWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAAL 262
           AWL +AM  PTPVSALIH+ATM  AGV+L++R  PL+  AP A   V+ VGA T L  A+
Sbjct: 241 AWLGDAMEGPTPVSALIHAATMVTAGVYLIVRSGPLYNLAPTAQLAVVIVGAVTLLFGAI 300

Query: 263 VATAQYDLKRLLAWSTVSQ--XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALER 320
           +  A+ D+KR LA ST+SQ                    HL  H  FK+ LFL  GA+  
Sbjct: 301 IGCAKDDIKRALAASTISQIGYMVLAAGLGPAGYAFAIMHLLTHGFFKAGLFLGSGAVIH 360

Query: 321 AT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEE 364
           A    +D+R+ GGL   LP T              P  +G++S++
Sbjct: 361 AMHEEQDMRRYGGLRAALPVTFATFGLAYLAIIGVPPFAGFFSKD 405


>NU5C_CICIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  175 bits (444), Expect = 7e-46
 Identities = 132/381 (34%), Positives = 184/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A +A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGVCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    FQ     + +                   I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFSDLFQIFNNLISNNEVNFLFVTLCAILLFAGAIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +  +G  T  + A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLMPLFIVIPHIMNFISLIGIITVFLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETLVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +      +G+
Sbjct: 374 CPKKSQNMVLMGGLTKHVPITKNSFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFGI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWSTAGLTAFYMCRIYLLTF 454


>NU5C_CUCSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 748

 Score =  175 bits (443), Expect = 1e-45
 Identities = 127/381 (33%), Positives = 180/381 (47%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L +    D L   MA L+  + + V +YS  YM+ + G  RFFA++S F  
Sbjct: 74  SWTINNDFSLELGYFIDPLTCIMAILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSLFNT 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPTAANACQKAFVTNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                 TG+ +    FQ     +++                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWTTGSFEFRDLFQIFNNLIDNNEVNFLFLTLCAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  +G  T L  A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFIAIPYIMNLIALIGIITVLFGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRSLAYSTMSQLGYMMLALGMGSYQAALFHLITHAYSKALLFLGSGSIIHSMESVVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMVLMGGLTKHVPITKNAFLLGTLSLCGVPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IACSTAGLTAFYMFRIYLLTF 454


>NU5M_SORFM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  174 bits (441), Expect = 2e-45
 Identities = 123/387 (31%), Positives = 186/387 (48%), Gaps = 12/387 (3%)

Query: 14  FISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYS 70
           F S +  L    +  E  L+   W T+   +L+++   D        +  ++   +  +S
Sbjct: 45  FTSLIPTLIFINSGHEAILSNWHWMTIQTVKLSLNFKLDYFSMIFTPVALFVTWSIMEFS 104

Query: 71  VPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKA 130
           + YM  +    RFF +L  F+  M            FI WEGVG+ SF+LIG  +G+A A
Sbjct: 105 MWYMHSDPNMNRFFKYLLMFLITMMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADA 164

Query: 131 RQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXX 190
             AA +A+L  R                + + +L   F                      
Sbjct: 165 NTAALQAILYNRIGDIGFILAMAWFLFNSNSWELQQIFM------LDTNQNXXXXXXXXX 218

Query: 191 XXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVL 250
              GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++R +PL E       ++L
Sbjct: 219 AATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFYPLIETNKTMQTLIL 278

Query: 251 WVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSA 310
            +GA T L  A+ A  Q D+K+++A+ST SQ                  H+  HA FK+ 
Sbjct: 279 CMGAITTLFTAICALTQNDIKKIIAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAM 338

Query: 311 LFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           LF+  G+ +      +D+R++GGL   LP+T              P L+G++S++ ++  
Sbjct: 339 LFMCSGSIIHNLNDEQDIRKMGGLYNALPFTTTSLIVGSLALTGTPFLTGFYSKDLIIET 398

Query: 370 AVSVHT-AWGVFM-LVLILLAGIYIGR 394
           A + +T AW + M L+   L  +Y  R
Sbjct: 399 ANTSYTNAWALLMTLIATSLTAVYSTR 425


>NU5C_BRADI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  174 bits (441), Expect = 2e-45
 Identities = 152/407 (37%), Positives = 211/407 (51%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIAMVFSVQLSIQQINGSSIYQYLWSWTINNDFSLEFGYLIDPLTSIMLMLITTVGILV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 LIYSDGYMSHDEGYLRFFIYISFFNISMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQ----VEDXXXXXXXXX 182
           +  A  A  KA +  R                TG+ +    FQ     + +         
Sbjct: 168 RPIAASACQKAFVTNRXXXXXXXXXXXXXXXXTGSLEFRDLFQTANNWIPNNGXXXXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL +  +  VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMTFISLVGTITLFLGATLALAQRDIKRTLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPLVGYSPDKSQNMALMGGLRKYIPITRTAFLWGTLSICG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_ATHGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  174 bits (441), Expect = 2e-45
 Identities = 135/407 (33%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLMPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKNSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5C_AMBTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 743

 Score =  174 bits (441), Expect = 2e-45
 Identities = 135/407 (33%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLMPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T    A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNLISLIGIITVFFGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKNSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5C_ADEHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 744

 Score =  174 bits (440), Expect = 2e-45
 Identities = 135/407 (33%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRNLFQIFNNLISNNEVNLLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKTSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5M_PIG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
              EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  173 bits (439), Expect = 3e-45
 Identities = 114/370 (30%), Positives = 167/370 (45%), Gaps = 9/370 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   EL++S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 68  WMTLQTVELSLSFKMDYFSVMFIPVALFVTWSIMEFSMWYMHSDPFINRFFKYLVLFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  HG+  A  AA +A+L  R           
Sbjct: 128 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWHGRTDANTAALQAILYNRIGDIGFVLSMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                +    L   F    +                    GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLTHSNAWDLQQIFMLNNE------CPNMPLIGLLLAAAGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R +PL E   L   + L +GA T L  AL A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFYPLMETNKLVQTMTLCLGAITTLFTALCAITQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+ +HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTIGINQPHLAFLHICMHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGVFM-LVLILLAGI 390
           L K +P+T              P L+G++S++ ++    +S   AW + M L+   L   
Sbjct: 362 LYKAMPFTTTALIIGSLALTGMPYLTGFYSKDLIIEAVNMSYTNAWALLMTLIATSLTAA 421

Query: 391 YIGRAAMATF 400
           Y  R     F
Sbjct: 422 YSTRIIFFAF 431


>NU5M_CRYPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;
          Length = 656

 Score =  173 bits (439), Expect = 3e-45
 Identities = 138/359 (38%), Positives = 191/359 (53%), Gaps = 3/359 (0%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F +      D L   M   V  I+  V +YS+ YM+ +   QRFF++LS F  M
Sbjct: 64  WIDSEWFNIIWGFQFDSLTVSMLLPVLIISSLVHIYSISYMSGDPHNQRFFSYLSLFTFM 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVG+ S++L+     +  A Q++  A L  R           
Sbjct: 124 MIILVTGNNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSISAFLTNRVGDCFLTIGMF 183

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                 G       F                        + KS+Q+ L  WLP AM  PT
Sbjct: 184 AILWSLGNLDYATVFSLAP--YXXXXXXXXXXXXXXXGAMAKSSQVGLHVWLPMAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSALIH+ATM  AGV+L++R  PL E++   L + LW+GA T + ++LV   Q D+K++
Sbjct: 242 PVSALIHAATMVTAGVYLLMRSSPLIEYSSTVLLICLWLGAITTVFSSLVGLFQQDIKKV 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG-TRDLRQLGG 332
           +A+ST+SQ                 FHL  HA +K+ALFL  G++  A    +D R+ GG
Sbjct: 302 IAYSTMSQLGLMVVAIGLSSYNIALFHLVNHAFYKAALFLGAGSIIHAVADNQDFRKYGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIY 391
           L + LP T              P L+G++S++ +L  A    T  GV +  +  +  I+
Sbjct: 362 LREFLPLTYXXXXXXXXXXXXFPFLTGFYSKDLILESAFGQFTFSGVSVYAISTIGAIF 420


>NU5C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  173 bits (439), Expect = 3e-45
 Identities = 142/381 (37%), Positives = 193/381 (50%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W       L V    D L   M  LV  + + V +YS  YM+ + G  RFF +LSFF  
Sbjct: 74  SWIPHKNIPLEVGFFIDPLTSIMLILVTTVGVLVMIYSDSYMSHDQGYVRFFVYLSFFTA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I  E VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVLSSNLVQIYIFRELVGMCSYLLIGFWFTRPSAANACQKAFITNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ ++    ++ ++                       + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEIHDLSERFDEXXXXXXXXXXXXXTCAILLFLGPVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAGVFLV R+F  F+  PL ++ + W+GA TAL+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGVFLVARMFHFFKALPLTMSFISWIGAITALMGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           DLKR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DLKRGLAYSTMSQLGYMMLAMGIGSYRAALFHLITHAYSKALLFLGSGSVIHSMEPIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL   +P T              P  + +WS++++L  + S     G 
Sbjct: 374 SPDKCQNMALMGGLRAYMPITGITFLFGTLSLCGIPPFACFWSKDKILADSWSYSPILGG 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWFTAGLTAFYMSRIYLLTF 454


>NU5C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  173 bits (439), Expect = 3e-45
 Identities = 130/381 (34%), Positives = 180/381 (47%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YMA + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VGL S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQ----VEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+             + +                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSXXXXXXXXXXXXLIYNNEVDFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFRVIPYIMYLISVIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGY 373

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPAKSQNMGLMGGLRKHVPITKITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWATAGLTAFYMFRIYLLTF 454


>NU5C_GOSBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 745

 Score =  173 bits (439), Expect = 3e-45
 Identities = 135/407 (33%), Positives = 198/407 (48%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++G+   +   +W     F        D L   M+ L+  + + V
Sbjct: 58  LSIVMIFSLDLSIQQINGSSIYQYVWSWTINNDFSFEFGYFIDSLTSIMSILITTVGIFV 117

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++S F   M            +I WE VG+ S++LIG    
Sbjct: 118 LIYSDNYMSHDEGYLRFFAYMSLFNTSMLGLVTSCNLIQIYIFWELVGMCSYLLIGFWFT 177

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 178 RPAAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNEVHFLFVT 237

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RLFPLF   
Sbjct: 238 LCASLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLFPLFIVI 297

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 298 PYIMNLISLIGIITVLLGATLALAQNDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLI 357

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL+ G    ++E   G     ++++  +GGL K +P T             
Sbjct: 358 THAYSKALLFLASGSIIHSMEAIVGYSPEKSQNMVFMGGLRKHVPVTQIAFLVGTLSLCG 417

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 418 IPPLACFWSKDEILSDSWLYSPIFAIIAWSTAGLTAFYMFRIYLLTF 464


>NU5M_CANLU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  173 bits (438), Expect = 4e-45
 Identities = 122/364 (33%), Positives = 174/364 (47%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 68  WMTIQTMKLSMSFKLDYFSMIFVPVALFVTWSIMEFSMWYMHSDPYINRFFKYLLLFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MMVLVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAVLYNRIGDVGFIMTMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F    D                    GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLLNLNTWDLQQIFITTNDNFNXXXXXXXXAAT------GKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL EH      + L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMEHNQTIQTLTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K LP+T              P L+G++S++ ++  A + +T AW + + LV   L   
Sbjct: 362 LFKVLPFTTTSLIIGSLALTGMPFLTGFYSKDLIIESANTSNTNAWALLITLVATSLTAA 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5C_GERJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 744

 Score =  173 bits (438), Expect = 4e-45
 Identities = 131/381 (34%), Positives = 184/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L +    D L   M+ L+  + + V +YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLELGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDHGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A +A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGIRSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    FQ     + +                   I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRNLFQIFNNLISNNEVNFLFVTLCAVLLFAGAIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +  +G  T  + A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPHIMNFISLIGIITVFLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETLVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 CPKKSQNMVLMGGLTKHVPITKTSFFLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWSTAGLTAFYMCRMYLLTF 454


>NU5C_DIGGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 699

 Score =  173 bits (438), Expect = 4e-45
 Identities = 135/407 (33%), Positives = 196/407 (48%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPL-SGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF + L++  + S +  +   +W     F L +    D L   M+ L+  + + V
Sbjct: 40  LSIVMIFSTNLSIQQINSNSIYQYVWSWTLDNDFSLELGCLIDPLTSIMSMLITIVGITV 99

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YMA + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 100 LIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGVCSYLLIGFWFT 159

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 160 RPLAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIVNNQVNYLFVT 219

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM A G+FLV RL PLF   
Sbjct: 220 LCAALLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAEGIFLVARLLPLFIVI 279

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 280 PYIMNFISLIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 339

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 340 THAYSKALLFLGSGSVIHSMETIVGYSPEKSQNMVLMGGLRKYVPITKISFLLGTLSLCG 399

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 400 IPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTF 446


>NU5C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 663

 Score =  173 bits (438), Expect = 4e-45
 Identities = 119/380 (31%), Positives = 168/380 (44%), Gaps = 13/380 (3%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W       L +    D L   M  LV  +A+ V  YS  YM+ +    RFFA+LS F   
Sbjct: 77  WIVNDNISLKLGFFIDPLSSLMLFLVTSVAVLVMSYSHGYMSHDQSYVRFFAYLSLFTAS 136

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            +I WE VG+ S++LIG    +  A  A  KA +  R           
Sbjct: 137 MLGLVLSPNLFQIYIFWELVGMCSYLLIGFWFTRPNAASACQKAFITNRIGDFCLLLGIL 196

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEAM 209
                T +       ++ E+                       I KSAQ PL  WLP+AM
Sbjct: 197 GLYWFTNSFDFITVTKRTEEIISNNNSHLYFFIFCSFLLFCGPIAKSAQFPLHIWLPDAM 256

Query: 210 AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYD 269
             PTP+SALIH+ATM AAG+FLV RLFPLF+  P  + ++  +G  TA + + +A +Q D
Sbjct: 257 EGPTPISALIHAATMVAAGIFLVARLFPLFQLFPSIMNLITCIGILTAFLGSTIALSQID 316

Query: 270 LKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA----LERATG-- 323
           LK+ LA+ST+SQ                 FHL  HA  K+ LFL  G+    LE   G  
Sbjct: 317 LKKSLAYSTISQLGYMMVAMGIGSYKAGLFHLVTHAYSKALLFLGSGSVIHNLEPLLGYN 376

Query: 324 ---TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVF 380
               ++L  +GGLGK +P T              P  + +WS++E++  A   +   G+ 
Sbjct: 377 PENNQNLVFMGGLGKSMPITRFTFLIGTLSLCGVPPFACFWSKDEIIADAWKYNFNLGLI 436

Query: 381 MLVLILLAGIYIGRAAMATF 400
             +   L G Y+ R  +  F
Sbjct: 437 AWITAGLTGFYMFRVYLLAF 456


>NU5C_ATRJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 749

 Score =  173 bits (438), Expect = 4e-45
 Identities = 134/407 (32%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMLILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNFVFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKTSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5M_RHIST RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 654

 Score =  172 bits (437), Expect = 5e-45
 Identities = 121/381 (31%), Positives = 175/381 (45%), Gaps = 12/381 (3%)

Query: 12  GIFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSV 71
           G+  S +++  +S  D+E  L  +      LTVS         M   V  ++  V +YS 
Sbjct: 51  GLCGSPVSIKLMSWIDSEFLLVSWGFIYDSLTVS---------MLLPVLIVSALVHIYST 101

Query: 72  PYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKAR 131
            YM+++   QRFFA+LS F   M            FI WEGVG++S++LI     + +A 
Sbjct: 102 NYMSEDPHNQRFFAYLSMFTFFMLMLVTGDNYLVMFIGWEGVGISSYLLINFWFTRLQAN 161

Query: 132 QAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXX 191
           +AA KAL+M R                 G       F                       
Sbjct: 162 KAAIKALVMNRVGDWGFSIGLWAIFWTFGNLDFTTVFSLAP--FINEELITIISICLLVA 219

Query: 192 XIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW 251
            +GKSAQ+ L  WLP+AM  PTPVSALIH+ATM  AGV+L+LR  P+ E    AL ++ W
Sbjct: 220 AMGKSAQIGLHTWLPDAMEGPTPVSALIHAATMVTAGVYLLLRSSPILEFGSTALILITW 279

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           V              Q DLKR++A+ST SQ                 FHL  HA FK+ L
Sbjct: 280 VXXXXXXXXXXXXXXQNDLKRVIAYSTCSQLGLLFLVCGLSQYNVALFHLVNHAWFKALL 339

Query: 312 FLSVGALERA-TGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           FLS G++  A    +DLR+ GGL + LP+T              P L+G++S++ ++  A
Sbjct: 340 FLSAGSVIHAMNDEQDLRKFGGLSRLLPFTYSMMVIGSLSLMALPFLTGFYSKDLIIELA 399

Query: 371 VSVHTAWGVFMLVLILLAGIY 391
              ++  G  +  L  +A ++
Sbjct: 400 YGHYSFSGNLVYWLASVAAVF 420


>NU5C_HELAN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 743

 Score =  172 bits (437), Expect = 5e-45
 Identities = 134/407 (32%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSLNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNSVFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLMPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  + ++G  T    A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISFIGIITVFFGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLKKHVPITKNSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +           Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGFTAFYMCRIYLLTF 454


>NU5M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 666

 Score =  172 bits (436), Expect = 6e-45
 Identities = 111/345 (32%), Positives = 162/345 (46%), Gaps = 9/345 (2%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           ++W   G F ++     D                  +YS+ YM ++  + RF ++L  F 
Sbjct: 62  VSWIKSGAFYVSWGFLFDXXXXXXXXXXXXXXXXXHIYSIKYMENDPHQPRFMSYLEIFT 121

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
             M            F+ WEGVGLAS++LI   + +  A Q+A KAL++ R         
Sbjct: 122 FFMLILVTADNLIQMFLGWEGVGLASYLLINFWYTRLAANQSAIKALIVNRVGDFGLSLG 181

Query: 152 XXXXXXITGTTQ------LPPFF--QQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                 +  +        L P F  Q +                     IGKSAQL L  
Sbjct: 182 IFLIFWVFNSVDYSVIFSLVPLFDNQFLTFLGFKLHVLTLISLFLFIGAIGKSAQLGLHT 241

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALV 263
           WLP+AM  PTPVSALIH+ATM  AGVFL++R  PL E +P  L +++  G+ TA  AA+ 
Sbjct: 242 WLPDAMEGPTPVSALIHAATMVTAGVFLMIRFSPLLEFSPTILFILITFGSLTAFFAAVT 301

Query: 264 ATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-T 322
              Q+DLKR++A+ST SQ                 FHL  HA FK+ LFLS G++  A +
Sbjct: 302 GVFQHDLKRVIAYSTCSQLGYMIFSCGMSCYDVSLFHLANHAFFKALLFLSAGSVIHAVS 361

Query: 323 GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
             +D+R++G L K +P T              P L+G++S++ +L
Sbjct: 362 NEQDMRRMGSLLKFMPLTYSVMLIGTLALIGFPFLTGFYSKDFIL 406


>NU5C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 752

 Score =  172 bits (435), Expect = 8e-45
 Identities = 126/381 (33%), Positives = 179/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   ++ L+  + + V  YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWTINNDFSLEFGHLIDPLTSILSVLITTVGILVLFYSDNYMSHDQGYLRFFAYMSFFTT 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGVCSYLLIGFWFTRPIASNACQKAFVTNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFKIFNNLIYNNQVNFLFVTLCAVLLFSGAIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RLFPLF   P  + ++  +G  T  + A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLFPLFVIIPFIMNLIALIGIITVFLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRSLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALLFLGSGSIIHSMEAILGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P  + +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMVLMGGLTKHIPITKTAFLLGTLSLCGIPPFACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IACFTAGLTAFYMFRVYLLTF 454


>NU5M_PHYIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 664

 Score =  171 bits (434), Expect = 1e-44
 Identities = 117/356 (32%), Positives = 166/356 (46%), Gaps = 9/356 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W   G F        D L   M  +V  I+  V +YS  YMA +    RF ++LS F   
Sbjct: 65  WINSGLFNCNWCFLFDSLTMIMLVVVTSISTLVHLYSSQYMAHDPHLSRFMSYLSLFTFF 124

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVG  S++LI     + +A +AA KA+L+ R           
Sbjct: 125 MIILVTGDNFMQMFVGWEGVGFCSYLLINFWFTRLQANKAAIKAMLVNRISDLILLLGVL 184

Query: 154 XXXXITGTTQLPPFFQQ---VEDXXXXXXXXXXXXXXXXXXXI-----GKSAQLPLTAWL 205
                  T +    F     V+D                   I     GKSAQ+ L  WL
Sbjct: 185 TIFYNIRTIEYFSTFAAISIVKDFKFIFFNYILSIIDVACILIFIGAMGKSAQIFLHLWL 244

Query: 206 PEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVAT 265
           P+AM  PTPVSALIH+ATM  AGV+L  R  P+FE++  +L ++  +GA TA  A+ V  
Sbjct: 245 PDAMEGPTPVSALIHAATMVTAGVYLTARCSPMFEYSMFSLKIITIIGASTAFFASTVGL 304

Query: 266 AQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG-T 324
            Q D K+++A+ST SQ                 FHL+ HA FK+ LFL  GA+  A G  
Sbjct: 305 VQNDFKKIVAYSTCSQLGYMFFACGLSNYPLAIFHLSNHAYFKALLFLCSGAVIHAMGDE 364

Query: 325 RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVF 380
           +D+R++GGL + LP+T              P L+G++S++ +L  A +  +  G F
Sbjct: 365 QDIRKMGGLRRILPFTYIMFLIGSLSLMGFPFLTGFYSKDLILEVAFASFSETGHF 420


>NU5C_SESIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 684

 Score =  171 bits (434), Expect = 1e-44
 Identities = 131/381 (34%), Positives = 183/381 (48%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L   + + V +YS  YMA + G   FFA++SFF  
Sbjct: 50  SWTXDNDFSLEFGYLIDPLTSIMSMLXTTVGIMVLIYSDNYMAHDQGYLIFFAYMSFFST 109

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 110 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFVTNRVXXXXXXXXX 169

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 170 XXXYWITGSFEFQDLFEIFNNLIYNNQVNSPFVTLCAALLFAGAVAKSAQFPLHVWLPDA 229

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +  +G  T L+ A +A AQ 
Sbjct: 230 MEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPYIMNFISLIGIITVLLGATLALAQK 289

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 290 DIKRGLAYSTMSQLXYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETIVGY 349

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L ++      + +
Sbjct: 350 SPDKSQNMVLMGGLRKHVPITKTSFLLGTLSLCGIPPLACFWSKDEILNESWLYSPIFAI 409

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 410 IAWATAGLTAFYMFRIYLLTF 430


>NUOL_RICPR RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 653

 Score =  171 bits (433), Expect = 1e-44
 Identities = 115/374 (30%), Positives = 169/374 (45%), Gaps = 5/374 (1%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           L W      ++  S+  D+L   M   V +++  V +YS+ YMA++ G  R         
Sbjct: 67  LPWIEFKNLQVNWSIYIDQLTSIMFIAVTFVSSVVHIYSLGYMAEDKGIIRXXXXXXXXX 126

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
                          F  WEGVG+ S++LIG  H +  A +AA KA +  R         
Sbjct: 127 XXXXXXVSADNFLQLFCGWEGVGVCSYLLIGFWHSKESANKAAIKAFITNRVSDFAFILG 186

Query: 152 XXXXXXITGTTQLPPFFQQVE-----DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLP 206
                   G+      F   +                         +GKSAQ+ L  WLP
Sbjct: 187 IITIIVYYGSANYKDVFSSAKLLSNTKIFVHFSILDIICLLLFIGCMGKSAQIGLHVWLP 246

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTPVSALIH+ATM  AGVFLV R   LFE++P+ L  +  +G  T L AA +A  
Sbjct: 247 DAMEGPTPVSALIHAATMVTAGVFLVARCSYLFEYSPIVLQFITIIGGITCLFAASIAIM 306

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRD 326
           Q D+K+++A+ST SQ                 FHL  HA FK+ LFLS G +  A    +
Sbjct: 307 QSDIKKIIAYSTCSQLGYMFMACGVSSYNSAIFHLVTHAFFKALLFLSAGNVIHAVNEHN 366

Query: 327 LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLIL 386
           + ++GGL  ++P T                LSG++S++ +L    S  +   +F ++  +
Sbjct: 367 IFKMGGLINKMPITYGNFLIGSLALIGIYPLSGFYSKDLILEATYSSGSFMFIFGIITAI 426

Query: 387 LAGIYIGRAAMATF 400
           L  IY  +  +  F
Sbjct: 427 LTAIYSMKIIILVF 440


>NU5M_POLOR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 613

 Score =  171 bits (433), Expect = 1e-44
 Identities = 126/376 (33%), Positives = 187/376 (49%), Gaps = 10/376 (2%)

Query: 15  ISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYM 74
           I ++  L L+     +   WF++   ++ +SL  D+      T+  ++   +  +++ YM
Sbjct: 54  IPSITCLNLNLQSFTIYYQWFSISSTKINISLQFDQYSMIFMTIALYVTWSILEFAIYYM 113

Query: 75  ADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAA 134
             +    RFF +L  F+  M            FI WEGVG+ SF+LIG  +G+A A  AA
Sbjct: 114 HTDILINRFFKYLLTFLIAMMILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANMAA 173

Query: 135 FKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIG 194
            +A++  R                T +  +   F   ++                     
Sbjct: 174 LQAVIYNRVGDIGLMMTMSWLLINTNSWDIQQLFGLTKNMDXXXXXXXXXXXXXX----- 228

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++RL PL E+    L   L +GA
Sbjct: 229 KSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGIFLLIRLHPLIENNNNILTAALCLGA 288

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T L  A  A  Q D+K+++ +ST SQ                  H+  HA FK+ LFL 
Sbjct: 289 ITTLFTATCALTQNDIKKIVGFSTSSQLGLMMVAIGLNQPQLAFLHICTHAFFKAMLFLC 348

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
            G+ +      +D+R++GG+ K LP T              P L+G++S++ ++    + 
Sbjct: 349 SGSIIHSLNDEQDIRKMGGINKTLPLTSSCLTIGSLALMGTPFLAGFFSKDAIIEAINTS 408

Query: 374 H-TAWGVFMLVLILLA 388
           H  AW    LVL L+A
Sbjct: 409 HLNAWA---LVLTLIA 421


>NU5C_GOSHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 735

 Score =  171 bits (433), Expect = 1e-44
 Identities = 134/407 (32%), Positives = 197/407 (48%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++G+   +   +W     F        D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSLDLSIQQINGSSIYQYVWSWTINNDFSFEFGYFIDSLTSIMSILITTVGIFV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++S F   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDEGYLRFFAYMSLFNTSMLGLVTSCNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPAAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNEVHFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCASLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISLIGIITVLLGATLALAQNDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL+ G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLASGSIIHSMEAIVGYSPEKSQNMVFMGGLRKHVPVTQIAFLVGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSDSWLYSPIFAIIAWSTAGLTAFYMFRIYLLTF 454


>NU5C_FLARA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  171 bits (433), Expect = 1e-44
 Identities = 134/407 (32%), Positives = 193/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W       L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDISLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNLLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLMPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T    A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFFGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKNSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5C_DAMDI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 744

 Score =  171 bits (433), Expect = 1e-44
 Identities = 131/404 (32%), Positives = 189/404 (46%), Gaps = 19/404 (4%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LSYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPLAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFQIFNSLISNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 FCALLLFTGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLIARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITLFLGATLALAQKDIKRGLAYSTMSQLGYMVLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYSPQKSQNMGLMGGLTKHVPITKTAFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQA-----VSVHTAWGVFMLVLILLAGIYI 392
            P L+ +WS++E+L  +     +    AW    L    +  IY+
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYL 451


>NU5M_ALLMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 641

 Score =  171 bits (432), Expect = 2e-44
 Identities = 120/314 (38%), Positives = 165/314 (52%), Gaps = 3/314 (0%)

Query: 68  VYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQ 127
           +YS+ YM  +   QRFF++LS F   M            F+ WEG+G++S++LI     +
Sbjct: 100 LYSIGYMQGDPHIQRFFSYLSLFTFFMLLLVTGNNYLLMFVGWEGIGVSSYLLINFWFTR 159

Query: 128 AKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXX 187
            +A +A+ +A+L+ R                  ++        +                
Sbjct: 160 IQANKASMQAMLVNRVGDXXXXXXXXXXXXXXXSSDYDTV--GIIAYKLDEQYITIVTLF 217

Query: 188 XXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA 247
                IGKSAQL L  WLP AM  PTPVSALIH+AT+  AGV+L+LR  PLFE AP +L 
Sbjct: 218 LLIAAIGKSAQLGLHTWLPSAMEGPTPVSALIHAATLVTAGVYLILRSSPLFELAPTSLI 277

Query: 248 VVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATF 307
            V  +G+ TA+ AA     Q DLKR++A+ST SQ                 FHL  HA F
Sbjct: 278 CVCVIGSLTAIFAATTGLFQNDLKRVIAYSTCSQLGYMVFALGLSQYEVAFFHLFNHAYF 337

Query: 308 KSALFLSVGALERAT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEEL 366
           K+ LFLS G++  A    +D+R++GGL   LP+T              P L+GY+S++ +
Sbjct: 338 KALLFLSAGSIIHALHDEQDMRKMGGLVNILPFTYTMILIGSLSLMALPFLTGYYSKDAI 397

Query: 367 LRQAVSVHTAWGVF 380
           L  A       G F
Sbjct: 398 LEVAYGQFLVTGTF 411


>NU5C_GUIAB RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  171 bits (432), Expect = 2e-44
 Identities = 134/407 (32%), Positives = 193/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQILNNLISNNEVNFVFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+F V RL PLF   
Sbjct: 228 LCAILLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFPVARLMPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T    A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFFGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKNSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  170 bits (431), Expect = 2e-44
 Identities = 123/346 (35%), Positives = 174/346 (50%), Gaps = 13/346 (3%)

Query: 68  VYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQ 127
           +YS  YM+ +    RFFA+L+FF   M            +I WE VG+ S++LIG    +
Sbjct: 109 IYSDNYMSHDKTYVRFFAYLNFFNASMLGLVISPNLLQIYIFWELVGMCSYLLIGFWFTR 168

Query: 128 AKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXX 187
             A  A  KA +  R               +TG+ +     +++ +              
Sbjct: 169 PSAANACQKAFITNRAXXXXXXXXXXXXYWVTGSFEFQYLSEKLNELTAIDGVGSFFVTS 228

Query: 188 XXXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RLFPLF+  P
Sbjct: 229 CAFLLFLGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLFPLFKALP 288

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
           L + ++ W+G  TAL+ A +A AQ DLKR LA+ST+SQ                 FHL  
Sbjct: 289 LIMYLISWIGGITALLGATMALAQKDLKRGLAYSTMSQLGYMMLALGIDSYRIALFHLIT 348

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T              
Sbjct: 349 HAYSKALLFLGSGSVIHSMEPIVGYCPRKSQNMALMGGLRKYMPITGITFLLGTLSLSGI 408

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P  + +WS++++L  +      +G        L   Y+ R  + TF
Sbjct: 409 PPFACFWSKDQILSDSKLYSPIFGGITWFTAGLTAFYMFRMYLLTF 454


>NU5M_SCYCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 609

 Score =  170 bits (430), Expect = 3e-44
 Identities = 125/375 (33%), Positives = 180/375 (48%), Gaps = 8/375 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +GPF + +S   D        +  ++   +  +++ YM  +    RFF +L  F+  
Sbjct: 70  WMNMGPFNINMSFKFDLYSIMFTPVALYVTWSILEFALWYMHLDPNINRFFKYLLLFLIS 129

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  + +  A  AA +A++  R           
Sbjct: 130 MIILVTANNMFQLFIGWEGVGIMSFLLIGWWYSRTDANTAALQAVIYNRIGDIGLILSMA 189

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + ++   F   +D                    GKSAQ  L  WLP AM  PT
Sbjct: 190 WLAMNLNSWEIQQIFILSKDKDXXXXXXXXXXXXX-----GKSAQFGLHPWLPSAMEGPT 244

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++RL PL +     L   L +GA T L  A  A  Q D+K++
Sbjct: 245 PVSALLHSSTMVVAGIFLLIRLHPLIQDNQFILTTCLCLGAITTLFTATCALTQNDIKKI 304

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 305 IAFSTSSQLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 364

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH-TAWGVFM-LVLILLAGI 390
           L K LP+T              P LSG++S++ ++    + H  AW + + LV      I
Sbjct: 365 LHKLLPFTSSSLTVGSLALTGMPFLSGFFSKDAIIEAMNTSHLNAWALILTLVATSFTAI 424

Query: 391 YIGRAAMATFGLAPQ 405
           Y  R    T    P+
Sbjct: 425 YSLRLIFFTLMKFPR 439


>NU5M_DASNO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 601

 Score =  170 bits (430), Expect = 3e-44
 Identities = 113/353 (32%), Positives = 172/353 (48%), Gaps = 9/353 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D       ++  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WMTMQTMKLSLSFKLDFFSIIFVSVALFVTWSIMEFSLWYMHSDPYINQFFKYLLLFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MMILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILTMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  +  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WLLLHLNSWDLQQIFM-------LKPTNXXXXXXXXVAAAGKSAQFGLHPWLPSAMEGPT 240

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL ++ P  L + L +GA T L  A+ A  Q D+K++
Sbjct: 241 PVSALLHSSTMVVAGIFLLVRFYPLMQNNPTILTMTLCLGAITTLFTAICALTQNDIKKI 300

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 301 IAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLNNEQDIRKMGG 360

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGVFMLVL 384
           L K +P+T              P L+G++S++ ++  A  S   AW + + +L
Sbjct: 361 LLKAMPFTSSCLMIGSLALTGMPFLTGFYSKDLIIESANTSYSNAWALLITLL 413


>NU5C_LIRTU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  170 bits (430), Expect = 3e-44
 Identities = 132/407 (32%), Positives = 195/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + L++  ++G+   +   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMVFSADLSIQQINGSSIYQYLCSWTINNDFSLEFGHLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SF    M             I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIHIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     +           
Sbjct: 168 RPIAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFEIFNNLIHTNGVNSLFAT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL P+F   
Sbjct: 228 LCAFLLFVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPIFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISLLGIITVLLGATLALAQKDIKRSLAYSTMSQLGYTMLAPGIGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPDKSQNMVLMGGLTKYVPITKTTFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIACSTAGLTAFYMFRMYLLTF 454


>NUOL_CAMJE RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 596

 Score =  169 bits (429), Expect = 4e-44
 Identities = 115/354 (32%), Positives = 164/354 (46%), Gaps = 4/354 (1%)

Query: 49  DRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFI 108
           D +   M ++V  +A  V  YS+ YMA + G  +FFA+L  FV  M            F+
Sbjct: 74  DAISLTMMSVVGIVATCVHFYSIFYMAHDEGFNKFFAYLGLFVFSMLFLVMSDNFLGLFV 133

Query: 109 AWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFF 168
            WEGVGL S++LIG  +       AA +A +M R                 GT +    F
Sbjct: 134 GWEGVGLCSWLLIGFWYKNDTYSFAANEAFIMNRIADLGMLLGIFWLYLQAGTLKYDEVF 193

Query: 169 QQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAG 228
              +                    +GKSAQ P   WL +AMA PTPVSALIH+ATM  AG
Sbjct: 194 SMAQSLDHNALILIATCLFIGA--MGKSAQFPFHTWLADAMAGPTPVSALIHAATMVTAG 251

Query: 229 VFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXX 288
           V+LV+R   L++  P    ++  +GAF A+ AA +A    DLKR++A+ST+SQ       
Sbjct: 252 VYLVIRASTLYDLVPEVSYIIALLGAFVAIFAASMALVVRDLKRIIAYSTLSQLGYMFVA 311

Query: 289 XXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTR-DLRQLGGLGKRLPWTXXXXXXX 347
                     FHL  HA FKS LFL  G +  A   + D++++GGL K L  T       
Sbjct: 312 AGLGAYGIALFHLATHAFFKSLLFLGAGNVMHAMNDKLDIKKMGGLFKPLKITAILMCIG 371

Query: 348 XXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
                     +G++S++ +L  + +S H    + +L+   L   Y  R  M  F
Sbjct: 372 SLALAGIYPFAGFFSKDLILGYSFISFHHGIFLVLLIAAFLTAFYSFRLLMLVF 425


>NU5M_RHIUN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  169 bits (429), Expect = 4e-44
 Identities = 115/379 (30%), Positives = 170/379 (44%), Gaps = 11/379 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T    +L++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WMTTQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFSIWYMHSDPHITQFFKYLLMFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFIMSMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  +  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLSNMNSWDLQQIFT------LDPNHTNLPLMGLLLAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+   A  + L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMENNKTAQTLTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMIVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K +P+T              P L+G++S++ ++  A + +T AW + M L+   L   
Sbjct: 362 LFKTMPFTATSLIIGSFALTGMPFLTGFYSKDLIIETANTSYTNAWALLMTLIATSLTAA 421

Query: 391 YIGRAAMATFGLAPQAVMP 409
           Y  R  M  F L  Q   P
Sbjct: 422 YSTR--MIFFTLLGQPRFP 438


>NU5M_DUGDU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  169 bits (429), Expect = 4e-44
 Identities = 115/369 (31%), Positives = 173/369 (46%), Gaps = 9/369 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    RFF +       
Sbjct: 68  WMTIHTLKLSLSFKLDYFSLIFMPVALFVTWSIMEFSLWYMNSDPYINRFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG  +G+  A  AA +A++  R           
Sbjct: 128 XXXXXXANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAMIYNRIGDVGFVAAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + + +L   F  V                     +GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLLHSNSWELQQIFLTV------PKGNTLPLTGLLLAAMGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E  P  L + L VGA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMEMNPSILTLTLCVGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG-TRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G++  + G  +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLGDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K LP+T              P L+G++S++ ++    S +T AW + +  +   +  +
Sbjct: 362 LYKTLPFTTTALIIGSLALTGMPFLTGFYSKDLIIEAMSSSYTNAWALLITFIATSMTAV 421

Query: 391 YIGRAAMAT 399
           Y  R    T
Sbjct: 422 YSTRIIFFT 430


>NU5C_LOLPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  169 bits (429), Expect = 4e-44
 Identities = 146/407 (35%), Positives = 203/407 (49%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSIQLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDGYMSHDEGYLRFFVYISFFTTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RLFPLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLFPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL + ++  VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMTLISLVGTITLFLGATLAIAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPLVGYSPEKSQNMVLMGGLRKYIPITRTTFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  169 bits (429), Expect = 4e-44
 Identities = 147/408 (36%), Positives = 203/408 (49%), Gaps = 14/408 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVQLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFQIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +  VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISLVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTTFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATFG 401
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TFG
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTFG 455


>NU5M_LEMCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  169 bits (428), Expect = 5e-44
 Identities = 107/361 (29%), Positives = 169/361 (46%), Gaps = 9/361 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WMTIQTLKLSISFKLDYFSMLFMPVALFVTWSIMEFSMWYMHSDPNMNQFFKYLLMFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MLILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + T +    FQQ+                      GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLMYSNTWE----FQQM--FMLNYHPDMIPLIGLLLAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+      ++L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFYPLMENNKTIQTLMLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTMGINQPHLAFLHICNHAFFKAMLFMCSGSIIHNLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGV-FMLVLILLAGI 390
           L K +P+T              P L+G++S++ ++    + +T AW +   L+   +  I
Sbjct: 362 LFKSMPFTSSSLMIGSLALTGMPFLTGFYSKDLIIESVNTSNTNAWALTITLIATSMTAI 421

Query: 391 Y 391
           Y
Sbjct: 422 Y 422


>NU5M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 715

 Score =  169 bits (427), Expect = 7e-44
 Identities = 117/407 (28%), Positives = 185/407 (45%), Gaps = 24/407 (5%)

Query: 3   GRGSGLAVGGIFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRL----------G 52
           GR  G++ G   I+ L+V+  +G      L +F VG   + V++   R           G
Sbjct: 20  GRKVGVS-GAQLITCLSVIITTGL---AILAFFEVGFNNIPVTINLFRWIDSEWYNILWG 75

Query: 53  WWMATLVAWIALPVAV-------YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXX 105
           +   +L   + +PV +       YS+ YM+ +   QRFF++LS F  MM           
Sbjct: 76  FQFDSLTVAMLIPVLIISSLVHIYSISYMSHDPHNQRFFSYLSLFTFMMIILVTANNYLL 135

Query: 106 XFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLP 165
            F+ WEGVG+ S++L+     +  A Q++  A L  R                 G     
Sbjct: 136 MFVGWEGVGVCSYLLVSFWFTRIAANQSSMSAFLTNRVGDCFLTIGMFVVLWTLGNLDYA 195

Query: 166 PFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMA 225
             F                        + KS+Q+ L  WLP AM  PTPVSALIH+ATM 
Sbjct: 196 TVFSLAP--YINSDIATIIGICLLIGAMAKSSQVGLHVWLPMAMEGPTPVSALIHAATMV 253

Query: 226 AAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXX 285
            AGV+L++R  PL E++   L + LW+GA T + ++L+   Q D+K+++A+ST+SQ    
Sbjct: 254 TAGVYLLMRSSPLIEYSSTVLLLCLWLGAITTVFSSLIGLFQQDIKKVIAYSTMSQLGMM 313

Query: 286 XXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG-TRDLRQLGGLGKRLPWTXXXX 344
                        FHL  HA +K+ LFL  G++  A    +D R+ GGL   LP T    
Sbjct: 314 VIAIGLSSYNVALFHLINHAFYKALLFLGAGSVIHAVADNQDFRKFGGLKNYLPLTYSVM 373

Query: 345 XXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIY 391
                     P ++G++S++ +L  A    +  GV + ++  +  I+
Sbjct: 374 LIASLSLVAFPYMTGFYSKDFILESAYGQFSFSGVAVYIIATIGAIF 420


>NU5M_GEOPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 599

 Score =  169 bits (427), Expect = 7e-44
 Identities = 101/335 (30%), Positives = 154/335 (45%), Gaps = 8/335 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W TV   EL +S   D        +  ++   +  YS  YM  +   +RF  +LS F+  
Sbjct: 65  WLTVHTIELKMSFKLDLYSITFMPVALYVTWSIMEYSTWYMKHDPHLKRFLNYLSLFLIT 124

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A++  R           
Sbjct: 125 MLILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAIIYNRVGDIGLVIAMA 184

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + + +L   F                        +GKSAQ  L  WLP AM  PT
Sbjct: 185 WFYKNSNSWELQQIFS-------LGTTSNLPLIGLILAAMGKSAQFGLHPWLPSAMEGPT 237

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL  +  + +  +L +GA T L  A+ A  Q D+K++
Sbjct: 238 PVSALLHSSTMVVAGVFLLIRFHPLMSNNSMIMTTILCIGAMTTLFTAICALTQNDIKKI 297

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 298 IAFSTSSQLGLMMVTLGINQPYLSFLHICTHAFFKAMLFMCAGSIIHNLNDEQDIRKMGG 357

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
           + K +P T              P +SG++S++ ++
Sbjct: 358 ISKTMPLTASAMTIGNLALMGTPFMSGFYSKDLII 392


>NU5C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  168 bits (426), Expect = 9e-44
 Identities = 154/381 (40%), Positives = 202/381 (53%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F   +    D L   M   V  + + V +YS  YM+ + G  RFFA+LS F  
Sbjct: 74  SWTINKNFSPELGYLIDPLTSIMPISVTTVGIMVMIYSDNYMSHDQGYVRFFAYLSLFNA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVISPNLVQIYIFWELVGMCSYLLIGSWFTRPSAANACQKAFITNRXXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFF----QQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +         + +                     + KSAQ PL  WLP+A
Sbjct: 194 XXXYQITGSFKFRYLLGRSNESIASNEVSSXXXXXXXXXXXXGPVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RLFPLF+  P  + ++ W G  TAL+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLFPLFKALPFIMNLISWTGGITALLGATMALAQS 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           DLKR LA+ST+SQ                 FH   HA  K+ LFL  G    ++E   G 
Sbjct: 314 DLKRGLAYSTMSQSGYMVLALGTGSYRAALFHPITHAYSKALLFLGSGSVIHSMESLVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P                P  + +WS++E++  +    T  G 
Sbjct: 374 CPAESQNMALMGGLSKYMPIXXXXXXXXXXXXXXIPPFACFWSKDEIISDSWLYSTILGG 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                      Y+ R     F
Sbjct: 434 IARSAAGFTAFYMSRMYFLAF 454


>NU5M_PENMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;
          Length = 658

 Score =  168 bits (425), Expect = 1e-43
 Identities = 107/365 (29%), Positives = 164/365 (44%), Gaps = 15/365 (4%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W       +  S   D L   M   V  ++  V +YS+ YM+ +   QRFF++LS F  M
Sbjct: 64  WIDAEALNVMWSFKFDSLTVSMLIPVLIVSSLVHIYSISYMSHDPHNQRFFSYLSLFTFM 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVG+ S++LI     +  A Q++  ALL  R           
Sbjct: 124 MIILVTGNNYLLMFVGWEGVGICSYLLINFWFTRIAANQSSISALLTNRVGDCFLTIGIF 183

Query: 154 XXXXITGTTQ------LPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPE 207
                 G         L P++ +                        KS+Q+ L  WLP+
Sbjct: 184 AMLWSFGNIDYNLIFSLAPYYNE--------NIITMIGICLVIGATAKSSQVGLHIWLPQ 235

Query: 208 AMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQ 267
           AM  PTPVSALIH+ATM  AGV+L++R  PL E++   L + LW+GA T + ++L+   Q
Sbjct: 236 AMEGPTPVSALIHAATMVTAGVYLLMRSSPLIEYSSTVLIICLWLGAITTVFSSLIGLFQ 295

Query: 268 YDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRD 326
            D+K+++A+ST+SQ                 FHL  HA +K+ LFL  GA +      +D
Sbjct: 296 QDIKKVIAYSTMSQLGMMVIGIGLSSYNIALFHLVNHAFYKALLFLGAGAVIHSVADNQD 355

Query: 327 LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLIL 386
            R+ GGL   LP T              P ++G++S++ +L  A       G  +  +  
Sbjct: 356 FRKYGGLRPFLPLTYSVMLIASLSLVAVPFMTGFYSKDLILESAYGQFYLSGTIVYFIAT 415

Query: 387 LAGIY 391
           +  ++
Sbjct: 416 IGAMF 420


>NU5C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 747

 Score =  168 bits (425), Expect = 1e-43
 Identities = 146/408 (35%), Positives = 204/408 (50%), Gaps = 15/408 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + LA+  ++G+   E   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMVFSTKLAIQQINGSSIYEYLWSWSITSDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M             I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDRGYLRFFAYMSFFNTAMLGLVTSPNLIQIHIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXX 186
           +  A  A  KA +  R                  + +                       
Sbjct: 168 RPIAANACQKAFVTNRVXXXXXXXXXXXXXXXXXSFEFQDLXXXXXXXXXXXXXXXXXXA 227

Query: 187 XXXXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEH 241
                      + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF  
Sbjct: 228 TLCAFLLFLGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIA 287

Query: 242 APLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHL 301
            P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL
Sbjct: 288 IPYIMNIISLIGVITVLLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYRAALFHL 347

Query: 302 TVHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
             HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T            
Sbjct: 348 ITHAYSKALLFLGSGSIIHSMEPIVGYSPAKSQNMVLMGGLTKYMPITKTTFFLGTLSLC 407

Query: 353 XXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
             P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 GIPPLACFWSKDEILNDSWLYSPIFAIIAFYTAGLTAFYMFRMYLLTF 455


>NU5M_HORSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 604

 Score =  167 bits (424), Expect = 2e-43
 Identities = 125/364 (34%), Positives = 181/364 (49%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 66  WMTMQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFSLWYMHSDPYITRFFKYLLTFLIT 125

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 126 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFIMAMA 185

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                T T  L   F                          KSAQ  L  WLP AM  PT
Sbjct: 186 WFLFNTNTWDLQQIFM------LDXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAMEGPT 239

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+     ++ L +GA T L  A+ A  Q D+K++
Sbjct: 240 PVSALLHSSTMVVAGVFLLIRFHPLMENNKTIQSLTLCLGAITTLFTAICALTQNDIKKI 299

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 300 IAFSTSSQLGLMIVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 359

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L   +P+T              P L+G++S++ ++  A + +T AW + M L+   L  +
Sbjct: 360 LFNAMPFTTTSLIIGSLALTGIPFLTGFYSKDLIIETANTSYTNAWALLMTLIATSLTAV 419

Query: 391 YIGR 394
           Y  R
Sbjct: 420 YSTR 423


>NU5M_BOSIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  167 bits (424), Expect = 2e-43
 Identities = 110/364 (30%), Positives = 167/364 (45%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    +FF +       
Sbjct: 68  WLTIQTLKLSLSFKMDYFSMMFTPVALFVTWSIMEFSMWYMHSDPNINKFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG  +G+A A  AA +A+L  R           
Sbjct: 128 XXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAVLYNRIGDIGFILAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLTNLNTWDLQQIFM------LNPSDSNMPLIGLALAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+     ++ L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFYPLTENNKFIQSITLCLGAITTLFTAMCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K +P+T              P L+G++S++ ++  A + +T AW + M L+      I
Sbjct: 362 LFKAMPFTTTALIVGSLALTGMPFLTGFYSKDLIIEAANTSYTNAWALLMTLIATSFTAI 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5C_LEMMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 742

 Score =  167 bits (424), Expect = 2e-43
 Identities = 134/405 (33%), Positives = 190/405 (46%), Gaps = 12/405 (2%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++G IF + LA   ++G+     L +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIGLIFSANLAFQQINGSFIYQYLWSWTINNDFSLEFGYFIDPLTSVMLILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVE--DXXXXXXXXXXX 184
           +  A  A  KA +  R               ITG+ +    F+     +           
Sbjct: 168 RPSAASACQKAFITNRVXXXXXXXXXXXXYWITGSFEFRDLFETFNKLNNEGNSLFPTLC 227

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P 
Sbjct: 228 AFLLFLGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTGIPY 287

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            + ++                AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 288 IMNIISXXXXXXXXXXXXXXXAQRDIKRSLAYSTMSQLGYIMLALGLGSYRAALFHLITH 347

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL + +P T              P
Sbjct: 348 AYSKALLFLGSGSIIHSMEPLVGYSPDKSQNMVLMGGLTRYIPITRTTFLLGTLSLCGIP 407

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L ++     ++ V       L   Y+ R  + TF
Sbjct: 408 PLACFWSKDEILSESWLYSPSFAVIAYFTAGLTAFYMFRVYLLTF 452


>NU5C_CAPBA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 695

 Score =  167 bits (424), Expect = 2e-43
 Identities = 129/381 (33%), Positives = 176/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M  L+  + + V +YS  YMA + G  RFFA++SFF  
Sbjct: 66  SWIINNDFSLDFGYLIDPLTSIMXXLITTVGIMVLIYSDNYMAHDQGYLRFFAYMSFFST 125

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VGL S++LIG    +  A  A  KA +  R          
Sbjct: 126 SMLGLVTSSNLIQIYIFWELVGLCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXX 185

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 186 XXXYWITGSFEFRDLFEIFNNLIYNNEVNFLFVTLCAVLLFVGAVAKSAQFPLHVWLPDA 245

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF                T L+ A +A AQ 
Sbjct: 246 MEGPTPISALIHAATMVAAGIFLVARLLPLFRVXXXXXXXXXXXXXXTVLLGATLALAQK 305

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 306 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGY 365

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 366 SPAKSQNMGLMGGLRKHVPITKITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 425

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 426 IAWATAGLTAFYMFRIYLLTF 446


>NU5M_SHEEP RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  167 bits (423), Expect = 2e-43
 Identities = 110/364 (30%), Positives = 167/364 (45%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    +FF +       
Sbjct: 68  WLTIQTLKLSLSFKMDFFSMMFVPVALFVTWSIMEFSMWYMHSDPNINQFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 XXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFILAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLINLNTWDLQQIFM------LNPNDSNLPLMGLILAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+     +++L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFYPLTENNKFGQSIMLCLGAMTTLFTAMCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K +P+T              P L+G++S++ ++  A + +T AW + M LV      I
Sbjct: 362 LFKAMPFTTTALIIGSLALTGMPFLTGFYSKDLIIESANTSYTNAWALLMTLVATSFTAI 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5M_EQUAS RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  167 bits (423), Expect = 2e-43
 Identities = 125/364 (34%), Positives = 180/364 (49%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 68  WMTIQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFSLWYMHSDPYITRFFKYLLTFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDIGFIMAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                T T  L   F                          KSAQ  L  WLP AM  PT
Sbjct: 188 WFLFNTNTWDLQQIFM------LDXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+     ++ L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMENNKTIQSLTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R+ GG
Sbjct: 302 IAFSTSSQLGLMIVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKTGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L   +P+T              P L+G++S++ ++  A + +T AW + M L+   L  +
Sbjct: 362 LFNAMPFTTTSLIIGSLALTGMPFLTGFYSKDLIIETANTSYTNAWALLMTLIATSLTAV 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5M_BOVIN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  167 bits (423), Expect = 2e-43
 Identities = 110/364 (30%), Positives = 167/364 (45%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    +FF +       
Sbjct: 68  WLTIQTLKLSLSFKMDYFSMMFIPVALFVTWSIMEFSMWYMYSDPNINKFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG  +G+A A  AA +A+L  R           
Sbjct: 128 XXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILYNRIGDIGFILAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLTNLNTWDLQQIFM------LNPSDSNMPLIGLALAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+     ++ L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFYPLTENNKYIQSITLCLGAITTLFTAMCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K +P+T              P L+G++S++ ++  A + +T AW + M L+      I
Sbjct: 362 LFKAMPFTTTALIVGSLALTGMPFLTGFYSKDLIIEAANTSYTNAWALLMTLIATSFTAI 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  167 bits (423), Expect = 2e-43
 Identities = 131/407 (32%), Positives = 188/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++G+ A +   +W     F        D L   M+          
Sbjct: 48  LSIVMIFSIDLSIQQITGSSAYQYVWSWTINNEFSFEFGNLIDPLTSIMSXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 XXYSDSYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNQVHFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAFLLFAGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIGI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMYLISLIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEAVVGYSPVKSQNMVLMGGLTKHVPITKTTFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + V       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAVIACSTAGLTAFYMFRIYLLTF 454


>NU5M_PODAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 652

 Score =  167 bits (422), Expect = 3e-43
 Identities = 117/359 (32%), Positives = 172/359 (47%), Gaps = 3/359 (0%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F +      D L   M   V  I+  V +YS+ YM+ +   QRFF++LS F  M
Sbjct: 64  WIDSEWFNIIWGFQFDSLTVSMLIPVLIISSLVHIYSISYMSSDPHNQRFFSYLSLFTFM 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVG+ S++L+     +  A Q++  A L  R           
Sbjct: 124 MIILVTANNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSISAFLANRVGDCFLTIGMF 183

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                 G       F                        + KS+Q+ L  WLP AM  PT
Sbjct: 184 AILWSLGNLDYSTVFSLAP--YINSKVVXXXXXXXXXXAMAKSSQVGLHVWLPMAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSALIH+ATM  AGV+L++R  PL E+    L + LW+GA T + ++L+   Q D+K++
Sbjct: 242 PVSALIHAATMVTAGVYLLMRSSPLIEYNSTVLLLCLWLGAITTVFSSLIGLFQQDIKKV 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG-TRDLRQLGG 332
           +A+ST+SQ                 FHL  HA +K+ LFL  G++  A    +D R+ GG
Sbjct: 302 IAYSTMSQLGMMVIAIGLSSYNVALFHLINHAFYKALLFLGAGSVIHAVADNQDFRKYGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIY 391
           L   LP T              P ++G++S++ +L  A    +  GV + ++  +  I+
Sbjct: 362 LINFLPLTYSVMLIASLSLVAFPFMTGFYSKDFILESAYGQFSFSGVAVYIIATIGAIF 420


>NU5M_BALPH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  166 bits (421), Expect = 3e-43
 Identities = 108/340 (31%), Positives = 156/340 (45%), Gaps = 7/340 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +LT+S   D        +  +I   +  +S+ YM  +    +FF +       
Sbjct: 68  WITIQTLKLTLSFKMDYFSLMFMPVALFITWSIMEFSMWYMHSDPYINQFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG   G+  A  AA +A+L  R           
Sbjct: 128 XXXXVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTDANTAALQAILYNRIGDIGLLASMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F   ++                    GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLSNMNTWDLEQIFMLNQN------PLNFPLMGLVLAAAGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+  L   V L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLVRFYPLMENNKLIQTVTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGLNQPYLAFLHICTHAFFKAMLFLCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
           L K LP+T              P L+G++S++ ++  A S
Sbjct: 362 LFKALPFTTTALIIGCLALTGMPFLTGFYSKDPIIEAATS 401


>NU5M_BALMU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  166 bits (421), Expect = 3e-43
 Identities = 108/340 (31%), Positives = 156/340 (45%), Gaps = 7/340 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +LT+S   D        +  +I   +  +S+ YM  +    +FF +       
Sbjct: 68  WITIQTLKLTLSFKMDYFSLMFMPVALFITWSIMEFSMWYMHSDPYINQFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG   G+  A  AA +A+L  R           
Sbjct: 128 XXXXVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTDANTAALQAILYNRIGDIGLLASMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F   ++                    GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLSNMNTWDLQQIFMLNQN------PLNFPLMGLVLAAAGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+  L   V L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLVRFYPLMENNKLIQTVTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGLNQPYLAFLHICTHAFFKAMLFLCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
           L K LP+T              P L+G++S++ ++  A S
Sbjct: 362 LFKALPFTTTALIIGCLALTGMPFLTGFYSKDPIIEAATS 401


>NU5M_ASPNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;
          Length = 656

 Score =  166 bits (421), Expect = 3e-43
 Identities = 122/367 (33%), Positives = 183/367 (49%), Gaps = 18/367 (4%)

Query: 14  FISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYS 70
           F++ LA   +   +  V +    W  V    +  +   D L   M   V  ++  V +YS
Sbjct: 41  FLAILAFFEVGFNNIPVTINVARWVDVESLYVLWNFRFDSLTVSMFITVLIVSSLVHIYS 100

Query: 71  VPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKA 130
           + YM+ +   QRFF++LS F  MM            F+ WEGVG+ S++L+     +  A
Sbjct: 101 ISYMSHDPHNQRFFSYLSLFTFMMIILVTGNNYLIMFVGWEGVGVCSYLLVNFWFTRIAA 160

Query: 131 RQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQ------LPPFFQQVEDXXXXXXXXXXX 184
            Q++  ALL  R                 G         L P++ +              
Sbjct: 161 NQSSLSALLTNREGDTLLTVGMFAILWSFGNIDYSTVFALAPYYNE--------NXXXXX 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KS+Q+ L  WLP+AM  PTPVSALIH+ATM  AGV+L++R  PL E++  
Sbjct: 213 XXXXXXXXXXKSSQVGLHIWLPQAMEGPTPVSALIHAATMVTAGVYLLMRSSPLIEYSST 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            L + LW+GA T + ++L+   Q D+K+++A+ST+SQ                 FHL  H
Sbjct: 273 VLVLCLWLGAITTVFSSLIGLFQQDIKKVIAYSTMSQLGMMVIAVGLSSYNLALFHLVNH 332

Query: 305 ATFKSALFLSVGALERATG-TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           A +K+ LFL  G++  A    +D R+ GGL + LP T              P ++G++S+
Sbjct: 333 AFYKALLFLGAGSVIHAVADNQDFRKYGGLREFLPLTYSVMLIASLSLVAVPFMTGFYSK 392

Query: 364 EELLRQA 370
           + +L  A
Sbjct: 393 DFILESA 399


>NU5C_CERDE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  166 bits (421), Expect = 3e-43
 Identities = 147/413 (35%), Positives = 207/413 (50%), Gaps = 26/413 (6%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++G +    LA+  ++ +     L +W     F L      D L   M+          
Sbjct: 48  LSIGMLLSVELAIQQINQSSVYKYLWSWTINNDFSLEFGYLIDPLTSIMSXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF++LSFF   M            +I WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDQGYLRFFSYLSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFA 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQ----VEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFELCNNLIPNNGVNSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 XXXXXXXXXXVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A +Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISLIGVITLLLGATLALSQRDIKRSLAYSTMSQLGYIMLAPGIGSYRTALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPEKSQNMALMGGLTKYVPITKTTFFWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAW---GVFMLVLILLAGI---YIGRAAMATF 400
            P L+ +WS++E+L      H +W    +F ++    AG+   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEIL------HDSWLYSPIFAIIAYATAGLTAFYMFRMYLLTF 454


>NU5M_CANFA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  166 bits (420), Expect = 4e-43
 Identities = 119/364 (32%), Positives = 172/364 (47%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   +        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 68  WMTIQTMKLSMSFKLNYFSMIFVPVALFVTWSIMEFSMWYMHSDPYINRFFKYLLLFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MMVLVTANNMFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAVLYNRIGDVGFIMTMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T  L   F    D                    GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLLNLNTWDLQQIFITTNDNFNXXXXXXXXAAT------GKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL EH      + L +GA T L  A+ A  Q D+K +
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMEHNQTIQTLTLCLGAITTLFTAICALTQNDIKEI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +++ST SQ                  H+  HA  K+ LF+  G+ +      +D+R++GG
Sbjct: 302 VSFSTSSQLGLMMVTIGINQPYLAFLHICTHAFCKAMLFMCSGSVIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K LP+T              P L+G++S++ ++  A + +T AW + + LV   L   
Sbjct: 362 LFKVLPFTTTSLIIGSLALTGMPFLTGFYSKDLIIESANTSNTNAWALLITLVATSLTAA 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5C_POAPR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 702

 Score =  166 bits (420), Expect = 4e-43
 Identities = 144/407 (35%), Positives = 203/407 (49%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  ++   L++  ++G+     L +W     F L      D L   M           
Sbjct: 40  LSIAIVYSVHLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 99

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 100 XXYSDGYMSHDEGYLRFFVYISFFTTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 159

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 160 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 219

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RLFPLF   
Sbjct: 220 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLFPLFISI 279

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL + ++  VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 280 PLIMTLISLVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 339

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 340 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTTFLWGTLSLCG 399

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + +F
Sbjct: 400 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLSF 446


>NU5C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 749

 Score =  166 bits (420), Expect = 4e-43
 Identities = 125/381 (32%), Positives = 177/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L +    D L   M  L+  + + V +YS  YM+ + G  RFFA +SF   
Sbjct: 74  SWTINSDFSLELGCLIDPLTSIMLILITTVGIMVLIYSDNYMSHDQGYLRFFASMSFSNT 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFKIFNNLIHNNGVNSLFVTFFASLLFLGAVAKSAQFPLHIWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM  AG+FLV RL PLF   P  + ++  +G  T L+ A  A AQ 
Sbjct: 254 MEGPTPISALIHAATMVVAGIFLVARLLPLFTVIPYIMNLISLIGVITLLLGATFALAQR 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+K+ LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKKSLAYSTMSQLGYIMLAPGIGSYRAASFHLITHAYSKALLFLGSGSIIHSMEPIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K LP T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMILMGGLTKYLPITKITFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IACFTTGLTAFYMFRMYLLTF 454


>NU5C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 732

 Score =  166 bits (420), Expect = 4e-43
 Identities = 141/381 (37%), Positives = 189/381 (49%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W + G   L      D L   M  LV  +A+ V +YS  YM+ + G  RFF +LS F  
Sbjct: 74  SWISNGDIVLEFGYLIDPLTCIMLVLVTSVAIIVMIYSDGYMSHDEGYVRFFVYLSLFTA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVLSPNLIQIYIFWELVGMCSYLLIGFWFTRPSAANACQKAFITNRXXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +    F+  +D                       + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFENLFKGFKDLLINNEVSPFFAILCASFLFLGPVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG++LV R+FPLFE  P  ++V+ W               Q 
Sbjct: 254 MEGPTPISALIHAATMVAAGIYLVARMFPLFETLPFVMSVISWXXXXXXXXXXXXXFFQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGAL---------E 319
           DLKR LA+ST+SQ                 FHL  HA  K+ LFL  G++          
Sbjct: 314 DLKRGLAYSTMSQLGYMMLALGIGSYRAGLFHLITHAYSKALLFLGSGSVIHSMEPIVGY 373

Query: 320 RATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
           R   ++++  +GGL K +P                P  + +WS++E++  +       G 
Sbjct: 374 RPDESQNMIFMGGLRKHMPIXXXXXXXXXXXXXXIPPFACFWSKDEIIADSWLYSPFIGW 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
             L+   L   Y+ R    TF
Sbjct: 434 IALLTAGLTSFYMFRIYFLTF 454


>NUOL_RICTY RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 653

 Score =  165 bits (418), Expect = 8e-43
 Identities = 135/374 (36%), Positives = 192/374 (51%), Gaps = 5/374 (1%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           L W     F++  S+  D+L   M  +V +++  V +YS+ YMA++ G  R         
Sbjct: 67  LPWIEFRNFKVNWSIYIDQLTSIMFIVVTFVSSVVHIYSLGYMANDKGIIRXXXXXXXXX 126

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
                          F  WEGVG+ S++LIG  + +  A +AA KA +  R         
Sbjct: 127 XXXXXXVSADNFLQLFCGWEGVGVCSYLLIGFWYSKESANKAAMKAFITNRVSDFAFXXX 186

Query: 152 XXXXXXITGTTQLPPFFQQVE-----DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLP 206
                   G+      F   +                           KSAQ+ L  WLP
Sbjct: 187 XXXXXXYNGSANYKDVFLSAKLLSNTKILVHFXXXXXXXXXXXXXXXXKSAQIGLHVWLP 246

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTPVSALIH+ATM  AG+FLV R   LFE++P+ L  +  +G  T L AA +A  
Sbjct: 247 DAMEGPTPVSALIHAATMVTAGIFLVARCSYLFEYSPIVLQFITIIGGITCLFAASIAIM 306

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRD 326
           Q D+K+++A+ST SQ                 FHL  HA FK+ LFLS G++  +    +
Sbjct: 307 QSDIKKIIAYSTCSQLGYMFMACGVSSYNSAIFHLVTHAFFKALLFLSAGSVIHSVNEHN 366

Query: 327 LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLIL 386
           + ++G L  ++P T                LSG++S++ +L  A S  +   +F +   +
Sbjct: 367 IFKMGNLINKMPITYGNFLIGSLALIGIYPLSGFYSKDLILEAAYSSGSFMFIFGITAAM 426

Query: 387 LAGIYIGRAAMATF 400
           L  IY  +  +  F
Sbjct: 427 LTAIYSMKIIILVF 440


>NU5C_SORBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 738

 Score =  165 bits (418), Expect = 8e-43
 Identities = 145/407 (35%), Positives = 202/407 (49%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSLHLSIQQINGSSIYQYLWSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +  VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISLVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYVPITRTTFLCGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  165 bits (418), Expect = 8e-43
 Identities = 145/408 (35%), Positives = 203/408 (49%), Gaps = 15/408 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + LA+  ++G+   E   +W     F L      D L   M+ L+  + + V
Sbjct: 48  LSIVMVFSTKLAIQQINGSSIYEYLWSWSITSDFSLEFGYLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M             I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSPNLIQIHIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXX 186
           +  A  A  KA +  R                  + +                       
Sbjct: 168 RPIAANACQKAFVTNRVXXXXXXXXXXXXXXXXXSFEFQDLXXXXXXXXXXXXXXXXXXA 227

Query: 187 XXXXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEH 241
                      + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF  
Sbjct: 228 TLCAFLLFLGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIG 287

Query: 242 APLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHL 301
            P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL
Sbjct: 288 IPYIMNIISLIGLITVLLGATLALAQRDIKRSLAYSTMSQLGYIMLALGIGSYRAALFHL 347

Query: 302 TVHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
             HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T            
Sbjct: 348 ITHAYSKALLFLGSGSIIHSMEPIVGYSPAKSQNMVLMGGLTKYMPITKTTFFLGTLSLC 407

Query: 353 XXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
             P L+ +WS++E++  +      +         L   Y+ R  + TF
Sbjct: 408 GIPPLACFWSKDEIINDSWLYSPIFATIACYTAGLTAFYMFRMYLLTF 455


>NUOL_RICCN RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 657

 Score =  164 bits (416), Expect = 1e-42
 Identities = 117/374 (31%), Positives = 167/374 (44%), Gaps = 5/374 (1%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           L W  VG F++  S+  D+L   M   V W++  V +YS+ YMA++ G  R         
Sbjct: 67  LPWIEVGTFKVNWSIYIDQLTSIMFIAVTWVSSIVHIYSLGYMAEDKGIIRXXXXXXXXX 126

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
                          F  WEGVG+ S++LIG  + +                        
Sbjct: 127 XXXXXXXXXDNFLQLFFGWEGVGVCSYLLIGFWYSKESXXXXXXXXXXXXXXSDFAFILG 186

Query: 152 XXXXXXITGTTQLPPFFQQVE-----DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLP 206
                   G+          E                         +GKSAQ+ L  WLP
Sbjct: 187 VITIIVYCGSANYKDVLSSAELLSNIKIFLHFSILDIICLLLFIGCMGKSAQIGLHVWLP 246

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTPVSALIH+ATM  AGVFLV R   LFE++PL L  +  +G  T L AA +A  
Sbjct: 247 DAMEGPTPVSALIHAATMVTAGVFLVARCSYLFEYSPLILQFITIIGGVTCLFAASIAIM 306

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRD 326
             D+K+++A+ST SQ                 FHL  HA FK+ LFLS G++  A   +D
Sbjct: 307 HSDIKKIIAYSTCSQLGYMFMACGVSAYNSGIFHLVTHAFFKALLFLSAGSVIHAVHEQD 366

Query: 327 LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLIL 386
           + ++G L  ++P T                L+G++S++ +L  A S  +   +F +   +
Sbjct: 367 IFKMGDLRNKMPVTYGNFLIGSLALIGIYPLAGFYSKDSILEAAYSSGSFMFIFGIAAAI 426

Query: 387 LAGIYIGRAAMATF 400
           L  IY  +  M  F
Sbjct: 427 LTAIYSMKIIMLVF 440


>NUOL_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 712

 Score =  164 bits (416), Expect = 1e-42
 Identities = 127/397 (31%), Positives = 177/397 (44%), Gaps = 28/397 (7%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMAD-------EAGRQRFF 84
           L W   G  + +  +  DRL   M  +V  ++  V +YS  YMA        EA + RFF
Sbjct: 60  LDWIRSGALDTSWGIRLDRLTAIMLIVVTTVSALVHLYSWGYMAHDENWTHHEAYKARFF 119

Query: 85  AWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXX 144
           A+LSFF   M            F  WEGVG+AS++LIG ++ +  A  AA KA ++ R  
Sbjct: 120 AYLSFFTFAMLMLVTSDNLVQMFFGWEGVGVASYLLIGFYYKKPSANAAAIKAFVVNRVG 179

Query: 145 XXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX--------IGKS 196
                        +T +  +   F    +                           +GKS
Sbjct: 180 DFGFALGIMGLFFLTDSIDMDVIFASAPELAKTELHFLAWEFXXXXXXXXXXFIGAMGKS 239

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFT 256
           AQL L  WLP+AM  PTPVSALIH+ATM  AGVFLV R+ PLFE+AP A  +        
Sbjct: 240 AQLFLHTWLPDAMEGPTPVSALIHAATMVTAGVFLVCRMSPLFEYAPEAKMMXXXXXXXX 299

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG 316
                     Q D+KR++A+ST SQ                 FHL  HA FK+ LFL  G
Sbjct: 300 XXXXXXXXXXQNDIKRVIAYSTCSQLGYMFVAAGSGVYSVAMFHLLTHAFFKAMLFLGAG 359

Query: 317 ALERAT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL-----------LSGYWSEE 364
           ++  A    +D+R  GGL K++P+T               +            +GY S++
Sbjct: 360 SVIHAMHHEQDMRNYGGLRKKIPFTFAIMMIGTLAITGVGIPFFSIGGVPVGFAGYLSKD 419

Query: 365 ELLRQAVSVHTAWGVFMLVLIL-LAGIYIGRAAMATF 400
            ++  A +    +  ++LV    +   Y  R    TF
Sbjct: 420 AIIESAFASGNGFAFYVLVAAAGMTSFYSWRLIFLTF 456


>NUOL_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 614

 Score =  164 bits (416), Expect = 1e-42
 Identities = 106/346 (30%), Positives = 166/346 (47%), Gaps = 11/346 (3%)

Query: 29  EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLS 88
           ++   W ++  F++      D L   M  ++  + L + ++S  YM  + G+ RFFA+ +
Sbjct: 62  QILWKWLSINEFKIDFGFFLDGLSLSMLFVITGVGLLIHIFSSWYMRYKEGQSRFFAYTN 121

Query: 89  FFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXX 148
            F+  M            ++ WEGV + S++LIG ++ + K    AFKA ++TR      
Sbjct: 122 LFIASMSVLVLADNFLFMYLGWEGVSVCSYLLIGFYYTELKNNLCAFKAFILTRVSDVFL 181

Query: 149 XXXXXXXXXITGTTQLPPF-----FQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                       +           F  VE+                   IGKSAQLPL  
Sbjct: 182 MIGMFLIYREFNSFNFQEIKFLSSFLNVENFYYLDYITLFLLLGV----IGKSAQLPLQT 237

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALV 263
           WL +AM  PTPVSALIH+ATM  AGV+L+ R   LF   P  L +V  +G  T L++++ 
Sbjct: 238 WLSDAMVGPTPVSALIHAATMVTAGVYLIARTHFLFLLTPGILYLVGLIGTLTILVSSIS 297

Query: 264 ATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGAL-ERAT 322
           A  Q D+KR+LA+ST+SQ                  HL +HA FK+ LFLS G+L +   
Sbjct: 298 ALVQKDIKRILAYSTMSQIGYMFLALGVKAWSAAITHLIMHAIFKALLFLSAGSLIKSCK 357

Query: 323 GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLL-SGYWSEEELL 367
             +++ ++GGL K+LP+               PL+ +G++S+  +L
Sbjct: 358 NEKNIFKMGGLRKQLPFLYISFIVGGASLVSFPLITAGFYSKGNIL 403


>NU5M_TRIRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;
          Length = 692

 Score =  164 bits (416), Expect = 1e-42
 Identities = 122/338 (36%), Positives = 170/338 (50%), Gaps = 3/338 (0%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F +  +   D L   M   V  I+  V  YS+ YM+ +   QRFF++LS F  M
Sbjct: 64  WLDSESFNMVWNFQFDSLTVSMLIPVLVISSLVHFYSIGYMSHDPHSQRFFSYLSLFTFM 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVG+ S++L+     +  A Q++  A L  R           
Sbjct: 124 MIILVTGNNYLLMFVGWEGVGVCSYLLVSFWFTRIAANQSSLSAFLTNRVGDCFLTIGMF 183

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                 G       F                        + KS+Q+ L  WLP AM  PT
Sbjct: 184 VILWSLGNLDYSTVFSLAP--YXXXXXXXXXXXXXXXXAMAKSSQVGLHIWLPMAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSALIH+ATM  AGV+L++R  PL E++   L + LW+GA T + ++L+   Q D+K++
Sbjct: 242 PVSALIHAATMVTAGVYLLIRSSPLIEYSSTVLLICLWLGAVTTVFSSLIGLFQQDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TGTRDLRQLGG 332
           +A+ST+SQ                 FHL  HA +K  LFL  GA+  A    +DLR+ GG
Sbjct: 302 IAYSTMSQLGMMVIAIGLSSYNVAIFHLINHAFYKGLLFLGAGAVIHAVVDNQDLRKYGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           L   LP T              P ++G++S++ +L  A
Sbjct: 362 LISFLPLTYTVILIASLSLVAFPFMTGFFSKDFILESA 399


>NU5M_MACRO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 602

 Score =  164 bits (416), Expect = 1e-42
 Identities = 109/366 (29%), Positives = 161/366 (43%), Gaps = 12/366 (3%)

Query: 14  FISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYS 70
           F S  A+L       E  +T   WF++    +T+S   D        +  ++   +  +S
Sbjct: 46  FTSLPALLLFINTGQESTITNWQWFSIESLNMTMSFKLDYFSIIFIPIALYVTWSILEFS 105

Query: 71  VPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKA 130
           + YM  +    RFF +L  F+  M            FI WEGVG+ SF+LIG   G+  A
Sbjct: 106 LWYMHSDPYIHRFFKYLITFLLTMIILVSANNLFQLFIGWEGVGIMSFMLIGWWFGRTDA 165

Query: 131 RQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXX 190
             AA +A+L  R                  +  L   F    D                 
Sbjct: 166 NTAALQAVLYNRIGDIGFMLAMAWLMINNSSWDLQHIFMTNMDTLALMGLVIAAT----- 220

Query: 191 XXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVL 250
              GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++R  P+ +  P  L   L
Sbjct: 221 ---GKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRFHPMIKDNPTILTTTL 277

Query: 251 WVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSA 310
            +GA T L  A+ A  Q D+K+++A+ST SQ                  H+  HA FK+ 
Sbjct: 278 CLGAITTLFTAICAITQNDIKKIVAFSTSSQLGLMMVTIGLNQPYLAFLHICTHAFFKAM 337

Query: 311 LFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           LFL  G+ +      +D+R++GGL   +P T              P L+G++S++ ++  
Sbjct: 338 LFLCSGSIIHNLNDEQDIRKMGGLLNIMPITSSALITGSLALMGTPFLAGFYSKDSIIEA 397

Query: 370 AVSVHT 375
             + HT
Sbjct: 398 MNTSHT 403


>NU5M_GORGO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  164 bits (416), Expect = 1e-42
 Identities = 126/385 (32%), Positives = 185/385 (48%), Gaps = 9/385 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T    +L++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WATTQTIQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQFFKYLLIFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  + +  A  AA +A+L  R           
Sbjct: 128 MLILVTANNLFQLFIGWEGVGIMSFLLIGWWYARTDANTAAVQAILYNRIGDIGFILALA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + +      +   +                     GKSAQL L  WLP AM  PT
Sbjct: 188 WFLLHSNS------WDPQQMSXXXXXXXXXXXXGFLLAAAGKSAQLGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R   L E+  LA  + L +GA T L AA+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFRHLAENNSLAQTLTLCLGAITTLFAAVCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMVATIGIGQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGV-FMLVLILLAGI 390
           L K +P T              P L+G++S++ ++  A   HT AW +  +L+   L   
Sbjct: 362 LLKAMPLTSTSLAIGSLALMGMPFLTGFYSKDLIIETANMSHTNAWALSIILIATSLTSA 421

Query: 391 YIGRAAMATFGLAPQAVMPANRRES 415
           Y  R  + T    P+    AN  E+
Sbjct: 422 YSTRMILLTLTGQPRFPTFANINEN 446


>NU5M_PANTR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  164 bits (415), Expect = 2e-42
 Identities = 111/385 (28%), Positives = 172/385 (44%), Gaps = 9/385 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T    +L++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WATTQTTQLSLSFKLDYFSMTFIPVALFVTWSIMEFSLWYMDSDPNINQFFKYLLIFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LI   + +  A  AA +A+L  R           
Sbjct: 128 MLILVTANNLFQLFIGWEGVGIMSFLLISWWYARTDANTAAIQAILYNRIGDIGFVLALA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + +      +   +                     GKSAQL L  WLP AM  PT
Sbjct: 188 WFLLHSNS------WDPQQMILLSTNTDLTPLLGFLLAAAGKSAQLGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E+ PL   + L +GA T L AA+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFYPLAENNPLIQTLTLCLGAITTLFAAVCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGV-FMLVLILLAGI 390
           L K +P T              P L+G++S++ ++  A +S   AW +   L+   L   
Sbjct: 362 LLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDLIIETANMSYTNAWALSITLIATSLTSA 421

Query: 391 YIGRAAMATFGLAPQAVMPANRRES 415
           Y  R  + T    P+     N  E+
Sbjct: 422 YSTRMILLTLTGQPRFPTLTNINEN 446


>NU5M_FELCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  164 bits (415), Expect = 2e-42
 Identities = 112/346 (32%), Positives = 167/346 (48%), Gaps = 8/346 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W ++   +L++S   D        +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 68  WLSIQTLKLSLSFKMDYFSTIFIPVALFVTWSIMEFSMWYMHSDPYINRFFKYLLMFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+A A  AA +A+L  R           
Sbjct: 128 MMILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAILYNRIGDVGFIMAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                +        FQQ+                      GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLTNSNAWD----FQQI--FITQHENLNIPXXXXXXAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R +PL E       + L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFYPLMEQNKTMQTLTLCLGAITTLFTAICALTQNDIKKV 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMIVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AW 377
           L K +P+T              P L+G++S++ ++  A + +T AW
Sbjct: 362 LYKPMPFTTTSLIIGSLALTGMPFLTGFYSKDLIIETANTSYTNAW 407


>NU5C_CARTI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 743

 Score =  164 bits (415), Expect = 2e-42
 Identities = 133/407 (32%), Positives = 189/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+          
Sbjct: 48  LSIVMIFSMNLSIHQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLMPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKISFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5M_CERSI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  164 bits (414), Expect = 2e-42
 Identities = 104/346 (30%), Positives = 157/346 (45%), Gaps = 8/346 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WMTIQTLKLSLSFKLDYFSMIFVPVALFVTWSIMEFSMWYMHSDPHITQFFKYLLMFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LI   +G+  A  AA +A+L  R           
Sbjct: 128 MMILVTANNLFQLFIGWEGVGIMSFLLISWWYGRTDANTAALQAILYNRIGDIGFIMSMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                T +  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLFNTNSWDLQQIFS------LNYNHTDLPLMGLLLAATGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+        L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMENNKTVQTFTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMIVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHNLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AW 377
           L K +P+T              P L+G++S++ ++  A + +T AW
Sbjct: 362 LFKAMPFTSTSLIIGSLALTGMPFLTGFYSKDLIIETANTSYTNAW 407


>NU5M_MYOGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  163 bits (413), Expect = 3e-42
 Identities = 127/377 (33%), Positives = 187/377 (49%), Gaps = 9/377 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+    LT              +  ++   +  +S+ YM  +    RFF +L  F+  
Sbjct: 68  WMTIQTLNLTXXXXXXXXXXXXVPVALFVTWSIMEFSLWYMHSDPYINRFFKYLLLFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 MIILVTANNLFQLFIGWEGVGIMSFLLIGWWYGRPDANTAALQAVLYNRIGDIGFVLSMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + +      ++                         KSAQ  L  WLP AM  PT
Sbjct: 188 WFLMHSSS------WEXXXXXXXXXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R +P  ++  L  ++++ +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFYPFIKNNQLVQSIIMCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                 FH+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 IAFSTSSQLGLMMVTIGINQPYLAFFHICTHAFFKAMLFMCSGSIIHNLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGV-FMLVLILLAGI 390
           L K LP+T              P L+G++S++ ++  A + +T AW +   L+   L  I
Sbjct: 362 LFKTLPFTSSELTVGSLTLTGTPYLTGFYSKDLIIESANTSYTNAWALSITLIATSLTAI 421

Query: 391 YIGRAAMATFGLAPQAV 407
           Y  R         P+ V
Sbjct: 422 YSTRIIFLLIRSKPRFV 438


>NU5M_HYLLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  163 bits (413), Expect = 3e-42
 Identities = 114/343 (33%), Positives = 166/343 (48%), Gaps = 7/343 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W      EL++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WTATQTLELSLSFKLDYFSMMFIPIALFVTWSIMEFSLWYMHSDPNINQFFKYLLIFLTT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  H + +A  AA +A+L  R           
Sbjct: 128 MLILVTANNLFQLFIGWEGVGIMSFLLIGWWHAREEANTAAIQAILYNRIGDIGFILALA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                T +      ++  +                     GKSAQL L  WLP AM  PT
Sbjct: 188 WFLLHTNS------WEPQQMILLNSNPNFXXXXXXXXXXRGKSAQLGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+  L   + L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLTENNQLIQTLTLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMVVTIGINQPYLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT 375
           L K LP T              P L+G++S++ ++  A   +T
Sbjct: 362 LFKTLPLTSTSLTIGSLALTGMPFLTGFYSKDLIIETANMSYT 404


>NU5M_DIDMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 602

 Score =  163 bits (413), Expect = 3e-42
 Identities = 101/343 (29%), Positives = 156/343 (45%), Gaps = 9/343 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           WF++  F +++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 70  WFSIHSFNISMSFKMDFFSIIFIPIALFVTWAILEFSLWYMHSDPNISQFFKYLIIFLLT 129

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G++ A  AA +A+L  R           
Sbjct: 130 MIILVSANNLFQLFIGWEGVGIMSFLLIGWWYGRSDANTAALQAILYNRIGDIGFMLTMA 189

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  +  L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 190 WLMLNCNSWDLQHIFSM--------NMHPIALLGLIIAATGKSAQFSLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R  P+ E+    L + L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFHPMLENNKTMLTITLCLGALTTLFTAMCAIMQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTVGLNQPHLAFLHICTHAFFKAMLFLCSGSIIHNLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT 375
           L   LP T              P L+G++S++ ++    + +T
Sbjct: 362 LFYTLPITSSALMTGSLALMGTPFLAGFYSKDSIIEAMNTSYT 404


>NU5C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 702

 Score =  163 bits (413), Expect = 3e-42
 Identities = 138/382 (36%), Positives = 191/382 (50%), Gaps = 19/382 (4%)

Query: 8   LAVGGIFISALAVLP------LSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAW 61
           L++G + ++ L  +       +S +     ++W  V    L +    D L   M      
Sbjct: 43  LSIGALLVTMLLSITVLWEQVISDSAYRQLVSWIKVDNLFLEIGCLVDPLSAIMXXXXXX 102

Query: 62  IALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLI 121
                 +Y+  YM+ + G  RFFA+LS F   M            +  WE VG+ S++L+
Sbjct: 103 XXXXXMIYTHGYMSHDQGYVRFFAYLSLFTASMLGLVLSPNLVQVYAFWELVGMCSYLLV 162

Query: 122 GQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPF----FQQVEDXXXX 177
           G    +  A  A  KA +  R                  + +         Q + +    
Sbjct: 163 GFWFTRPSAAYACQKAFITNRVXXXXXXXXXXXXXXXXXSLEFDIVASRAHQLLVENSAN 222

Query: 178 XXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                          I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAGV+LV RL P
Sbjct: 223 XXXXXXXXXXXFLGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGVYLVARLLP 282

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
           LF+  PL + +V W G  TA++ A VA AQ DLK+ LA+ST+SQ                
Sbjct: 283 LFQEVPLVMDIVAWTGGITAVLGATVALAQKDLKKGLAYSTMSQLGYMILALGVGSYQAG 342

Query: 298 XFHLTVHATFKSALFLSVGA----LERATG-----TRDLRQLGGLGKRLPWTXXXXXXXX 348
            FHL  HA  K+ LFL  G+    +E   G     ++++  +GGL   +P T        
Sbjct: 343 LFHLITHAYSKALLFLGSGSVIHGIEPVVGYNPNQSQNMTYMGGLRSYMPITGVTFLIGT 402

Query: 349 XXXXXXPLLSGYWSEEELLRQA 370
                 P  + +WS++E+L  A
Sbjct: 403 LSLCGVPPFACFWSKDEILADA 424


>NU5C_MALAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 707

 Score =  163 bits (413), Expect = 3e-42
 Identities = 131/407 (32%), Positives = 192/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++G+   +   +W     F        D L   M+ L+  + + V
Sbjct: 48  LSIVMIFSIDLSIQQINGSYIYQYVWSWTINNDFSFEFGYFIDSLTSIMSILITTVGIFV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++S F   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSLFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPAAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQXLFEIFNNLIYNNEVHLLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM A G+FLV RL PLF   
Sbjct: 228 LCASLLFAGAVAKSAQFPLHVWLPDAMXGPTPISALIHAATMVATGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +  AQ  +KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISLIGIITVLLGATLPLAQKXIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K  P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEAVVGYSPEKSQNMVLMGGLRKHAPITQIAFLIGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSDSWLYSPIFAIIAWSTAGLTAFYMFRIYLLTF 454


>NU5M_PANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  163 bits (412), Expect = 4e-42
 Identities = 124/385 (32%), Positives = 183/385 (47%), Gaps = 9/385 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T    +L++S   D        +  ++   +  +S+ YM  +    +FF +L  F+  
Sbjct: 68  WATTQTTQLSLSFKLDYFSMTFIPVALFVTWAIMEFSLWYMNSDPNINQFFKYLLIFLIT 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LI   + +  A  AA +A+L  R           
Sbjct: 128 MLILVTANNLFQLFIGWEGVGIMSFLLISWWYARTDANTAAIQAILYNRIGDIGFILALA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                + +      +   +                     GKSAQL L  WLP AM  PT
Sbjct: 188 WFLLHSNS------WDPQQMVXXXXXXXXXXXXGFLLAAAGKSAQLGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+ PL   + L +GA T L AA+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLAENNPLIQTLTLCLGAITTLFAAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGV-FMLVLILLAGI 390
           L K +P T              P L+G++S++ ++  A +S   AW +   L+   L   
Sbjct: 362 LLKTMPLTSTSLIIGSLALAGMPFLTGFYSKDLIIETANMSYMNAWALSITLIATSLTSA 421

Query: 391 YIGRAAMATFGLAPQAVMPANRRES 415
           Y  R  + T    P+     N  E+
Sbjct: 422 YSTRMILLTLMGQPRFPTLTNINEN 446


>NU5C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 760

 Score =  163 bits (412), Expect = 4e-42
 Identities = 120/347 (34%), Positives = 165/347 (47%), Gaps = 15/347 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFF ++SFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDSYMSHDQGYLRFFVYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVE------DXXXXXXXXX 182
               A  KA +  R               ITG+ +    F+         D         
Sbjct: 170 IVSNACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNDNEVHFLFVT 229

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 230 LCAFLLFSGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVVI 289

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 290 PYIMKLIALIGIITVLLGATLAFAQKDIKRGLAYSTMSQLGYTMLALGMGSYRAALFHLI 349

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 350 THAYSKALLFLGSGSIIHSMEGIVGYSPDKSQNMVLMGGLTKHVPITKIAFLLGTLSLCG 409

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  + S    + +       L   Y+ R  + TF
Sbjct: 410 IPPLACFWSKDEILNDSWSYSPIFAIIAFSTAGLTAFYMFRVYLLTF 456


>NU5C_DAUCA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  163 bits (412), Expect = 4e-42
 Identities = 132/407 (32%), Positives = 186/407 (45%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+   +   +W     F L      D                V
Sbjct: 48  LSIVMLFSINLSIQQINGSSIYQYVWSWIINNDFSLEFGYLIDPXXXXXXXXXXXXXXXV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSYDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPVAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFKILNNLISNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 FCAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLIPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  VG  T L  A  A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLVGVITILFGATFALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYSPNKSQNMVFMGGLTKHVPITKTSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L         + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDTWLYSPIFAIIAWFTAGLTAFYMFRIYLLTF 454


>NQO12_PARDE RecName: Full=NADH-quinone oxidoreductase chain 12;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I,
           chain 12;AltName: Full=NDH-1, chain 12;
          Length = 703

 Score =  163 bits (412), Expect = 4e-42
 Identities = 127/354 (35%), Positives = 165/354 (46%), Gaps = 21/354 (5%)

Query: 8   LAVGGIFISALA----VLPLSGADAEV-ALTWFTVGPFELTVSLAADRLGWWMATLVAWI 62
           L  G +F+S L      L   G    +  L W   G F    ++  DRL   M  +V  +
Sbjct: 31  LTTGVLFLSCLISWYLFLSFDGVPRHIPVLDWVVTGDFHAEWAIRLDRLTAIMLIVVTTV 90

Query: 63  ALPVAVYSVPYMA-------DEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGL 115
           +  V +YS+ YMA       DE  + RFFA+LSFF   M            F  WEGVG+
Sbjct: 91  SALVHMYSLGYMAHDDNWTHDEHYKARFFAYLSFFTFAMLMLVTADNLLQMFFGWEGVGV 150

Query: 116 ASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXX 175
           AS++LIG ++             ++ R               +TG+ Q    F+QV    
Sbjct: 151 ASYLLIGFYYXXXXXXXXXXXXFIVNRVGDXXXXXXXXXXYWLTGSVQFDEIFRQVPQLA 210

Query: 176 XXXXXXXXXXXXXXXXX--------IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAA 227
                                    +GKSAQL L  WLP+AM  PTPVSALIH+ATM  A
Sbjct: 211 QTEIDFLWRDWNAANLLGFLLFVGAMGKSAQLLLHTWLPDAMEGPTPVSALIHAATMVTA 270

Query: 228 GVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXX 287
           GVFLV R+ PL+E AP A                     Q D+KR++A+ST SQ      
Sbjct: 271 GVFLVCRMSPLYEFAPDAKNXXXXXXXXXXXXXXXXXLVQNDIKRVIAYSTCSQLGYMFV 330

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERAT-GTRDLRQLGGLGKRLPWT 340
                      FHL  HA FK+ LFL  G++  A    +D+R  GGL K++P T
Sbjct: 331 AAGVGVYSAAMFHLLTHAFFKAMLFLGAGSVIHAMHHEQDMRNYGGLRKKIPLT 384


>NU5M_SCHCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 686

 Score =  162 bits (411), Expect = 5e-42
 Identities = 107/351 (30%), Positives = 165/351 (47%), Gaps = 18/351 (5%)

Query: 59  VAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASF 118
           V +I+  + ++SV YMA++   QRFF++LS F   M            F+ WEG+G+ S+
Sbjct: 109 VLFISFLIHLFSVNYMANDPHIQRFFSYLSLFTFFMAILVTGANYFVLFVGWEGIGVVSY 168

Query: 119 VLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQ------LPPFFQQVE 172
           +LI     + +A +AA  A    R                 G+        LP +  Q  
Sbjct: 169 LLINFWFTRIQANKAAILAFNTNRIGDMALSIAYFVMLPAFGSADFSTVFSLPAYINQTT 228

Query: 173 DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLV 232
                               + KS+Q+PL  WLP +M  PTPVSALIH+AT+  AG +L+
Sbjct: 229 --------ITIIGFLLLVGAMAKSSQIPLHNWLPGSMEGPTPVSALIHAATLVTAGSYLL 280

Query: 233 LRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXX 292
           +R  P+ E+AP  L V+  +GA TA  AA     Q D+KR++A+ST+SQ           
Sbjct: 281 IRSSPILEYAPTVLLVITIIGASTAFFAATCGLVQNDIKRIIAFSTISQLGYMVMAIGLS 340

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATG-TRDLRQLGGLGKRLPWTXXXXXXXXXXX 351
                  H   HA FK+ LFL  G++  A G  +D+R++GGL   LP+T           
Sbjct: 341 QYNVALAHTLFHAYFKALLFLGAGSVIHAFGDIQDVRKMGGLINFLPFTYAVMLVGTLSL 400

Query: 352 XXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATFGL 402
              P L+G++S++ ++  A   ++  G +  +   L  +  G  A  +F L
Sbjct: 401 LATPFLTGFYSKDLIIELAYGQYSFSGTYAYI---LGSVTAGLTAFYSFRL 448


>NU5C_WHEAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  162 bits (411), Expect = 5e-42
 Identities = 144/407 (35%), Positives = 201/407 (49%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVQLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGVNSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALI +ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIQAATMVAAGIFLLARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +  VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISLVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTTFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 760

 Score =  162 bits (411), Expect = 5e-42
 Identities = 120/347 (34%), Positives = 165/347 (47%), Gaps = 15/347 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFF ++SFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDSYMSHDQGYLRFFVYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVE------DXXXXXXXXX 182
               A  KA +  R               ITG+ +    F+         D         
Sbjct: 170 IVSNACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLIYNNDNEVHFLFVT 229

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 230 LCAFLLFSGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVVI 289

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 290 PYIMKLIALIGIITVLLGATLAFAQKDIKRGLAYSTMSQLGYTMLALGMGSYRAALFHLI 349

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 350 THAYSKALLFLGSGSIIHSMEVIVGYSPDKSQNMVLMGGLTKHVPITKIAFLLGTLSLCG 409

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  + S    + +       L   Y+ R  + TF
Sbjct: 410 IPPLACFWSKDEILNDSWSYSPIFAIIAFSTAGLTAFYMFRVYLLTF 456


>NU5C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 772

 Score =  162 bits (411), Expect = 5e-42
 Identities = 120/346 (34%), Positives = 166/346 (47%), Gaps = 14/346 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+ V +               
Sbjct: 170 IAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTL 229

Query: 189 XXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P
Sbjct: 230 CSFLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVITP 289

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
             + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL  
Sbjct: 290 YIMNLISLIGIITVLLGATLALAQKDIKRSLAYSTMSQLGYMMLALGMGSYRAALFHLIT 349

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T              
Sbjct: 350 HAYSKALLFLGSGSIIHSMESIVGYSPDKSQNMVLMGGLKKHVPITKTAFLVGTLSLCGI 409

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P L+ +WS++E+L  +      + +           Y+ R  + TF
Sbjct: 410 PPLACFWSKDEILNDSWLYSPIFAIIACSTAGFTAFYMFRVYLLTF 455


>NU5C_OENGL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 772

 Score =  162 bits (411), Expect = 5e-42
 Identities = 120/346 (34%), Positives = 166/346 (47%), Gaps = 14/346 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+ V +               
Sbjct: 170 IAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTL 229

Query: 189 XXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P
Sbjct: 230 CSFLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVITP 289

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
             + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL  
Sbjct: 290 YIMNLISLIGIITVLLGATLALAQKDIKRSLAYSTMSQLGYMMLALGMGSYRAALFHLIT 349

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T              
Sbjct: 350 HAYSKALLFLGSGSIIHSMESIVGYSPDKSQNMVLMGGLKKHVPITKTAFLVGTLSLCGI 409

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P L+ +WS++E+L  +      + +           Y+ R  + TF
Sbjct: 410 PPLACFWSKDEILNDSWLYSPIFAIIACSTAGFTAFYMFRVYLLTF 455


>NU5C_OENEH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 777

 Score =  162 bits (411), Expect = 5e-42
 Identities = 120/346 (34%), Positives = 166/346 (47%), Gaps = 14/346 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+ V +               
Sbjct: 170 IAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTL 229

Query: 189 XXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P
Sbjct: 230 CSFLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVITP 289

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
             + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL  
Sbjct: 290 YIMNLISLIGIITVLLGATLALAQKDIKRSLAYSTMSQLGYMMLALGMGSYRAALFHLIT 349

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T              
Sbjct: 350 HAYSKALLFLGSGSIIHSMESIVGYSPDKSQNMVLMGGLKKHVPITKTAFLVGTLSLCGI 409

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P L+ +WS++E+L  +      + +           Y+ R  + TF
Sbjct: 410 PPLACFWSKDEILNDSWLYSPIFAIIACSTAGFTAFYMFRVYLLTF 455


>NU5C_OENBI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 772

 Score =  162 bits (411), Expect = 5e-42
 Identities = 120/346 (34%), Positives = 166/346 (47%), Gaps = 14/346 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+ V +               
Sbjct: 170 IAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTL 229

Query: 189 XXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P
Sbjct: 230 CSFLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVITP 289

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
             + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL  
Sbjct: 290 YIMNLISLIGIITVLLGATLALAQKDIKRSLAYSTMSQLGYMMLALGMGSYRAALFHLIT 349

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T              
Sbjct: 350 HAYSKALLFLGSGSIIHSMESIVGYSPDKSQNMVLMGGLKKHVPITKTAFLVGTLSLCGI 409

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P L+ +WS++E+L  +      + +           Y+ R  + TF
Sbjct: 410 PPLACFWSKDEILNDSWLYSPIFAIIACSTAGFTAFYMFRVYLLTF 455


>NU5C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 772

 Score =  162 bits (411), Expect = 5e-42
 Identities = 120/346 (34%), Positives = 166/346 (47%), Gaps = 14/346 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+ V +               
Sbjct: 170 IAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFEIVNNLIDNNNQVHFLFVTL 229

Query: 189 XXXX-----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P
Sbjct: 230 CSFLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFVITP 289

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
             + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL  
Sbjct: 290 YIMNLISLIGIITVLLGATLALAQKDIKRSLAYSTMSQLGYMMLALGMGSYRAALFHLIT 349

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T              
Sbjct: 350 HAYSKALLFLGSGSIIHSMESIVGYSPDKSQNMVLMGGLKKHVPITKTAFLVGTLSLCGI 409

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P L+ +WS++E+L  +      + +           Y+ R  + TF
Sbjct: 410 PPLACFWSKDEILNDSWLYSPIFAIIACSTAGFTAFYMFRVYLLTF 455


>NU5C_MAIZE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 738

 Score =  162 bits (411), Expect = 5e-42
 Identities = 143/407 (35%), Positives = 201/407 (49%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSLHLSIQQINGSSIYQYLWSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLLARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  ++ +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PWIMSFISLIGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYVPITRTTFLCGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_FAGEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 751

 Score =  162 bits (411), Expect = 5e-42
 Identities = 127/381 (33%), Positives = 179/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YM  + G  RFFA+LSFF  
Sbjct: 74  SWTINNDFSLEFGYLVDPLTSIMSMLITTVGILVLIYSDNYMVHDQGYLRFFAYLSFFNT 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNFIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                   + +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 194 XXXXXXXXSFEFRDLFEIFNTLIYNNEVHFLVGTVCTFLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RLFPL    P  L ++  VG  T  + A +A+   
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLFPLLIVTPFILNLIALVGIITLFLGATLASCSK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALLFLGSGCVIHSMEAIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E++         + +
Sbjct: 374 SPDKSQNMVFMGGLKKHVPITKTAFLLGTLSLSGIPPLACFWSKDEIINDTWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                +     Y+ R  + TF
Sbjct: 434 ISWATVGFTAFYMFRIYLLTF 454


>NU5C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 734

 Score =  162 bits (411), Expect = 5e-42
 Identities = 132/345 (38%), Positives = 178/345 (51%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMSFFNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXX 184
            A  A  KA +  R               ITG+ +    FQ     + +           
Sbjct: 170 SAATACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFRDLFQILNNLIYNNEVPXXXXXXX 229

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P 
Sbjct: 230 XXXXXAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIIIPY 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            +  +  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 IMNFISLIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMVLMGGLKKHVPITKTAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSWLYSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>PHAAB_RHIME RecName: Full=Probable K(+)/H(+) antiporter subunit
           A/B;AltName: Full=pH adaptation potassium efflux system
           protein A/B;
          Length = 999

 Score =  162 bits (410), Expect = 6e-42
 Identities = 139/389 (35%), Positives = 184/389 (47%), Gaps = 21/389 (5%)

Query: 24  SGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRF 83
           SG      + W  V    L  +L  D   W  + L+  I + VA+Y+  YMA+E    RF
Sbjct: 81  SGGVLHYRIDW--VPELGLNFTLRMDGFAWLFSALITAIGVLVALYARYYMAEEDPVPRF 138

Query: 84  FAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRX 143
           FA    F+G M             + WE   + SF+LIG  H  A AR  A  AL +T  
Sbjct: 139 FALFLAFMGSMLGVVLSGNLILLAVFWELTSIVSFLLIGYWHHNAHARDGARMALTITGT 198

Query: 144 XXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                         I G+ +L        D                   + KSAQ P   
Sbjct: 199 GGLAMFVGLIIIGKIVGSYELDAVLAS-GDAIRNHPLYGTXXXXXXXGALTKSAQFPFHF 257

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALV 263
           WLP AMAAPTPVSA +HSATM  AGVFL++R +P+         +V              
Sbjct: 258 WLPHAMAAPTPVSAYLHSATMVKAGVFLLVRFWPVMAGTEAWFWIVXXXXXXXXXXXXYF 317

Query: 264 ATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALER 320
           A  Q DLK LLA+ST+S                     FH+  HATFK++LF++ G ++ 
Sbjct: 318 AIFQQDLKGLLAYSTISHLGLITVLLSLGSPLAAVAAVFHIVNHATFKASLFMAAGIIDH 377

Query: 321 ATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH------ 374
            +GTRD+R+LGGL   +P                PLL+G+ S+E    +A+  H      
Sbjct: 378 ESGTRDIRRLGGLFHFMPIXXXXXXXXXXXXXGVPLLNGFLSKEMFFAEAIETHLVNPLD 437

Query: 375 -------TAWGVFMLV--LILLAGIYIGR 394
                  T  G+F +   L  + G++ GR
Sbjct: 438 TVTPYVATIAGMFAVTYSLRFIHGVFFGR 466


>NU5M_ROUAM RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 605

 Score =  162 bits (409), Expect = 8e-42
 Identities = 128/364 (35%), Positives = 184/364 (50%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D     +  +   +   +  +S+ YM  +    RFF +       
Sbjct: 68  WMTIQTLKLSLSFKLDYFSMILMPVALSVTWSIMEFSMWYMHSDPYINRFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LIG  +G+  A  AA +A+L  R           
Sbjct: 128 XXXXVTANNLFQLFIGWEGVGIMSFLLIGWWYGRTDANTAALQAILYNRIGDVGFLVAMA 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T +L   F                          KSAQ  L  WLP AM  PT
Sbjct: 188 WFLFNLNTWELQQIF------XXXXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R +PL E       ++L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRFYPLTESNKTIQTMMLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMVTVGINQPHLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGI 390
           L K LP+T              P L+G++S++ ++    + +T AW +F+ L+   L  +
Sbjct: 362 LYKSLPFTTTALITGSLALTGMPFLTGFYSKDLIIESINTSYTNAWALFITLIATSLTAV 421

Query: 391 YIGR 394
           Y  R
Sbjct: 422 YSTR 425


>NU5C_PANGI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  162 bits (409), Expect = 8e-42
 Identities = 128/381 (33%), Positives = 177/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+            YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDQGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFKIFSNLIYNNEVNFLFVTLCAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  VG  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLIPLFIVIPHIMNLISLVGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETLVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E++         + +
Sbjct: 374 SPKKSQNMVFMGGLTKHVPITKTSFLFGTLSLCGIPPLACFWSKDEIINDTWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWSTAGLTAFYMFRIYLLTF 454


>NU5C_ASTCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  162 bits (409), Expect = 8e-42
 Identities = 132/407 (32%), Positives = 187/407 (45%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ +   +   +W     F L      D L   M+          
Sbjct: 48  LSIVMIFSMNLSIQQINSSSVYQYVWSWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDHGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     +           
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFQIFNNLISTNQVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+ R LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFLGATLALAQKDINRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKNSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5C_RANMC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 738

 Score =  161 bits (408), Expect = 1e-41
 Identities = 131/407 (32%), Positives = 185/407 (45%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  + G    +   +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIIMIFSVILSIKQIDGNPIYQYVWSWTINNDFSLDFGNFIDPLTSIMLILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +   FF+     +++         
Sbjct: 168 RPLAANACQKAFVTNRVGDFSLFLGILGLYWITGSFEFRDFFEIAKNLIDNNGYNXXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RLFPLF   
Sbjct: 228 XXXXXXXVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLFPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +                    Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNXXXXXXXXXXXXXXXXXXXQRDIKRSLAYSTMSQLGYIMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K  P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMENVVGYSPDKSQNMALMGGLTKYAPITKTSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +     +   L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFATIACLTAGLTAFYMFRMYLLTF 454


>NU5C_MUTAC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 744

 Score =  161 bits (408), Expect = 1e-41
 Identities = 132/407 (32%), Positives = 188/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++ + A +   +W       L      D L   M+          
Sbjct: 48  LSIVMIFSMNLSIQQINSSSAYQYVWSWIINNDVSLEFGYLIDPLTSIMSXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +I WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDHGYLRFFVYMSFFSTSMLGLVTSSNLIQIYIFWELVGICSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A +A  KA +  R               ITG+ +    FQ     + +         
Sbjct: 168 RPVAAKACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRNLFQIFNNLISNNEVNFLFVT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAVLLFAGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PHIMNFISLIGIITVFLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMETLVGYCPKKSQNMVLMGGLTKHVPITKTSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAWSTAGLTAFYMCRIYLLTF 454


>NU5M_PETMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 598

 Score =  161 bits (407), Expect = 1e-41
 Identities = 116/370 (31%), Positives = 166/370 (44%), Gaps = 10/370 (2%)

Query: 13  IFISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVY 69
           +FIS + +      + E  LT   W     F + +S   D+       +   I   +  +
Sbjct: 43  MFISLIPLTIYLNENMETTLTMKPWMDWALFNIALSFKIDKYTVIFTPIALMITWSIMEF 102

Query: 70  SVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAK 129
           S  YMA E    +FF +                    FI WEGVG+ SF+LI    G+ K
Sbjct: 103 SQWYMAKERHMDKFFKYXXXXXXXXXXXXSANNLLQLFIGWEGVGIMSFLLISWWSGRTK 162

Query: 130 ARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXX 189
           A  +A +A+   R                T +  L      + D                
Sbjct: 163 ANISALQAVAYNRIGDIGLMMSMVWMCSNTNSWDLQQITMLLSDQQYLIPTLGFLIAAT- 221

Query: 190 XXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVV 249
               GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AGVFL++RL PLF++ PL L + 
Sbjct: 222 ----GKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLIRLHPLFQNYPLMLEMT 277

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           L +GA T + AAL AT Q D+K+++A+ST SQ                  H+  HA FK+
Sbjct: 278 LCLGAMTTICAALCATTQNDIKKIIAFSTSSQLGLMMVAVGLNHPHIAFLHMCTHAFFKA 337

Query: 310 ALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR 368
            LFL  G+ +      +D+R+   L   LP T              P L+G+++++ +L 
Sbjct: 338 MLFLCSGSIIHNMNNEQDIRKFSCLNNNLPLTTTCMTIGSAALMGLPFLAGFFTKDLILE 397

Query: 369 QAVSVHT-AW 377
              + +T AW
Sbjct: 398 ALNTSYTNAW 407


>NU5C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 670

 Score =  160 bits (406), Expect = 2e-41
 Identities = 124/381 (32%), Positives = 171/381 (44%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W T     L +    D L   M  LV  + + V +Y+  YM+ + G  RFF +LS F  
Sbjct: 74  SWITTEAVSLQIGYIIDPLSSIMLVLVTTVGIAVMIYTDGYMSHDQGYVRFFLYLSLFTA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +  WE VG+ S++L+G    +  A  A  KA +  R          
Sbjct: 134 SMLGLVLSSNLVQIYAFWELVGMCSYLLVGFWFSRPSAAAACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGT----TQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+    T    F + +                     + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFDFETITTRFSELLNTNNVNVSFAIVCSLLLFLGPVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL P+F++ P+ +  +   G             Q 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPIFQNLPIVMDTIAITGVSXXXXXXXXXXXQR 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA----LERATG- 323
           DLKR LA+ST+SQ                 FHL  HA  K+ LFL  G+    +E   G 
Sbjct: 314 DLKRGLAYSTMSQLGYMMLALGLGSYKVGLFHLITHAYSKALLFLGSGSVIHGMEPTVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++D+  +GG+ K +P T              P  + +WS++E+L  A       G 
Sbjct: 374 NPNKSQDMGYMGGIRKYMPVTGITFLIGTLSLCGIPPFACFWSKDEILANAWEKMPILGW 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R    TF
Sbjct: 434 IAWFTAGLTAFYMFRIYFLTF 454


>NU5C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 734

 Score =  160 bits (406), Expect = 2e-41
 Identities = 124/348 (35%), Positives = 171/348 (49%), Gaps = 13/348 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W       L V    D L   M  LV  I + V ++S  YM+ + G  RFFA+LS    
Sbjct: 74  SWIPDQDVTLEVGYPIDPLTSIMLVLVTTIGVTVMIHSDSYMSHDQGYVRFFAYLSLSTA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I  E VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVISPNLIQIYIFRELVGMCSYLLIGFWFTRPSAANACQKAFITNRVGDFGLLLGT 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +    F++  +                       + KSAQ PL  WLP+A
Sbjct: 194 SGFYWITGSFKFEDLFERFNESLANHEVSLFLATPCALLFPLGPVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SA IH+ATM AAG+FLV R+FPLF+  PL ++ + WVG  TA + A VA AQ 
Sbjct: 254 MEGPTPISAPIHAATMVAAGIFLVARMFPLFQTLPLVMSSISWVGGVTASLGATVALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           DLKR+LA+ST+SQ                 FHL  HA  K+      G    ++E   G 
Sbjct: 314 DLKRVLAYSTMSQLGYMMLALGIGSYRAASFHLITHAYPKALSSPGSGSVIHSMEPIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
               ++++  +GGL K +P                P L+ +WS++E++
Sbjct: 374 CPDKSQNIALMGGLRKYVPIXXXXXXXXXXXXXXIPPLACFWSKDEII 421


>NU5C_CARCG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 743

 Score =  160 bits (406), Expect = 2e-41
 Identities = 127/381 (33%), Positives = 176/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L +    D L   M  L+  + + V +YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWVINNDFSLELGYLIDPLTSIMLILITTVGIMVLIYSDSYMSHDQGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVTNRXXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +    FQ V +                       + KSAQ PL  WLP+A
Sbjct: 194 XXFYWITGSFEFRDLFQIVTNLIYNNEVNLVFLTICAVLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  L ++ +               Q 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPYILNLISFXXXXXXXXXXXXXXXQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRSLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYPKALLFLGSGSVIHSMETVVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMVLMGGLTKHVPITKTAFFLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IACSTAGLTAFYMFRIYLLTF 454


>NU5M_RAT RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
              EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 610

 Score =  160 bits (405), Expect = 2e-41
 Identities = 112/353 (31%), Positives = 168/353 (47%), Gaps = 7/353 (1%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +LT+S   D       ++  ++   +  +S  YM  +    RF  +L  F+  
Sbjct: 68  WLTINSIKLTMSFKIDYFSILFLSVSLFVTWSIMQFSSWYMHSDPHINRFIKYLMMFLNN 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G A A  AA +A+L  R           
Sbjct: 128 MLILTSANNLFQLFIGWEGVGIMSFLLIGWWYGLADANTAALQAILYNRVGDIGFILAMT 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + +L   F                         GKSAQ  L  WLP AM  PT
Sbjct: 188 WFCLNMNSWELQQIFXXXXXXXXXXXXXXXIAAT------GKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R  PL  +    +  +L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLMIRFHPLTSNNSTIMTAMLCLGAITTLFTAICALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++G 
Sbjct: 302 VAFSTSSQLGLMMVTLGINQPYLAFLHICTHAFFKAMLFMCSGSIIHILNDEQDIRKMGN 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLI 385
           + K +P+T              P L+G++S++ ++    + +T     M+ LI
Sbjct: 362 MMKAMPFTSSCLIIGSLALTGMPFLTGFYSKDLIIEAINTCNTNAWALMITLI 414


>NU5C_PACAQ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 709

 Score =  160 bits (405), Expect = 2e-41
 Identities = 117/381 (30%), Positives = 168/381 (44%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F        D L   M+ L+  + + V +Y   YM+ + G  RFFA++S F  
Sbjct: 74  SWTINNDFSFEFGYFIDSLTSIMSILITTVGIFVLIYXDNYMSHDQGYLRFFAYMSLFNT 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +  WE VG+ S++LIG       A  A  KA +  R          
Sbjct: 134 SMLGLLTXSNLIQIYXFWELVGMCSYLLIGFWFTXPAAANACQKAFVTNRICDFGLSLXI 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG  +    F+     + +                   + KSAQ PL  WLP+A
Sbjct: 194 LRXYWITGXFEFQDLFEIFNNLIYNNEVHFLFVTLCASLLFAGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  + ++  +G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVPRLLPLFIVIPYIMNLISLIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALLFLGSGSIIHSMEAIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMVFMGGLRKHVPITQIAFLVGTLSLCGIPPLACFWSKDEILSDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y  R  + TF
Sbjct: 434 IAWSTAGLTASYXFRIYLLTF 454


>NU5C_ANIIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  160 bits (405), Expect = 2e-41
 Identities = 128/378 (33%), Positives = 175/378 (46%), Gaps = 18/378 (4%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+            YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWIINNDFSLEFGYLIDPLTSIMSXXXXXXXXXXXXYSDNYMSHDHGYLRFFAYMSFFST 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A +A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPVAAKACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +    FQ     + +                   I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFQIFNNLISNNEVNFFFVTLCAVLLFGGAIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALI +ATM AAG+FLV RL PLF   P  +  +  +G  T  + A +A AQ 
Sbjct: 254 MEGPTPISALIRAATMVAAGIFLVARLMPLFIVIPHIMNFISLIGIITVFLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSVIHSMETLVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-----VSVH 374
               ++++  +GGL K +P T              P L+ +WS++E+L  +     +   
Sbjct: 374 CPEKSQNMVLMGGLTKHVPITKNSFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAT 433

Query: 375 TAWGVFMLVLILLAGIYI 392
            AW    L    +  IY+
Sbjct: 434 IAWSTAGLTAFYMCRIYL 451


>NU5M_TRIRU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 653

 Score =  160 bits (404), Expect = 3e-41
 Identities = 101/333 (30%), Positives = 156/333 (46%), Gaps = 22/333 (6%)

Query: 52  GWWMATLVAWIALPVAV-------YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXX 104
           G++  +L   + +PV +       YS+ YM+ +   QRFF++LS F  MM          
Sbjct: 75  GFYFDSLTVSMLIPVLIVSSLVHIYSIGYMSHDPHNQRFFSYLSLFTFMMIILVTANNYL 134

Query: 105 XXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTT-- 162
             F+  EGVG+ S++L+     +  A Q++  A L  R                 G    
Sbjct: 135 LMFLGVEGVGVCSYLLVNFWFTRIAANQSSISAFLTNRVGDCFLTIGMFIIIWSFGNLDY 194

Query: 163 ----QLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSAL 218
                L P+F Q                      + KS+Q+ L  WLP+AM  PTPVSAL
Sbjct: 195 STVFSLAPYFNQ--------EFITLIGICLLIGAMAKSSQIGLHVWLPQAMEGPTPVSAL 246

Query: 219 IHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWST 278
           IH+ATM  AGV+L++R  PL E++   L + LW+GA T + ++++   Q D+K+++A+ST
Sbjct: 247 IHAATMVTAGVYLLMRSSPLIEYSSTVLILCLWLGAITTIFSSIIGLFQQDIKKVIAYST 306

Query: 279 VSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRL 337
           +SQ                 FHL  HA +K+ LFL  GA +   +  +D R+ GGL   L
Sbjct: 307 MSQLGMMVIAIGLSSYNLALFHLVNHAFYKALLFLGAGAVIHSVSDNQDFRKYGGLKPFL 366

Query: 338 PWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           P                P +SG++S++ +L  A
Sbjct: 367 PLAYSIMLIASLSLVAIPFMSGFYSKDFILESA 399


>NU5M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 675

 Score =  160 bits (404), Expect = 3e-41
 Identities = 115/349 (32%), Positives = 164/349 (46%), Gaps = 10/349 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           WF +G  +L      D +                 YS+ YM+ +    RF  +LS F   
Sbjct: 63  WFHIGLLKLNWLFLFDSITSXXXXXXXXXXXXXXXYSIDYMSGDPHIIRFLGYLSLFTFF 122

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVGL+S++LI   + + +A ++A KA+++ R           
Sbjct: 123 MLMLVTSGNFVQLFLGWEGVGLSSYLLINFWYTRIQANKSAMKAIIVNRFGDFGIYXXXX 182

Query: 154 XXXXIT---------GTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAW 204
                             Q      ++                     IGKSAQL L  W
Sbjct: 183 XXXXXXXXXXXXXXXNLVQFLDTQPRMSFLGFSLNRVDLIVIFLFLGAIGKSAQLGLHTW 242

Query: 205 LPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVA 264
           LP+AM  PTPVSALIH+ATM  AGVF+++R  P+ E++   L +V  +G  TAL A  V 
Sbjct: 243 LPDAMEGPTPVSALIHAATMVTAGVFVLIRSSPILEYSSTGLFLVSLIGGLTALFAGTVG 302

Query: 265 TAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TG 323
             QYD+K+++A+ST SQ                 FHL  H  FK+ LFL  G++  A   
Sbjct: 303 LVQYDIKKVIAYSTCSQLGYMFFACGMSNYSVGLFHLFNHGFFKALLFLGAGSVIHALLD 362

Query: 324 TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
            +D+R++GGL K +P T              P L+G++S+E +L  A S
Sbjct: 363 EQDMRKMGGLIKLMPLTYVAILVGSLSLTGFPFLTGFYSKEVVLEIAFS 411


>NU5C_AMBTC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  159 bits (403), Expect = 4e-41
 Identities = 133/410 (32%), Positives = 192/410 (46%), Gaps = 17/410 (4%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + L++  ++G      L +W       L      D L   M+ L+A + + V
Sbjct: 48  LSIVMVFSTNLSIQQINGNSIYQYLWSWTINSDSSLEFGYLIDSLTSIMSILIATVGMMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++ IG    
Sbjct: 108 LIYSDNYMSHDKGYLRFFAYMSFFNTSMLGLVISPNLIQIYIFWELVGMCSYLSIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQL-------PPFFQQVEDXXXXXX 179
           +  A  A  KA +  R               I G+ +                       
Sbjct: 168 RPSAANACQKAFVTNRVGDFXXXXXXXXXYWIAGSFEFRXXXXXXXXXXXXXXXXXXXXX 227

Query: 180 XXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF 239
                        + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PL 
Sbjct: 228 FAILCASLLFLGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLL 287

Query: 240 EHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXF 299
              P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 F
Sbjct: 288 TVIPYIMNLISLIGVITVLLGATLALAQKDIKRSLAYSTMSQLGYIMLASGIGSYRAALF 347

Query: 300 HLTVHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXX 350
           H   HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T          
Sbjct: 348 HSITHAYSKALLFLGSGSIIHSMEPILGYSPDKSQNMVFMGGLSKYVPITKATFLLGTLS 407

Query: 351 XXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
               P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 LCGIPPLACFWSKDEILNNSWLYSPIFAIIASSTTGLTAFYMFRMYLLTF 457


>NU5M_PAPHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  159 bits (401), Expect = 7e-41
 Identities = 115/385 (29%), Positives = 171/385 (44%), Gaps = 9/385 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W      +LT+S   D        +  +I   +  +S+ YM+ +    +FF +       
Sbjct: 68  WMMTQTLDLTLSFKLDYFSMMFIPIALFITWSIMEFSLWYMSSDPNINQFFKYXXXXXXX 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        FI WEGVG+ SF+LI   H +  A  AA +A+L  R           
Sbjct: 128 XXXXXXANNLFQLFIGWEGVGIMSFLLISWWHARTDANTAAIQAVLYNRIGDIGLILAMV 187

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  +      FQQ+                     +GKSAQ  L  WLP AM  PT
Sbjct: 188 WFLLHYNSWD----FQQM--LALNPHPSPLPLMGLLLAAVGKSAQFGLHPWLPSAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R  PL E+  L   + L +GA T L  A+ A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGVFLLIRFHPLMENDTLTQNLTLCLGAITTLFMAMCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 302 VAFSTSSQLGLMMITIGINQPYLAFLHICTHAFFKAMLFICSGSIIHNLNNEQDIRKMGG 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGV-FMLVLILLAGI 390
           L K +P T              P L+G++S++ ++    + +T AW +   L+   L   
Sbjct: 362 LFKTMPLTSTSLIIGNLALTGIPFLTGFYSKDLIIEATSTSYTNAWALSITLIATSLTSA 421

Query: 391 YIGRAAMATFGLAPQAVMPANRRES 415
           Y  R  + T    P+     N  E+
Sbjct: 422 YSTRTILLTLTGQPRFPTLTNINEN 446


>NU5C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 772

 Score =  159 bits (401), Expect = 7e-41
 Identities = 125/381 (32%), Positives = 171/381 (44%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +WF      L +    D L   M   V  + + V +YS  YM+ + G  RFFA+LS F  
Sbjct: 74  SWFFNKDISLQIGFLIDPLTSTMLVSVTSVGILVMIYSDSYMSHDQGYVRFFAYLSLFTA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVLSPNPVQIYIFWELVGMCSYLLIGFWFSRPSAANACQKAFITNRVGDFGLLLGI 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI----GKSAQLPLTAWLPEA 208
                ITG+  +    ++  D                         KSAQ PL  WLP+A
Sbjct: 194 LGTYWITGSFDIHSLSERFNDLIDSNGVNLFLANMCALLLFLGPAAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+F V R+F  FE  P  + ++ WV              Q 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFFVARMFHFFEALPFTMNIISWVXXXXXXXXXXXXXXQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           DLK+ LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DLKKGLAYSTMSQPGYMMLAPGIGSYRAASFHLITHAYSKALLFLGSGSVIHSMEPIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P                P  + +WS++E+L  +     + G 
Sbjct: 374 SPEKSQNMSFMGGLRKYMPIXXXXXXXXXXXXXXIPPFACFWSKDEILVDSWIASASLGW 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L G Y+ R    TF
Sbjct: 434 IAWCTAGLTGFYMFRMYFVTF 454


>NU5M_ORNAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 604

 Score =  158 bits (400), Expect = 9e-41
 Identities = 132/386 (34%), Positives = 186/386 (48%), Gaps = 14/386 (3%)

Query: 15  ISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSV 71
           IS + +L       E  +T   WFT   F L+++   D        +   I   +  +S+
Sbjct: 47  ISLVPMLSFLNGGVEATVTNWHWFTTQTFNLSMNFKLDLYTIMFLPIALLITWSIMEFSI 106

Query: 72  PYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKAR 131
            YM+ +    +F  +                    FI WEGVG+ SF+LIG  H +  A 
Sbjct: 107 WYMSSDPKINQFMKYXXXXXXXXXXXXSANNLFQLFIGWEGVGIMSFMLIGWWHARTDAN 166

Query: 132 QAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXX 191
            AA +A+L  R                T + +    FQQ+                    
Sbjct: 167 TAALQAILYNRIGDIGFILAMAWFLIHTNSWE----FQQM----FXXXXXXXXXXXXXXA 218

Query: 192 XIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW 251
             GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++R  PL E    AL + L 
Sbjct: 219 ATGKSAQFGLHPWLPFAMEGPTPVSALLHSSTMVVAGIFLLVRFSPLLEQNSTALTMALC 278

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           +GA T L  A  A  Q D+K+++A+ST SQ                  H+  HA FK+ L
Sbjct: 279 LGAITTLFTAACALTQNDIKKIIAFSTSSQLGLMMVTIGLNQPFLAFLHICTHAFFKAML 338

Query: 312 FLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           FL  G+ +      +D+R++GGL   LP T              P L+G++S++ ++   
Sbjct: 339 FLCSGSIIHNLNDEQDIRKMGGLINILPITSSALIIGSLALTGMPFLAGFYSKDLIIESL 398

Query: 371 VSVHT-AWGVFM-LVLILLAGIYIGR 394
            + +T AW + + LV      +Y  R
Sbjct: 399 NTSNTNAWALSLTLVATTFTAVYSTR 424


>NU5C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 747

 Score =  158 bits (400), Expect = 9e-41
 Identities = 116/345 (33%), Positives = 164/345 (47%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXX 184
            A  A  KA +  R               ITG+ +    FQ     ++            
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSLEFRDLFQIINNLIDQNEVNIFFITLC 229

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL P F   P 
Sbjct: 230 ALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPFFIAIPS 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            +  + ++G  T ++ A +A AQ D+K+ LA+ST+SQ                 FHL  H
Sbjct: 290 IMNGIAFIGIITVVLGATLAIAQKDIKKNLAYSTMSQLGYMMLALGMGSYRIALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPNKSQNMLLMGGLTKHVPITKTAFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
             + +WS++E+L  +      + +       L   Y+ R  +  F
Sbjct: 410 PFACFWSKDEILNDSWLYSPIFAIIACSTAGLTAFYMFRIYLLVF 454


>NU5C_CALFG RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  158 bits (400), Expect = 9e-41
 Identities = 129/407 (31%), Positives = 187/407 (45%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F        D L   M+ L+  + + V
Sbjct: 48  LSIAMVFSVNLSIQQINGSSIYQHLWSWTINNDFSFEFGHLIDPLTSIMSILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SF    M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFSNTSMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPTAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFTNLIHNNGVNSLFAT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCAFLLFVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++                AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLISXXXXXXXXXXXXXXXAQRDIKRSLAYSTMSQLGYIMLAPGIGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K LP T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPDKSQNVVLMGGLTKYLPITKTTFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIACSTAGLTAFYMVRVYLLTF 454


>MRPA_BACSU RecName: Full=Na(+)/H(+) antiporter subunit A;AltName:
           Full=Multiple resistance and pH homeostasis protein
           A;AltName: Full=Mrp complex subunit A;
          Length = 801

 Score =  158 bits (400), Expect = 9e-41
 Identities = 118/401 (29%), Positives = 172/401 (42%), Gaps = 25/401 (6%)

Query: 13  IFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVP 72
           I+   +  +  SG      L W        TV +  D LG   A L+  I   V +YS+ 
Sbjct: 43  IYFLPMIRMTQSGETLRSVLEWIPSLGINFTVYI--DGLGLLFALLITGIGSLVTLYSIF 100

Query: 73  YMADEAGRQR-FFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKAR 131
           Y++ E  +   F+ +L  F+G M            ++ WE   L+SF+LIG  + + K+R
Sbjct: 101 YLSKEKEQLGPFYVYLLMFMGAMLGVVLVDNVMVLYMFWELTSLSSFLLIGYWYKREKSR 160

Query: 132 QAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXX 191
             A K+LL+T                IT +  +     QV+                   
Sbjct: 161 YGAAKSLLITVSGGLCMLGGFILLYLITDSFSIREMVHQVQ-LIAGHELFIPAMILILLG 219

Query: 192 XIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW 251
              KSAQ P   WLP+AM APTPVSA +HSATM  AG++++ R  P+F  +     +V  
Sbjct: 220 AFTKSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGIYVIARFSPIFAFSAQWFWIVSL 279

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTVSQ--------------XXXXXXXXXXXXXXXX 297
           VG FT +  +  A  Q DLK +LA+STVSQ                              
Sbjct: 280 VGLFTMVWGSFHAVKQTDLKSILAFSTVSQLGMIISMLGVSAAALHYGHTEYYTVAAMAA 339

Query: 298 XFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLL 357
            FHL  HATFK +LF++VG ++  TGTRD+R+LGGL   +P T              P  
Sbjct: 340 IFHLINHATFKGSLFMAVGIIDHETGTRDIRKLGGLMAIMPITFTISLIGTFSMAGLPPF 399

Query: 358 SGYWSEEELLRQAVSVH-------TAWGVFMLVLILLAGIY 391
           +G+ S+E      + V          WGV   +   +  ++
Sbjct: 400 NGFLSKEMFFTSMLRVTHFDLFNVQTWGVLFPLFAWIGSVF 440


>NUOL_NEIMB RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 674

 Score =  158 bits (399), Expect = 1e-40
 Identities = 107/376 (28%), Positives = 165/376 (43%), Gaps = 13/376 (3%)

Query: 29  EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADE-AGRQRFFAWL 87
           E   TW T+G  + +V    D             +L V +Y++ YM DE  G QRFF+++
Sbjct: 65  ENVYTWLTMGGLDFSVGFLVDXXXXXXXXXXXXXSLMVHIYTIGYMHDEKVGYQRFFSYI 124

Query: 88  SFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXX 147
           S F   M            F  WE VGL S++LIG +  +  A  A  KA L+ R     
Sbjct: 125 SLFTFSMLMLIMSNNFIQLFFGWEAVGLVSYLLIGFYFKRPSATFANLKAFLINRVGDFG 184

Query: 148 XXXXXXXXXXITGTT----QLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI------GKSA 197
                       G +     +  +   V++                   +      GKSA
Sbjct: 185 FLLGIGLVLAYFGGSLRYQDVFAYLPNVQNATIQLFPGVEWSLITVTCLLLFVGAMGKSA 244

Query: 198 QLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTA 257
           Q PL  WLP++M  PTP+SALIH+ATM  AG+F+V R+ P++E +  AL+V++ +GA TA
Sbjct: 245 QFPLHVWLPDSMEGPTPISALIHAATMVTAGLFMVSRMSPIYEMSSTALSVIMVIGAITA 304

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG- 316
           L    +   Q D+KR++A+ST+SQ                 FH+  H           G 
Sbjct: 305 LFMGFLGVIQNDIKRVVAYSTLSQLGYMTVALGASAYSVAMFHVMTHXXXXXXXXXXXGS 364

Query: 317 ALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTA 376
           A+      +D+R +G L K +P T              P  SG++S++ ++ +A    T 
Sbjct: 365 AIIGMHHDQDMRHMGNLKKYMPVTWLTMLIGNLSLIGTPFFSGFYSKDSII-EAAKYSTL 423

Query: 377 WGVFMLVLILLAGIYI 392
            G       +LA +++
Sbjct: 424 PGSGFAYFAVLASVFV 439


>NUOL_NEIMA RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 674

 Score =  158 bits (399), Expect = 1e-40
 Identities = 107/376 (28%), Positives = 165/376 (43%), Gaps = 13/376 (3%)

Query: 29  EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADE-AGRQRFFAWL 87
           E   TW T+G  + +V    D             +L V +Y++ YM DE  G QRFF+++
Sbjct: 65  ENVYTWLTMGGLDFSVGFLVDXXXXXXXXXXXXXSLMVHIYTIGYMHDEKVGYQRFFSYI 124

Query: 88  SFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXX 147
           S F   M            F  WE VGL S++LIG +  +  A  A  KA L+ R     
Sbjct: 125 SLFTFSMLMLIMSNNFIQLFFGWEAVGLVSYLLIGFYFKRPSATFANLKAFLINRVGDFG 184

Query: 148 XXXXXXXXXXITGTT----QLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI------GKSA 197
                       G +     +  +   V++                   +      GKSA
Sbjct: 185 FLLGIGLVLAYFGGSLRYQDVFAYLPNVQNATIQLFPGVEWSLITVTCLLLFVGAMGKSA 244

Query: 198 QLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTA 257
           Q PL  WLP++M  PTP+SALIH+ATM  AG+F+V R+ P++E +  AL+V++ +GA TA
Sbjct: 245 QFPLHVWLPDSMEGPTPISALIHAATMVTAGLFMVSRMSPIYEMSSTALSVIMVIGAITA 304

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG- 316
           L    +   Q D+KR++A+ST+SQ                 FH+  H           G 
Sbjct: 305 LFMGFLGVIQNDIKRVVAYSTLSQLGYMTVALGASAYSVAMFHVMTHXXXXXXXXXXXGS 364

Query: 317 ALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTA 376
           A+      +D+R +G L K +P T              P  SG++S++ ++ +A    T 
Sbjct: 365 AIIGMHHDQDMRHMGNLKKYMPITWLTMLIGNLSLIGTPFFSGFYSKDSII-EAAKYSTL 423

Query: 377 WGVFMLVLILLAGIYI 392
            G       +LA +++
Sbjct: 424 PGSGFAYFAVLASVFV 439


>NU5M_SQUAC RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 610

 Score =  156 bits (395), Expect = 4e-40
 Identities = 116/357 (32%), Positives = 170/357 (47%), Gaps = 10/357 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +GPF++ +S   D        +  ++   +  +++ YM  +    RFF +L  F+  
Sbjct: 71  WINIGPFDINMSFKFDMYSIIFTPVALYVTWSILEFALWYMHSDPNMNRFFKYLLLFLIS 130

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  + +A A  AA +A++  R           
Sbjct: 131 MIILVTANNMFQLFIGWEGVGIMSFLLIGWWYSRADANTAALQAVIYNRVGDIGLILSMA 190

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + ++   F   +D                    GKSAQ  L  WLP AM  PT
Sbjct: 191 WLAMNLNSWEIQQLFILSKDKDXXXXXXXXXXXXX-----GKSAQFGLHPWLPSAMEGPT 245

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++RL PL +   L                      Q D+K++
Sbjct: 246 PVSALLHSSTMVVAGIFLLIRLHPLMQDNQLIXXXXXXXXXXXXXXXXXXXXXQNDIKKI 305

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 306 VAFSTSSQLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 365

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH-TAWGVFMLVLILLA 388
           L K LP+T              P LSG++S++ ++    + H  AW    L+L L+A
Sbjct: 366 LHKLLPFTSSSLTVGSLALTGMPFLSGFFSKDAIIESMNTSHLNAWA---LILTLIA 419


>NU5C_NANDO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  156 bits (395), Expect = 4e-40
 Identities = 130/407 (31%), Positives = 187/407 (45%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF + L++  + G+   +   +W     F L      D L   M  L+  + + V
Sbjct: 48  LSIIMIFSADLSIQQIKGSLIHQYVWSWTINNDFSLEFGYLIDPLTSIMLILITTVGIMV 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
            +YS  YM+ + G  RFFA++SF    M            +I WE VG+ S++LIG    
Sbjct: 108 LIYSDNYMSHDQGYLRFFAYMSFSNASMLGLVTSCNLIQIYIFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     +++         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXXITGSFEFRDLFEITNNLMDNGGVNSLFLT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCASLLFVGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +  +                 Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYVMNFISXXXXXXXXXXXXXXXXQRDIKRSLAYSTMSQLGYTMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVGALERATGT---------RDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G++  +  T         +++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMETVIGYSPEKSQNMVLMGGLTKYVPITKTAFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIACFTAGLTAFYMFRMYLLTF 454


>NU5M_CHIMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 612

 Score =  156 bits (394), Expect = 5e-40
 Identities = 121/359 (33%), Positives = 182/359 (50%), Gaps = 10/359 (2%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           ++W  +  F + +S   D       ++  ++   +  ++  YM  +    RFF +     
Sbjct: 67  ISWIHLPLFNINLSFKFDMYSIMFTSVALYVTWSILDFTSWYMYSDPNINRFFKYXXXXX 126

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
                          FI WEGVG+ SF+LIG  +G+A A  AA +A++  R         
Sbjct: 127 XXXXXXVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANTAALQAVIYNRIGDIGLILS 186

Query: 152 XXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAA 211
                    + ++  F                           KSAQ  L  WLP AM  
Sbjct: 187 MIWLATNLNSWEMNQFM-----VLSKXXXXXXXXXXXXXXXXXKSAQFGLHPWLPSAMEG 241

Query: 212 PTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLK 271
           PTPVSAL+HS+TM  AG+FL++RL PLF++    L V L +GA T L  A+ A  Q D+K
Sbjct: 242 PTPVSALLHSSTMVVAGIFLLVRLNPLFQNNKEILTVCLCLGALTTLFTAICALTQNDIK 301

Query: 272 RLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQL 330
           +++A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++
Sbjct: 302 KIIAFSTSSQLGLMMVTIGLNQPYLAFLHVCTHAFFKAMLFLCSGSIIHSLNNEQDIRKM 361

Query: 331 GGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAW-GVFMLVLILLA 388
           GGL   LP+T              P L+G++S++ ++    S++T++   + L+L L+A
Sbjct: 362 GGLNNILPFTSSCMVLGSLALTGMPFLAGFFSKDAIIE---SLNTSYLNAWALILTLIA 417


>NU5C_LIGVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 738

 Score =  156 bits (394), Expect = 5e-40
 Identities = 123/381 (32%), Positives = 174/381 (45%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YMA + G  R          
Sbjct: 74  SWTINNDFSLEFGYLIDPLTSIMSMLITTVGIMVLIYSDNYMAHDQGYLRXXXXXXXXXX 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
                         +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 XXLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVTNRVXXXXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +    F+ + +                       + KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFRDLFEILNNFISKNEVNSSFGTLCAALLFTGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  + ++G  T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPYIMNFISFIGIITVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETIVGY 373

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P T              P L+ +WS++E+L  +      + +
Sbjct: 374 SPDKSQNMVLMGGLRKHVPITQISFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IAWSTAGLTAFYMFRIYLLTF 454


>NU5C_LEPVR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  155 bits (393), Expect = 6e-40
 Identities = 141/381 (37%), Positives = 189/381 (49%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F        D L   M+ L++ + + V +YS  YM+ + G  RFFA++ FF  
Sbjct: 74  SWTINNEFSFEFGYFIDPLTSIMSILISTVGILVLIYSDNYMSHDQGYLRFFAYMGFFNT 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +  WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +                                 I KSAQ PL  WLP+A
Sbjct: 194 XXXYWITGSFEFQDXXXXXXXXXXXXXXXXXXXXXXXXXXXVGPIAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF                T L+ A +A AQ 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXXXXXXXXXXXXXTVLLGATLALAQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMEAIVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++E+L  ++     + +
Sbjct: 374 SPDKSQNMILMGGLTKHVPITKTAFLIGTLSLCGIPPLACFWSKDEILNDSLLFSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                  L   Y+ R  + TF
Sbjct: 434 IACSTAGLTAFYMFRIYLLTF 454


>NU5C_VITVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 749

 Score =  155 bits (392), Expect = 8e-40
 Identities = 132/383 (34%), Positives = 181/383 (47%), Gaps = 15/383 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+ L+  + + V +YS  YM+ + G  RFFA++SFF  
Sbjct: 74  SWTINNDFSLEFGYLIDPLTSIMSILITTVGIMVLIYSDNYMSHDQGYLRFFAYMSFFNA 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXX 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX------IGKSAQLPLTAWLP 206
                ITG+ +    F+                             + KSAQ PL  WLP
Sbjct: 194 XXXYWITGSFEFRDLFEXXXXXXXXXXXXXXXLFVSLCALFLFVGAVAKSAQFPLHVWLP 253

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
           +AM  PTP+SALIH+ATM AAG+FLV RLFPLF   P  +                    
Sbjct: 254 DAMEGPTPISALIHAATMVAAGIFLVARLFPLFIVIPYIMNXXXXXXXXXXXXXXXXXXX 313

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERAT 322
           Q D+K+ LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   
Sbjct: 314 QKDIKKSLAYSTMSQLGYTMLALGMGSYRAALFHLITHAYSKALLFLGSGSIIHSMEAIV 373

Query: 323 G-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAW 377
           G     ++++  +GGL K +P T              P L+ +WS++E+L  +      +
Sbjct: 374 GYSPDKSQNMVLMGGLTKHVPITKNTFLLGTLSLCGIPPLACFWSKDEILNDSWLYSPIF 433

Query: 378 GVFMLVLILLAGIYIGRAAMATF 400
            +   +   L   Y+ R  + TF
Sbjct: 434 AIIACLTAGLTAFYMFRIYLLTF 456


>NU5C_SOYBN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 750

 Score =  155 bits (391), Expect = 1e-39
 Identities = 114/345 (33%), Positives = 164/345 (47%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+L+ F   M            ++ WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYLTLFNISMLGLVTSSNLIQIYVFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    FQ + +               
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSLEFRDLFQIINNLIYKNEVNIFFLTLV 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P 
Sbjct: 230 ALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVLPA 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            +  + ++G  T ++ A +A AQ D+K+ LA+ST+SQ                 FHL  H
Sbjct: 290 IMNGIAFIGIITVVLGATLAIAQQDIKKNLAYSTMSQLGYMMLALGMGSYRAALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEALVGYSPAKSQNMVLMGGLTKHVPITKTSFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
             + +WS++E+L  +      + +       L   Y+ R  +  F
Sbjct: 410 PFACFWSKDEILNDSWLYSPIFAIIACCTAGLTAFYMFRIYLLVF 454


>NU5M_CRYNV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;
          Length = 662

 Score =  154 bits (390), Expect = 1e-39
 Identities = 122/428 (28%), Positives = 177/428 (41%), Gaps = 32/428 (7%)

Query: 4   RGSGLAVGGIFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMAT---LVA 60
           RG  + V G  I     L  S A + VA  ++ VG     VS+    +G W+ +   LV 
Sbjct: 19  RGRTIGVTGAHIITTGCLMTSAALSIVA--FYEVGLSGSPVSIV---IGSWIDSEFMLVQ 73

Query: 61  W----------IALPVAV-------YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXX 103
           W          + LPV +       YS+ YMA +   QRFF++LS F   M         
Sbjct: 74  WGFLFDSLTVSMLLPVLIVSSLVHLYSISYMAGDPHNQRFFSYLSMFTFFMLVLVAGDNY 133

Query: 104 XXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQ 163
              F+ WEG+G++S++LI   + + +A +A  KAL + R               + G   
Sbjct: 134 FIMFVGWEGIGISSYLLINFWYTRMQANKAGMKALTVNRVGDMFLSVGFFAIFWVFGNVD 193

Query: 164 LPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSAT 223
               F                        + KSA +PL  WLP+AM  PTPVSALIH+AT
Sbjct: 194 YASVFSVAP--YINETAITIIGLLLLVGAMAKSANIPLHTWLPDAMEGPTPVSALIHAAT 251

Query: 224 MAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXX 283
           +  AGV+L+LR  P+ E+ P  L V+ WV              Q DLKR++A+ST SQ  
Sbjct: 252 LVTAGVYLMLRSSPIIEYGPTVLVVITWVXXXXXXXXXXXXXXQNDLKRVIAYSTCSQMG 311

Query: 284 XXXXXXXXXXXXXXXFHLTVH-ATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXX 342
                          FHL  H              +      +DLR+LGGL   LP+T  
Sbjct: 312 YLFMAVGLSQYNVALFHLVNHXXXXXXXXXXXXXVIHGMADQQDLRRLGGLVNFLPFTYT 371

Query: 343 XXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGI----YIGRAAMA 398
                       P ++G++S++ +L  A+  +   G     L  ++ +    Y  R    
Sbjct: 372 AILIGSLSLMALPFMTGFYSKDLILEVALGQYEVSGTIAYWLGTISAVFTAFYSFRLVSL 431

Query: 399 TFGLAPQA 406
           TF   P A
Sbjct: 432 TFFTTPNA 439


>NU5C_VICFA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  154 bits (390), Expect = 1e-39
 Identities = 118/345 (34%), Positives = 166/345 (48%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFF ++SFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDSYMSHDQGYLRFFTYMSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    FQ  ++               
Sbjct: 170 IAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFQIFKNLIYKNEVNILFVTLC 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P 
Sbjct: 230 ALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPS 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            ++ +  +G  T ++ A +A AQ D+K+ LA+ST+SQ                 FHL  H
Sbjct: 290 IMSGIALIGIITVVLGATLAIAQKDIKKNLAYSTMSQLGYMMLALGMGSYRAALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K  P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMVLMGGLTKHAPITKMSFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
             + +WS++E+L  +      + +       L   Y+ R  +  F
Sbjct: 410 PFACFWSKDEILNDSWLYSPIFAIIACSTAGLTAFYMFRIYLLVF 454


>NU5C_CITSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 743

 Score =  154 bits (390), Expect = 1e-39
 Identities = 121/345 (35%), Positives = 168/345 (48%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++SFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMSFFNASMLGLVTSSNFIQIYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R                  + +    F+ +++               
Sbjct: 170 IAAGACQKAFVTNRVXXXXXXXXXXXXXXXXXSFEFRDLFEILKNLIYNNEVNLLFVTLC 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P 
Sbjct: 230 AFLLFAGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPY 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
           A+ ++  +G  T  + A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 AMNLISLIGIITVFLGATLALAQQDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYFPDKSQNMVLMGGLRKHVPITKTAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L         +         L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDTWLYSPIFATIAFFTAGLTAFYMFRIYLLTF 454


>NU5C_DRANE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  154 bits (389), Expect = 2e-39
 Identities = 137/345 (39%), Positives = 177/345 (51%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YMA + G  RFFA+L FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMAHDQGYLRFFAYLGFFTTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+                   
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRPALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLAWFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NU5C_DIOEL RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  154 bits (389), Expect = 2e-39
 Identities = 129/397 (32%), Positives = 182/397 (45%), Gaps = 14/397 (3%)

Query: 18  LAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMAD 76
           LA+  ++G+   +   +W     F L      D L   M+ L++ + + V +YS  YM+ 
Sbjct: 58  LAIQQINGSFIYQYLCSWTINNDFSLEFGYLIDPLTSIMSLLISTVGIMVLMYSDNYMSH 117

Query: 77  EAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFK 136
           + G  RFFA++SFF   M             I WE VG+ S++LIG    +  A  A  K
Sbjct: 118 DQGYLRFFAYMSFFNTSMLGLVTSSNLIQIHIFWELVGMCSYLLIGFWFTRPIAASACQK 177

Query: 137 ALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX---- 192
           A ++ R               ITG+ +    F+ V +                       
Sbjct: 178 AFVINRVXXXXXXXXXXXXYWITGSLEFRDLFEIVNNLIHNNGVNFRFAILCACLLFLGA 237

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
           + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P  +      
Sbjct: 238 VAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLRPLFIVIPYIMNXXXXX 297

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALF 312
                         Q D+KR LA+STVSQ                 FHL  HA  K+ LF
Sbjct: 298 XXXXXXXXXXXXXXQGDIKRSLAYSTVSQLGYIMLALGIGSYRAALFHLITHAYSKALLF 357

Query: 313 LSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           L  G    ++E   G     ++++  +GGL K +P T              P L+ +WS+
Sbjct: 358 LGSGSIIHSMEPVVGYSPDKSQNMVLMGGLKKYVPVTRTTFLLGTLSLCGIPPLACFWSK 417

Query: 364 EELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           +E+L  +      + +       L   Y+ R  + TF
Sbjct: 418 DEILTDSWLYSPIFAIIAYFTAGLTAFYMFRVYLLTF 454


>NU5M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 601

 Score =  154 bits (388), Expect = 2e-39
 Identities = 97/334 (29%), Positives = 158/334 (47%), Gaps = 6/334 (1%)

Query: 35  FTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMM 94
           F +  F L +   AD       ++  +I   +  +S+ YM  E     FF +L+ F+  M
Sbjct: 67  FNMISFNLLLGFEADMYCLTFFSIALYITWSIMQFSLWYM-HEHNNTLFFKYLTMFLISM 125

Query: 95  XXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXX 154
                        + WEG+G+ SF+LI   H + +A  AA +A++  R            
Sbjct: 126 LFFLSANNLLQLILGWEGMGIMSFLLINWWHNRLEANSAAMQAIIYNRIGDTGLIIFMIW 185

Query: 155 XXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTP 214
               T +  +    +Q+                      GKSAQ  L  WL  AM  PTP
Sbjct: 186 SALFTNSWNM----KQIFILQNNSMDLWLPLLGIVLAATGKSAQFMLHPWLLSAMEGPTP 241

Query: 215 VSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLL 274
           VSAL+HS+TM  +GVFL++R +P+ +++ + ++++L +GA T L AAL A++Q D+K+++
Sbjct: 242 VSALLHSSTMVVSGVFLLIRFYPMIKNSQMIISIILCLGAMTTLFAALCASSQTDIKKII 301

Query: 275 AWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFL-SVGALERATGTRDLRQLGGL 333
           A+ST SQ                  H++ HA FK+ LFL S   +      +D+R++G L
Sbjct: 302 AFSTTSQLGLMTVTIGINQPQLAFLHMSTHAFFKALLFLCSASIIHTINNEQDIRKMGSL 361

Query: 334 GKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
              LP+T              P LSG++S++ +L
Sbjct: 362 HLILPFTSSCTLISSLALMGMPYLSGFYSKDIIL 395


>NU5M_EMENI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 657

 Score =  154 bits (388), Expect = 2e-39
 Identities = 117/344 (34%), Positives = 169/344 (49%), Gaps = 16/344 (4%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  V    +      D L   M   V  ++  V +YS+ YM+ +   QRFF++LS F  M
Sbjct: 64  WLDVESLYVLWIFRFDSLTVSMFITVLIVSSLVHIYSISYMSHDPHNQRFFSYLSLFTFM 123

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WE VG+ S++L+     +  A Q++  ALL  R           
Sbjct: 124 MIILVTGNNYLIMFVGWEVVGVCSYLLVNFWFTRIAANQSSLSALLTNRVGDTLLTVGMF 183

Query: 154 XXXXITGTTQ------LPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPE 207
                 G         L P++ +                        KS+Q+ L  WLP+
Sbjct: 184 AILWSFGNIDYSTVFALAPYYNE--------NXXXXXXXXXXXXXXXKSSQVGLHIWLPQ 235

Query: 208 AMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQ 267
           AM  PTPVSALIH+ATM  AGV+L++R  PL E++   L + LW+GA T + ++L+   Q
Sbjct: 236 AMEGPTPVSALIHAATMVTAGVYLLMRSSPLIEYSSTVLVLCLWLGAITTVFSSLIGLFQ 295

Query: 268 YDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG-TRD 326
             LK+L A+ST+ Q                 FHL  HA +K+ LFL  G++  A    +D
Sbjct: 296 QILKKLFAYSTM-QLGMMVIAVGLSSYNLALFHLVNHAFYKALLFLGAGSVIHAVADNQD 354

Query: 327 LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
            R+ GGL + LP T              P ++G++S++ +L  A
Sbjct: 355 FRKYGGLREFLPLTYYVMLIASLSLVAVPFMTGFYSKDYILESA 398


>NU5M_DEBHA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 592

 Score =  153 bits (387), Expect = 3e-39
 Identities = 147/386 (38%), Positives = 205/386 (53%), Gaps = 20/386 (5%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           TWF+VG  ++      D L   +   V  + L V +Y++ YM  +  R RF+  LS F  
Sbjct: 18  TWFSVGDIQVNYGTLLDSLSMVVMVPVGIVTLSVLIYAIDYMRYDPNRNRFYIILSVFAI 77

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            F+ WE VG+ S++LI   + +  A ++A  A+L+ R          
Sbjct: 78  FMTVLVISDNYIMMFMGWEFVGVVSYLLISFWNTRIAAMKSALSAILLNRMGDTLFV--- 134

Query: 153 XXXXXITGTTQLPPF----FQQVE--DXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLP 206
                I   T L  F    F+ +E                        KSAQL L  WL 
Sbjct: 135 -----ICIGTMLSYFHAVDFETMELMTPHTDTYXXXXXXXXXXXXXXXKSAQLGLHGWLL 189

Query: 207 EAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATA 266
            AM  PTPVSAL H+ATM  +GVF+++R   + E+ P  L V+LW+  FT L++ L+A  
Sbjct: 190 SAMEGPTPVSALTHAATMVCSGVFVLVRSSFMLEYTPSMLLVMLWLAGFTTLMSGLMAVV 249

Query: 267 QYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA--TGT 324
             D+KR+                         +HL  HA FK+ LF+S G++  +  + T
Sbjct: 250 SNDMKRVXXXXXXXXXXXXXXXXXXXXYDLAMYHLYCHAFFKALLFMSAGSIMHSYMSET 309

Query: 325 RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVL 384
           +D+R+ GGL   LP++              P L+GY+S++ ++      +T  G  M  +
Sbjct: 310 QDMRKYGGLINYLPFSYTTXXXXXXXXXXXPGLTGYYSKDIIMESLYGTYTVSGYIMYYI 369

Query: 385 ----ILLAGIYIGRAAMATFGLAPQA 406
                 L  IY  R    TF   P++
Sbjct: 370 ATASATLTAIYSLRVTYLTFYNVPRS 395


>NU5C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 744

 Score =  153 bits (387), Expect = 3e-39
 Identities = 126/381 (33%), Positives = 176/381 (46%), Gaps = 13/381 (3%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F L      D L   M+            YS  YM  + G  RFF++++ F  
Sbjct: 74  SWTINNDFSLEFGHLVDPLTSIMSXXXXXXXXXXXXYSEKYMFHDQGYLRFFSYMTLFHV 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 SMLGLVTSSNLIQIYICWEFVGMFSYLLIGFWFTRPVAANACQKAFVTNRVGDFSFLLGI 193

Query: 153 XXXXXITGTTQLPP----FFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                ITG+ +       F+  V +                     KSAQ PL  WLP+A
Sbjct: 194 LGLYWITGSFEFRDLFEIFYNLVHNNEIPXXXXXXXXXXXXXXXXXKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  L ++ ++G  T  + A +A +Q 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFIVMPYILNLISFIGIITVFLGATLALSQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG- 323
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G    ++E   G 
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALLFLGAGSIIHSMEAFVGY 373

Query: 324 ----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
               ++++  +GGL K +P T              P L+ +WS++ +L  +      + +
Sbjct: 374 SPEKSQNMVLMGGLIKHMPITKTSFLLGTLSLCGIPPLACFWSKDSILNDSWLYSPIFAI 433

Query: 380 FMLVLILLAGIYIGRAAMATF 400
                      Y+ R  + TF
Sbjct: 434 IACSTTGFTAFYMFRIYLLTF 454


>NU5C_CHLSC RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  153 bits (387), Expect = 3e-39
 Identities = 130/407 (31%), Positives = 188/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F S L++  ++G+     L +W     F L      D L   M+          
Sbjct: 48  LSITMVFSSNLSIQQINGSFIYQYLWSWTINNDFSLEFGYLIDPLTSIMSXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RF +++SF    M             I WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDQGYLRFLSYMSFSNTSMLGLVTSSNLIQIHIFWELVGMCSYLLIGFWST 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R                  + +    F+     +           
Sbjct: 168 RTVAANACQKAFVTNRXXXXXXXXXXXXXXXXXXSFEFRDLFEIFKNLIHSNGVHFVFAT 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL P+F   
Sbjct: 228 LCASLLFVGAVAKSAQFPLHVWLPDAMEVPTPISALIHAATMVAAGIFLVARLLPIFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  + ++  +G  T L+ A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNLIALIGVITVLLGATLALAQRDIKRSLAYSTMSQLGYTMLALGIGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPIVGYSPDKSQNMVLMGGLRKYIPITKTTFLLGTFSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILNDSWLYSPIFAIIAYSTAGLTAFYMFRMYLLTF 454


>NUOL_STRCO RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 654

 Score =  152 bits (385), Expect = 5e-39
 Identities = 132/379 (34%), Positives = 180/379 (47%), Gaps = 13/379 (3%)

Query: 5   GSGLAVGGIFISALAVLPLSGADAEVA------LTWFTVGPFELTVSLAADRLGWWMATL 58
           G+ LA     +  +    L G+ AE         +W  V  F+  V+   D+L      L
Sbjct: 34  GTLLAAVSFVLGVVLFADLLGSGAEDRTLTQHLFSWIPVEGFQADVAFRLDQLSMTFVLL 93

Query: 59  VAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASF 118
           +  +   + +YSV YM  +  R+RFF +L+ F+  M            ++ WEGVGLAS+
Sbjct: 94  ITGVGSLIHLYSVAYMEHDERRRRFFGYLNLFLAAMLILVLADNYLLLYVGWEGVGLASY 153

Query: 119 VLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXX 178
           +LIG    +  A  AA KA L+ R                 GT    P            
Sbjct: 154 LLIGFWQHKPSAATAAKKAFLVNRVGDMGLSIGIMLMFLWFGTFAFGPVXXXXXXXXXXX 213

Query: 179 XXXXXXXXXXXXXXI----GKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR 234
                              GKSAQ+PL +WL +AM  PTPVSALIH+ATM  AGV+L++R
Sbjct: 214 XXXXXKXXXXXXXXXXXXCGKSAQVPLQSWLGDAMEGPTPVSALIHAATMVTAGVYLIVR 273

Query: 235 LFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ--XXXXXXXXXXX 292
              +F  AP A  VV  VGA T L  A+V  A+ D+K+ LA ST+SQ             
Sbjct: 274 SGAIFNGAPDAQLVVTIVGAVTLLFGAIVGCAKDDIKKALAGSTMSQIGYMVLAAGLGPI 333

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTR-DLRQLGGLGKRLPWTXXXXXXXXXXX 351
                  HL  H            ++        D+R+ GGL K +P T           
Sbjct: 334 GYVFAIMHLVTHXXXXXXXXXXXXSVMHGMNDEVDMRRYGGLRKYMPVTFVTFGLGYLAI 393

Query: 352 XXXPLLSGYWSEEELLRQA 370
              P LSG++S+++++  A
Sbjct: 394 IGFPGLSGFFSKDKIIEAA 412


>NU5M_CARAU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 607

 Score =  152 bits (384), Expect = 7e-39
 Identities = 115/417 (27%), Positives = 174/417 (41%), Gaps = 16/417 (3%)

Query: 1   MPGRGSGLAVGGIFISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMAT 57
           M G          FIS L ++       E  +T   W     F++ +S   D        
Sbjct: 33  MAGMTKTAVSSAFFISLLPLMIFLNLKTEGIITNWQWMNTQTFDVNISFKFDHYSLIFVP 92

Query: 58  LVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLAS 117
           +  ++   +  +++ YM  +    RFF +L  F+  M            FI WEGVG+ S
Sbjct: 93  IALYVTWSILEFALWYMHSDPYIDRFFKYLLTFLVAMIILVTANNMFQLFIGWEGVGIMS 152

Query: 118 FVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXX 177
           F+LIG  HG+A A  AA +A++  R                  + ++   F   ++    
Sbjct: 153 FLLIGWWHGRADANTAALQAVIYNRVGDIGLIMTMAWFAMNLNSWEIQQIFVLSKNFDMT 212

Query: 178 XXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                           GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++RL P
Sbjct: 213 IPLMGLALAAT-----GKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIRLHP 267

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
           L E+                   A  A  Q D+K+++A+ST SQ                
Sbjct: 268 LMENNQXXXXXXXXXXXXXXXFTATCALTQNDIKKIVAFSTSSQLGLMMVTIGLNQPQLA 327

Query: 298 XFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             H+  HA FK+ LFL  G+ +      +D+R++GGL   +P T              P 
Sbjct: 328 FLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLFSIMPATSTYFTIGSLALTGTPF 387

Query: 357 LSGYWSEEELLRQAVSVH-TAWGVFMLVLILLAGIYIGRAAMATFGLAPQAVMPANR 412
           L+G++S++ ++    + H  AW    L L L+A  +    A+ +F L    VM   R
Sbjct: 388 LAGFFSKDAIIEALNTSHLNAWA---LTLTLIATSF---TAVYSFRLVYFVVMGTPR 438


>MNHA2_STAES RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  152 bits (384), Expect = 7e-39
 Identities = 123/394 (31%), Positives = 179/394 (45%), Gaps = 26/394 (6%)

Query: 30  VALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGR-QRFFAWLS 88
           V L W      ++ + L  D L      +++ I + V  Y+  Y++       RFF +L 
Sbjct: 60  VRLPWMP--SIDINLDLRLDGLSLMFGLIISLIGVGVFFYATQYLSHSTDNLPRFFIYLL 117

Query: 89  FFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXX 148
            F+  M            ++ WE   ++SF+LI   +   +++  A ++ ++T       
Sbjct: 118 LFMFSMIGIVIANNTILMYVFWELTSISSFLLISYWYNNGESQLGAIQSFMITVFGGLAL 177

Query: 149 XXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                    ITGT  +     Q  +                     KSAQ P   WLP+A
Sbjct: 178 LTGFIILYIITGTNTITDILNQ-RNAISRHXXXXXXXXXXXXGAFTKSAQFPFHIWLPKA 236

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           MAAPTPVSA +HSATM  AG+FL+ R  PL   + + +  V +VG  T L  +L A  QY
Sbjct: 237 MAAPTPVSAYLHSATMVKAGIFLLFRFTPLLGLSNVYIYTVTFVGLITMLFGSLTALRQY 296

Query: 269 DLKRLLAWSTVSQ-----------------XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           DLK +LA+ST+SQ                                  FHL  HA FK AL
Sbjct: 297 DLKGILAYSTISQLGMIMTMVGLGGGYAQHTSDELSKFYILVLFAGLFHLMNHAVFKCAL 356

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F+ VG ++  +GTRD+R L G+ K  P                P L+G+ S+E  L    
Sbjct: 357 FMGVGIIDHESGTRDIRLLNGMRKVFPKMHIVMLLAALSMAGVPFLNGFLSKEMFLDSLT 416

Query: 372 SVH--TAWGVFMLVLILLAGIYIGRAAMATFGLA 403
             +    +G  +  +I+  G+    A++ TF  A
Sbjct: 417 KANELDQYGFVLTFVIISIGVI---ASILTFTYA 447


>MNHA2_STAEQ RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  152 bits (384), Expect = 7e-39
 Identities = 123/394 (31%), Positives = 179/394 (45%), Gaps = 26/394 (6%)

Query: 30  VALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGR-QRFFAWLS 88
           V L W      ++ + L  D L      +++ I + V  Y+  Y++       RFF +L 
Sbjct: 60  VRLPWMP--SIDINLDLRLDGLSLMFGLIISLIGVGVFFYATQYLSHSTDNLPRFFIYLL 117

Query: 89  FFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXX 148
            F+  M            ++ WE   ++SF+LI   +   +++  A ++ ++T       
Sbjct: 118 LFMFSMIGIVIANNTILMYVFWELTSISSFLLISYWYNNGESQLGAIQSFMITVFGGLAL 177

Query: 149 XXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                    ITGT  +     Q  +                     KSAQ P   WLP+A
Sbjct: 178 LTGFIILYIITGTNTITDILNQ-RNAISRHXXXXXXXXXXXXGAFTKSAQFPFHIWLPKA 236

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           MAAPTPVSA +HSATM  AG+FL+ R  PL   + + +  V +VG  T L  +L A  QY
Sbjct: 237 MAAPTPVSAYLHSATMVKAGIFLLFRFTPLLGLSNVYIYTVTFVGLITMLFGSLTALRQY 296

Query: 269 DLKRLLAWSTVSQ-----------------XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           DLK +LA+ST+SQ                                  FHL  HA FK AL
Sbjct: 297 DLKGILAYSTISQLGMIMTMVGLGGGYAQHTSDELSKFYILVLFAGLFHLMNHAVFKCAL 356

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F+ VG ++  +GTRD+R L G+ K  P                P L+G+ S+E  L    
Sbjct: 357 FMGVGIIDHESGTRDIRLLNGMRKVFPKMHIVMLLAALSMAGVPFLNGFLSKEMFLDSLT 416

Query: 372 SVH--TAWGVFMLVLILLAGIYIGRAAMATFGLA 403
             +    +G  +  +I+  G+    A++ TF  A
Sbjct: 417 KANELDQYGFVLTFVIISIGVI---ASILTFTYA 447


>NU5C_OLIPU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  152 bits (383), Expect = 9e-39
 Identities = 128/345 (37%), Positives = 172/345 (49%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXX 184
            A  A  KA +  R               ITG+ +    F+     + +           
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFKNLILNNRVNXXXXXXX 229

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NU5M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 674

 Score =  151 bits (382), Expect = 1e-38
 Identities = 124/305 (40%), Positives = 164/305 (53%), Gaps = 4/305 (1%)

Query: 68  VYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQ 127
           ++SV YM+ +   QRFFA+LS F   M            F+ WEG+G++S++LI     +
Sbjct: 98  IFSVDYMSADPHNQRFFAYLSMFTFFMLVLVTGDNYLIMFVGWEGIGISSYLLINFWFTR 157

Query: 128 AKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXX 187
            +A ++A KAL++ R               + G       F                   
Sbjct: 158 IQANKSAIKALVVNRVGDMFLSIGFFAIFFVFGNLDYSTVFSIAP--FINEXXXXXXXXX 215

Query: 188 XXXXXIGKSAQLPLTAWLPE-AMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLAL 246
                +GKSAQL L  WLP+ +M  PTPVSALIH+AT+  AGV+L+LR  P+ E+ P  L
Sbjct: 216 XXXAAMGKSAQLGLHTWLPDPSMEGPTPVSALIHAATLVTAGVYLLLRSSPVIEYGPTTL 275

Query: 247 AVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHAT 306
            V+ WVGA TA  AA     Q DLKR++A+ST SQ                 FHL  H  
Sbjct: 276 IVITWVGALTAFFAASTGLLQNDLKRVIAYSTCSQMGYLFMACGLSQYNVALFHLVNHXX 335

Query: 307 FKSALFLSVGALERAT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEE 365
                          T   +D R+LGGL   LP+T              P L+G++S++ 
Sbjct: 336 XXXXXXXXXXXXXXXTYDQQDQRRLGGLIGFLPFTYTXXXXXXXXXXXXPWLTGFYSKDL 395

Query: 366 LLRQA 370
           +L  A
Sbjct: 396 ILEVA 400


>NU5C_NASOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  151 bits (381), Expect = 1e-38
 Identities = 132/345 (38%), Positives = 174/345 (50%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXX 184
            A  A  KA +  R               ITG+ +    F+                   
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIXXXXXXXXXXXXXXXXXX 229

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKIAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIAFSTAGLTAFYMFRIYLLTF 454


>NU5M_MOUSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 607

 Score =  150 bits (380), Expect = 2e-38
 Identities = 109/375 (29%), Positives = 169/375 (45%), Gaps = 11/375 (2%)

Query: 15  ISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSV 71
           IS L +L     + E  +T   W T+   EL +S   D       ++  ++   +   S 
Sbjct: 46  ISLLPLLMFFHNNMEYMITTWHWVTMNSMELKMSFKTDFFSILFTSVALFVTWSIMQLSS 105

Query: 72  PYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKAR 131
            YM  +    RF  +                    FI WEGVG+ SF+LIG  +G+  A 
Sbjct: 106 WYMHSDPNINRFIKYXXXXXXXXXXXXSANNMFQLFIGWEGVGIMSFLLIGWWYGRTDAN 165

Query: 132 QAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXX 191
            AA +A+L  R                  + +L    QQ+                    
Sbjct: 166 TAALQAILYNRIGDIGFILAMVWFSLNMNSWEL----QQI--MFSNNNDNLIPLMGLLIA 219

Query: 192 XIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW 251
             GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++R  PL  +    L  +L 
Sbjct: 220 ATGKSAQFGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLVRFHPLTTNNNFILTTMLC 279

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           +GA T L  A+ A  Q D+K+++A+ST SQ                  H+  HA FK+ L
Sbjct: 280 LGALTTLFTAICALTQNDIKKIIAFSTSSQLGLMMVTLGMNQPHLAFLHICTHAFFKAML 339

Query: 312 FLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           F+  G+ +      +D+R++G + K +P+T              P L+G++S++ ++   
Sbjct: 340 FMCSGSIIHSLADEQDIRKMGNITKIMPFTSSCLVIGSLALTGMPFLTGFYSKDLIIEAI 399

Query: 371 VSVHT-AWGVFMLVL 384
            + +T AW + + ++
Sbjct: 400 NTCNTNAWALLITLI 414


>NU5C_ORYSJ RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 734

 Score =  150 bits (380), Expect = 2e-38
 Identities = 139/407 (34%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVHLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNEINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLIARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +                 Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISXXXXXXXXXXXXXXXXQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTCFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_ORYSI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 734

 Score =  150 bits (380), Expect = 2e-38
 Identities = 139/407 (34%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVHLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNEINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLIARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +                 Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISXXXXXXXXXXXXXXXXQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTCFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_ORYSA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 734

 Score =  150 bits (380), Expect = 2e-38
 Identities = 139/407 (34%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVHLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNEINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLIARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +                 Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISXXXXXXXXXXXXXXXXQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTCFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_ORYNI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 734

 Score =  150 bits (380), Expect = 2e-38
 Identities = 139/407 (34%), Positives = 194/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVHLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNEINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL+ RL PLF   
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLIARLLPLFISL 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           PL ++ +                 Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PLIMSFISXXXXXXXXXXXXXXXXQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRTCFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_CICAR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 744

 Score =  150 bits (379), Expect = 3e-38
 Identities = 117/345 (33%), Positives = 163/345 (47%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ +    RFF +LSFF   M            +I WE VG+ S++LIG    + 
Sbjct: 110 YSDSYMSHDQSYLRFFTYLSFFNTSMLGLVTSSNLIQVYIFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXXXX 184
            A  A  KA +  R               ITG+ +    FQ     +             
Sbjct: 170 IAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFQIFNNLIYKNEVNIFFVTLC 229

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P 
Sbjct: 230 ALLLFCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPS 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            ++ +  +G  T ++ A +A AQ D+K+ LA+ST+SQ                 FHL  H
Sbjct: 290 IMSGIALIGIITVVLGATLAIAQKDIKKNLAYSTMSQLGYMILALGMGSYRAALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K  P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMVLMGGLTKHAPITKNAFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
             + +WS++ +L  +      + +       L   Y+ R  +  F
Sbjct: 410 PFACFWSKDGILNDSWLYSPIFAIIACSTAGLTAFYMFRIYLLVF 454


>NU5M_LOXAF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  149 bits (377), Expect = 4e-38
 Identities = 124/364 (34%), Positives = 178/364 (48%), Gaps = 9/364 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W T+   +L++S   D        +  +I   +  +S+ YM  +    RFF +       
Sbjct: 71  WMTIHTLKLSMSFKLDFFSLTFMPIALFITWSIMEFSLWYMHSDPHINRFFKYXXXXXXX 130

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        F+ WEGVG+ SF+LI   HG+  A  AA +A+L  R           
Sbjct: 131 XXXXVSANNLLQLFMGWEGVGIMSFLLISWWHGRTDANTAALQAMLYNRIGDMGFIMMMA 190

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + +    FQQ+                         AQ  L  WLP AM  PT
Sbjct: 191 WFTIHLNSWE----FQQI--FXXXXXXXXXXXXXXXXXXXXXXAQFGLHPWLPSAMEGPT 244

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVF ++R +PL E+        L +GA T L  A+ A  Q D+K++
Sbjct: 245 PVSALLHSSTMVMAGVFTLIRFYPLMENNLTIQTSTLCLGAITTLFTAICALTQNDIKKI 304

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A ST SQ                  H+  HA FK+ LFLS G+ +      +D+R++GG
Sbjct: 305 IALSTSSQLGLMMVTIGINQPQLAFIHMCTHAFFKAMLFLSSGSIIHNLNNEQDIRKMGG 364

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGVFM-LVLILLAGI 390
           L K +P T              P L+G++S++ ++  A +S    W + + L+ + +   
Sbjct: 365 LYKTMPITSTAIIIGSLALTGMPFLTGFYSKDPIIETANMSYINTWALLITLIAVSMTAS 424

Query: 391 YIGR 394
           Y  R
Sbjct: 425 YSTR 428


>NU5M_DINSE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 590

 Score =  149 bits (377), Expect = 4e-38
 Identities = 99/353 (28%), Positives = 155/353 (43%), Gaps = 10/353 (2%)

Query: 42  LTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXX 101
           + +S+  D        +  +I   +  +S+ YMA +    +F  +L  F+  M       
Sbjct: 66  INISITLDTASLLFTPIALFITWSITEFSLWYMATDPNINKFIKYLLTFLITMLVIITAN 125

Query: 102 XXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGT 161
                FI WEGVG+ SF+LIG  HG+  A  AA +A++  R                T +
Sbjct: 126 NMYQLFIGWEGVGIMSFLLIGWWHGRQDANTAALQAIIYNRIGDIGLIMTTAWMMT-TSS 184

Query: 162 TQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHS 221
             +     Q E                     GKSAQ  L  WLP AM  PTPVSAL+HS
Sbjct: 185 INMQELMIQHE------VVNIIPLLGLVAAATGKSAQFSLHPWLPSAMEGPTPVSALLHS 238

Query: 222 ATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           +TM  AGVFL++RL P+  +  + L   L +G              +D+K+++A ST SQ
Sbjct: 239 STMVVAGVFLLIRLHPILHNNKIMLTCCLILGXXXXXXXXXXXXXYFDIKKIIALSTTSQ 298

Query: 282 XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWT 340
                             H+  H+ FK+ LFL  G+ +      +D+R +GGL K LP T
Sbjct: 299 LGLMMTMIGLNQPTLAFLHMITHSFFKAMLFLCSGSYIHNLNNEQDIRMMGGLLKTLPMT 358

Query: 341 XXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHT-AWGVFM-LVLILLAGIY 391
                         P LSG++S++ ++    + +T +W + + ++  +L+  Y
Sbjct: 359 SSFLTIANLSLMGMPFLSGFYSKDTIIETLANSYTNSWAIMITMIATILSACY 411


>NU5M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 638

 Score =  149 bits (375), Expect = 7e-38
 Identities = 111/394 (28%), Positives = 174/394 (44%), Gaps = 11/394 (2%)

Query: 14  FISALAVL-PLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVY 69
           F+S +++L  +  +   + LT   WF   P  ++++   D+      ++   +   +  +
Sbjct: 76  FLSVISLLISVQNSFKSINLTFSLWFNNTPTNVSINFLLDQYFLLFLSVGLIVTWSIMEF 135

Query: 70  SVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAK 129
           S  YM ++   + FF     F   M            F+ WEGVG  SF+LI     +  
Sbjct: 136 SYYYMKEDPNGKAFFRPFGHFSLNMLILTSSNSLFLVFLGWEGVGFLSFLLISWWATRND 195

Query: 130 ARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXX 189
           A  +A +A++  R                T +  L     ++                  
Sbjct: 196 ASSSALEAVIYNRIGDIGLITFMSLAVLTTNSWNLT----EIITNEPNNHFVLFMLFGLI 251

Query: 190 XXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVV 249
               GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AGVFL++R   LF + P A  +V
Sbjct: 252 LAAAGKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLVRTSELFSNYPNANTIV 311

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           L +G  TAL AA  A AQ+D+K+++A+ST SQ                 FH+  HA FK+
Sbjct: 312 LVLGGTTALFAASTAIAQHDIKKIIAYSTTSQLGLMVAAIGIGQPVLAFFHICTHAFFKA 371

Query: 310 ALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR 368
            LFL +G+ +      R+LR++ G+    P T              P L+G++S++ +L 
Sbjct: 372 MLFLCLGSVIHSLNNERNLRKMEGISDLSPVTSACLAMGSLALMGTPFLAGFYSKDLILE 431

Query: 369 QA-VSVHTAWGVFM-LVLILLAGIYIGRAAMATF 400
            A  S     G+ + +V  +L  +Y  R     F
Sbjct: 432 AASASFANTLGISLGIVATMLTTVYSFRIVFFCF 465


>NU5M_CYPCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 607

 Score =  148 bits (374), Expect = 1e-37
 Identities = 103/389 (26%), Positives = 162/389 (41%), Gaps = 10/389 (2%)

Query: 1   MPGRGSGLAVGGIFISALAVLPLSGADAEVALT---WFTVGPFELTVSLAADRLGWWMAT 57
           M G          F+S L ++       E  +T   W     F++ +S   D        
Sbjct: 33  MAGMTKTAVSSAFFVSLLPLMIFLNLKTEGIITNWQWMNTQAFDVNISFKFDHYSLIFVP 92

Query: 58  LVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLAS 117
           +  ++   +  +++ YM  +    RFF +L  F+  M            FI WEGVG+ S
Sbjct: 93  IALYVTWSILEFALWYMHSDPNIDRFFKYLLTFLVAMIILVTANNMFQLFIGWEGVGIMS 152

Query: 118 FVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXX 177
           F+LIG  HG+A A  AA +A++  R                  + ++   F   ++    
Sbjct: 153 FLLIGWWHGRADANTAALQAVIYNRVGDIGLIMTMAWLAMNLNSWEIQQIFALSKNFDMT 212

Query: 178 XXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                           GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++RL P
Sbjct: 213 IPLMGLALAAT-----GKSAQFGLHPWLPVAMEGPTPVSALLHSSTMVVAGIFLLIRLHP 267

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
             E+                   A  A  Q D+K+++A+ST SQ                
Sbjct: 268 RMENNQXXXXXXXXXXXXXXXFTATCALTQNDIKKIVAFSTSSQLGLMMVTIGLNQPQLA 327

Query: 298 XFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             H+  HA FK+ LFL  G+ +      +D+R++GGL   +P T              P 
Sbjct: 328 FLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLFNIMPATSTYFTIGSLALTGTPF 387

Query: 357 LSGYWSEEELLRQA-VSVHTAWGVFMLVL 384
           L+G++S++ ++     S   AW + + ++
Sbjct: 388 LAGFFSKDAIIEALNTSYLNAWALTLTLI 416


>NU5M_PONPY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  148 bits (373), Expect = 1e-37
 Identities = 140/364 (38%), Positives = 191/364 (52%), Gaps = 12/364 (3%)

Query: 55  MATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVG 114
           +A  V W    +  +S+ YMA +    +FF +                    FI WEGVG
Sbjct: 92  VALFVTW---SIMEFSLWYMASDPNINQFFKYXXXXXXXXXXXXXANNLLQLFIGWEGVG 148

Query: 115 LASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDX 174
           + SF+LI   + +  A  AA +A+L  R                + + +L   F      
Sbjct: 149 IMSFLLISWWYARTDANTAAIQAILYNRIGDIGFILTLAWFLLHSNSWELQQVF------ 202

Query: 175 XXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR 234
                               KSAQL L  WLP AM  PTPVSAL+HS+TM  AG+FL++R
Sbjct: 203 XXXXXXXXXXXXXXXXXXXXKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGIFLLIR 262

Query: 235 LFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXX 294
             PL E+ P    + L +GA T L AA+ A  Q D+K+++A+ST SQ             
Sbjct: 263 FHPLMENNPPIQTLALCLGAITTLFAAICALTQNDIKKIVAFSTSSQLGLMMVTIGINQP 322

Query: 295 XXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
                H+  HA FK+ LF+  G+ +      +D+R++GGL K                  
Sbjct: 323 HLAFLHICTHAFFKALLFMCSGSIIHNLNNEQDIRKMGGLLKXXXXXXXXXXXXXXXXAG 382

Query: 354 XPLLSGYWSEEELLRQA-VSVHTAWGV-FMLVLILLAGIYIGRAAMATFGLAPQAVMPAN 411
            P LSG++S++ ++  A +S   AW +   L+   L   Y  R  + T    P    P +
Sbjct: 383 MPFLSGFYSKDLIIETASMSYTNAWALSITLIATSLTSAYSTRMILHTLTGKPLLPTPIS 442

Query: 412 RRES 415
             E+
Sbjct: 443 INEN 446


>NU5M_LATCH RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 611

 Score =  147 bits (372), Expect = 2e-37
 Identities = 97/348 (27%), Positives = 146/348 (41%), Gaps = 7/348 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F + +S   D+       +  ++   +  ++  YM  +    +FF +L  F+  
Sbjct: 72  WMNTNTFNINISFKFDQYSIVFIPIALYVTWSILEFANWYMHQDPKMNQFFKYLLLFLIT 131

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  HG+A A  AA +A++  R           
Sbjct: 132 MMILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRANANTAALQAVIYNRVGDIGLTLSMV 191

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T ++   F                         GKSAQ  L  WLP AM  PT
Sbjct: 192 WFAINLNTWEMQQMF-----IMSYNTDMTIPLLGLTLAAAGKSAQFGLHPWLPAAMEGPT 246

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++RL PL ++  L                      Q D+K++
Sbjct: 247 PVSALLHSSTMVVAGIFLLIRLHPLMDNNKLIXXXXXXXXXXXXXXXXXXXXXQNDIKKI 306

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 307 IAFSTSSQLGLMMVAIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 366

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH-TAWGV 379
           L   LP T              P L+G++S++ ++    S H  AW +
Sbjct: 367 LHNMLPTTSSCTMVSSMALTGMPFLAGFFSKDAIIESLNSSHLNAWAL 414


>NU5M_STRCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 605

 Score =  147 bits (371), Expect = 2e-37
 Identities = 112/346 (32%), Positives = 170/346 (49%), Gaps = 9/346 (2%)

Query: 24  SGADAEVALTWFTVGP-FELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQR 82
           SG +A ++  +++  P  ++ +S   D+       +  ++   +  +++ YMA E    +
Sbjct: 59  SGTEAIISHWYWSFTPNLKIPLSFKMDQYSMLFLPVALFVTWSILQFAMWYMASEPHVTK 118

Query: 83  FFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTR 142
           FF +L  F+  M            FI WEGVG+ SF+LI   HG+A+A  AA +A++  R
Sbjct: 119 FFIYLLMFLIAMLTLTIANNMFMLFIGWEGVGIMSFLLISWWHGRAEANTAALQAVIYNR 178

Query: 143 XXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLT 202
                             T ++    QQ+                       KSAQ  L 
Sbjct: 179 IGDVGLILSMAWLASTLNTWEI----QQIS---YESQXXXXXXXXXXXXXXXKSAQFGLH 231

Query: 203 AWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAAL 262
            WLP AM  PTPVSAL+HS+TM  AG+FL++R+ PL  +                  AA 
Sbjct: 232 PWLPAAMEGPTPVSALLHSSTMVVAGIFLLVRIHPLLANNQXXXXXXXXXXXXXXXFAAT 291

Query: 263 VATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERA 321
            A  Q D+K+++A+ST SQ                  H++ HA FK+ LFL  G+ +   
Sbjct: 292 CALTQNDIKKIIAFSTSSQLGLMMVTIGLNLPQLAFLHISTHAFFKAMLFLCSGSIIHSL 351

Query: 322 TGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            G +D+R++GGL K LP T              P L+G++S++ ++
Sbjct: 352 AGEQDIRKMGGLQKLLPTTTSCLTIGNLALMGTPFLAGFYSKDLII 397


>NU5C_CAPBU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  147 bits (370), Expect = 3e-37
 Identities = 131/345 (37%), Positives = 172/345 (49%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +                         
Sbjct: 170 VAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NU5C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 692

 Score =  146 bits (369), Expect = 4e-37
 Identities = 116/346 (33%), Positives = 160/346 (46%), Gaps = 13/346 (3%)

Query: 68  VYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQ 127
           +YS  YM  + G  +FF +LS F   M            +I WE VG+ S++LIG    +
Sbjct: 109 IYSDSYMFYDEGYIKFFCYLSLFTASMLGLVLSPNLIQVYIFWELVGMCSYLLIGFWFTR 168

Query: 128 AKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP----FFQQVEDXXXXXXXXXX 183
             A  A  KA +  R               ITG+         FF+ +            
Sbjct: 169 PSAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFDFQQLSKRFFELLSYNQINLVFATL 228

Query: 184 XXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV R+FPLF+  P
Sbjct: 229 CALFLFLGPVAKSAQFPLHIWLPDAMEGPTPISALIHAATMVAAGIFLVARMFPLFQMLP 288

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
             ++++ W               Q DLK+ LA+ST+SQ                 FHL  
Sbjct: 289 FVMSIISWXXXXXXXXXXXXXXXQKDLKKGLAYSTMSQLGYMMLALGIGSYKAGLFHLIT 348

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E   G     ++++  +GGL + +P T              
Sbjct: 349 HAYSKALLFLGSGSVIHSMEPIVGYHPNKSQNMIFMGGLRQYMPITAITFLFGTLSLCGI 408

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P  + +WS++E+L  +       G        L   Y+ R    TF
Sbjct: 409 PPFACFWSKDEILVNSWLHFPILGSIAFFTAGLTAFYMFRIYFLTF 454


>NU5C_BARVE RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  146 bits (369), Expect = 4e-37
 Identities = 131/345 (37%), Positives = 172/345 (49%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +                         
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NU5C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  146 bits (369), Expect = 4e-37
 Identities = 134/345 (38%), Positives = 175/345 (50%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +                         
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXXXXXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLIGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NUOL_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 621

 Score =  145 bits (367), Expect = 6e-37
 Identities = 107/343 (31%), Positives = 168/343 (48%), Gaps = 6/343 (1%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W ++   ++  +   D L   M T+   I   + ++S  Y+  +    RFF++++ F+  
Sbjct: 68  WISIDYLKIDFNFMLDGLSITMLTMTTSIGFLIHLFSSWYIKLQDEYTRFFSYMNLFIAS 127

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            +I WEGVGL S++L+G ++ +  +  AA K  ++TR           
Sbjct: 128 MVXXXXXXXXXVMYIGWEGVGLCSYLLVGFYYSKINSGYAAIKGFIITRIGDIFLILAIF 187

Query: 154 XXXXITGTT---QLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMA 210
                 GT    +L   F+   +                   I KSAQ+PL  WL +AMA
Sbjct: 188 FIYKNFGTLNFRELKLIFETT-NVVENFKFLNYVSLFLLIAAIAKSAQVPLQTWLIDAMA 246

Query: 211 APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDL 270
            PTP SALIHS+TM  AGV+L+ R+  LF  +P+ L ++  +   T +++ L A  Q ++
Sbjct: 247 GPTPASALIHSSTMVTAGVYLIARMNFLFSLSPIILYILGIISCLTIIMSCLSALVQKNI 306

Query: 271 KRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQ 329
           K +LA+ST+ Q                  HL  HA FK+ LFLS GA +      +++  
Sbjct: 307 KCILAYSTMGQVGYMFLALAMKEWTLAINHLVTHAIFKTLLFLSAGAVIILLNNEKNIFN 366

Query: 330 LGGLGKRLPWTXXXXXXXXXXXXXXPLL-SGYWSEEELLRQAV 371
           +GGL K+ P                P+L SG++S+  +L  A+
Sbjct: 367 MGGLRKKFPMLYFSFLIGGASLASFPILTSGFYSKGNILFSAL 409


>NU5M_ONCMY RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 612

 Score =  145 bits (367), Expect = 6e-37
 Identities = 95/342 (27%), Positives = 144/342 (42%), Gaps = 6/342 (1%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F++ +S   D        +  ++   +  ++  YM  +    RFF +L  F+  
Sbjct: 73  WMNTTTFDINLSFKFDHYSIIFTPIALYVTWSILEFASWYMHADPNMNRFFKYLLLFLIA 132

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  HG+A A  AA +A++  R           
Sbjct: 133 MIILVTANNMFQLFIGWEGVGIMSFLLIGWWHGRADANTAAMQAVIYNRVGDIGLILSMA 192

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + ++   F   +                     GKSAQ  L  WLP AM  PT
Sbjct: 193 WFATNLNSWEIQQMFASSKGLDLTLPLMGLILAAT-----GKSAQFGLHPWLPSAMEGPT 247

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++RL PL E    AL V                  Q D+K++
Sbjct: 248 PVSALLHSSTMVVAGIFLLIRLHPLMEDNQTALTVXXXXXXXXXXXXXXXXXXQNDIKKI 307

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 308 VAFSTSSQLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 367

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
           +    P T              P L+G++S++ ++    + H
Sbjct: 368 MHNLTPSTSSCLTIGSLALTGTPFLAGFFSKDAIIEALNTSH 409


>NU5M_HUMAN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  145 bits (367), Expect = 6e-37
 Identities = 124/395 (31%), Positives = 186/395 (47%), Gaps = 12/395 (3%)

Query: 27  DAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRF 83
           D EV ++   W T    +L++S   D        +  ++   +  +S+ YM  +    +F
Sbjct: 58  DQEVIISNWHWATTQTTQLSLSFKLDYFSMMFIPVALFVTWSIMEFSLWYMNSDPNINQF 117

Query: 84  FAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRX 143
           F +L  F+  M            FI WEGVG+ SF+LI   + +A A  AA +A+L  R 
Sbjct: 118 FKYLLIFLITMLILVTANNLFQLFIGWEGVGIMSFLLISWWYARADANTAAIQAILYNRI 177

Query: 144 XXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                          + +           +                         LP   
Sbjct: 178 GDIGFILALAWFILHSNSWDPQQMALLNANPSXXXXXXXXXXXXXXXXXXXXHPWLP--- 234

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALV 263
               AM  PTPVSAL+HS+TM  AG+FL++R  PL E++PL   + L +GA T L AA+ 
Sbjct: 235 ---SAMEGPTPVSALLHSSTMVVAGIFLLIRFHPLAENSPLIQTLTLCLGAITTLFAAVC 291

Query: 264 ATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERAT 322
           A  Q D+K+++A+ST SQ                  H+  HA FK+ LF+  G+ +    
Sbjct: 292 ALTQNDIKKIVAFSTSSQLGLMMVTIGINQPHLAFLHICTHAFFKAMLFMCSGSIIHNLN 351

Query: 323 GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAWGV-F 380
             +D+R++GGL K +P T              P L+G++S++ ++  A +S   AW +  
Sbjct: 352 NEQDIRKMGGLLKTMPLTSTSLTIGSLALAGMPFLTGFYSKDHIIETANMSYTNAWALSI 411

Query: 381 MLVLILLAGIYIGRAAMATFGLAPQAVMPANRRES 415
            L+   L   Y  R  + T    P+     N  E+
Sbjct: 412 TLIATSLTSAYSTRMILLTLTGQPRFPTLTNINEN 446


>NU5C_LOBMA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  145 bits (367), Expect = 6e-37
 Identities = 125/345 (36%), Positives = 167/345 (48%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    F+   +               
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEIFNNLILTNRVNXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL P       
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPXXXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSFLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NU5C_CRUWA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 746

 Score =  145 bits (367), Expect = 6e-37
 Identities = 135/345 (39%), Positives = 175/345 (50%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +                         
Sbjct: 170 IAANACQKAFVTNRXXXXXXXXXXXXXYWITGSFEFQDXXXXXXXXXXXXRVNXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R    TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRIYFLTF 454


>NU5C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 655

 Score =  145 bits (367), Expect = 6e-37
 Identities = 118/389 (30%), Positives = 168/389 (43%), Gaps = 20/389 (5%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           + W     F L +  + D             A+ V +YS  YM+ + G  RFFA+LS F 
Sbjct: 73  IEWIVTNQFSLEIGYSIDPXXXXXXXXXXXXAILVMIYSDSYMSYDQGYVRFFAYLSLFT 132

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXX 151
             M            ++ WE VG+ S++LIG    +  A  A  KA +  R         
Sbjct: 133 ASMLGLVLSPNLVQIYVFWELVGMCSYLLIGFWFTRPAAADACQKAFVTNRVXXXXXXXX 192

Query: 152 XXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX-----------IGKSAQLP 200
                 +TG+ +      ++ +                              + KSAQ P
Sbjct: 193 XXXXYWVTGSFEFQTISNRLSNVLLGDFVLPGSHPVQVEXXXXXXXXXXXGPMAKSAQFP 252

Query: 201 LTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIA 260
           L  WLP+AM  PTP+SALIH+ATM AAGVFLV R+FP+F   P+ +              
Sbjct: 253 LHVWLPDAMEGPTPISALIHAATMVAAGVFLVARMFPIFNQFPIVMGFXXXXXXXXXXXX 312

Query: 261 ALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA--- 317
                 Q DLK+ LA+ST+SQ                 FHL  HA  K+ LFL  G+   
Sbjct: 313 XXXXVTQNDLKKGLAYSTISQLGYMIMAMGVGSYTAGLFHLITHAYSKALLFLGSGSVIH 372

Query: 318 -LERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
            +E   G      +++  +G + + +P T              P ++ +WS++E+L Q  
Sbjct: 373 GMEPVVGFNPSKNQNMLFMGKMREFMPVTAITFLLGTLSLCGIPPMACFWSKDEILSQTF 432

Query: 372 SVHTAWGVFMLVLILLAGIYIGRAAMATF 400
                  +   V   L   Y+ R     F
Sbjct: 433 QAQPILWIIAWVTAGLTSFYMFRMYFLVF 461


>NU5C_ARAHI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 741

 Score =  145 bits (366), Expect = 8e-37
 Identities = 133/345 (38%), Positives = 175/345 (50%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS   M+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNNMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQVYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
               A  KA +  R               ITG+ +    F+                   
Sbjct: 170 IPANACQKAFVTNRVGDFXXXXXXXXXYWITGSFEFQDLFEXXXXXXXXXXXXXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXVGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                      T L+ A +A AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXTVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILNDSLLFSPIFAIIAYSTAGLTAFYMFRIYLLTF 454


>NU5M_PONAB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  145 bits (365), Expect = 1e-36
 Identities = 137/364 (37%), Positives = 187/364 (51%), Gaps = 12/364 (3%)

Query: 55  MATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVG 114
           +A L+ W    +  +S+ YMA +                             FI WEGVG
Sbjct: 92  VALLITW---SIMEFSLWYMASDPNXXXXXXXXXXXXXXXXXXVTANNLLQLFIGWEGVG 148

Query: 115 LASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDX 174
           + SF+LI   + +  A  AA +A+L  R                + + +L   F      
Sbjct: 149 IMSFLLISWWYARTDANTAAIQAILYNRIGDIGFILALAWFLLHSNSWELQQVF------ 202

Query: 175 XXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR 234
                               KSAQL L  WLP AM  PTPVSAL+HS+TM  AGVFL++R
Sbjct: 203 XXXXXXXXXXXXXXXXXXXXKSAQLGLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLIR 262

Query: 235 LFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXX 294
             PL E++P    + L +GA T L AA+ A  Q D+K+++A+ST SQ             
Sbjct: 263 FHPLTENSPHIQTLTLCLGAITTLFAAICALTQNDIKKIVAFSTSSQLGLMMVTIGINQP 322

Query: 295 XXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
                H+  HA FK+ LF+  G+ +      +D+R++GGL K                  
Sbjct: 323 HLALLHICTHAFFKALLFMCSGSIIHNLNNEQDIRKMGGLLKXXXXXXXXXXXXXXXXAG 382

Query: 354 XPLLSGYWSEEELLRQA-VSVHTAWGV-FMLVLILLAGIYIGRAAMATFGLAPQAVMPAN 411
            P LSG++S++ ++  A +S    W +   L+   L G Y  R  + T    P    P +
Sbjct: 383 MPFLSGFYSKDLIIETANMSYTNTWALSITLIATSLTGAYSTRMILHTLTSKPHFPTPIS 442

Query: 412 RRES 415
             E+
Sbjct: 443 INEN 446


>NU5M_GADMO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 612

 Score =  145 bits (365), Expect = 1e-36
 Identities = 96/346 (27%), Positives = 151/346 (43%), Gaps = 7/346 (2%)

Query: 41  ELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXX 100
           ++T+S   D        +  ++   +  ++  YM  +    RFF +L  F+  M      
Sbjct: 80  DITLSFKFDHYSIIFIPIALYVTWSILEFATWYMHSDPFMNRFFKYLLTFLVAMLILVSA 139

Query: 101 XXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITG 160
                 FI WEGVG+ SF+LIG  HG+A A  AA +A+L  R                  
Sbjct: 140 NNLFQLFIGWEGVGIMSFLLIGWWHGRADANTAALQAVLYNRVGDIGLILGMAWLATNVN 199

Query: 161 TTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIH 220
           +  +   F   ++                    GKSAQ  L  WLP AM  PTPVSAL+H
Sbjct: 200 SWDIQQMFILSKNLDMTLPLLGLILAAT-----GKSAQFGLHPWLPAAMEGPTPVSALLH 254

Query: 221 SATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVS 280
           S+TM  AG+FL++R+ PL E+                +  A  A  Q D+K+++A+ST S
Sbjct: 255 SSTMVVAGIFLLIRMSPLMENNQXXXXXXXXXXXXXXMFTATCALTQNDIKKIVAFSTSS 314

Query: 281 QXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPW 339
           Q                  H+  HA FK+ LFL  G+ +      +D+R++GGL    P+
Sbjct: 315 QLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSVIHSLNDEQDIRKMGGLHHLAPF 374

Query: 340 TXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH-TAWGVFMLVL 384
           T              P L+G++S++ ++    + H  AW + + ++
Sbjct: 375 TSSCLTVGSLALTGTPFLAGFFSKDAIIEALNTSHVNAWALTLTLI 420


>NU5M_XENLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 604

 Score =  144 bits (364), Expect = 1e-36
 Identities = 111/353 (31%), Positives = 164/353 (46%), Gaps = 8/353 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +  F++ +S   D        +  ++   +  ++  YMA +    RFF +L  F+  
Sbjct: 70  WMNINTFDINMSFKFDIYSSIFIPIALFVTWSILEFATWYMASDPMISRFFKYLLTFLVA 129

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  + +A+   AA +A++  R           
Sbjct: 130 MVILVTANNFFQFFIGWEGVGIMSFLLIGWWYARAEPNTAALQAVIYNRVGDIGLILSMA 189

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + ++   F    D                     KSAQ  L  WLP AM  PT
Sbjct: 190 WVAMNLNSWEMQQVFMLNSD------NXXXXXXXXXXXXXXKSAQFGLHPWLPAAMEGPT 243

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R+ P+  +   AL + L +GA T L  A  A  Q D+K++
Sbjct: 244 PVSALLHSSTMVVAGIFLLIRISPMMNNNQTALTICLCLGAMTTLFTAACALTQNDIKKI 303

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERA-TGTRDLRQLGG 332
           +A+ST SQ                 FH+  +A FK   F   G         +D+R++GG
Sbjct: 304 VAFSTSSQ-LGLMMVTIGLIFQLAFFHICNNAFFKVYYFFCSGQYSSCLNDEQDIRKMGG 362

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLI 385
           L   LP T              P L+G++S++ ++    +  T      L LI
Sbjct: 363 LQNSLPITTSCLTIGSLALTGTPFLAGFFSKDAIIEALNTSQTNTWALTLTLI 415


>MNHA2_STAS1 RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 798

 Score =  144 bits (364), Expect = 1e-36
 Identities = 112/368 (30%), Positives = 164/368 (44%), Gaps = 21/368 (5%)

Query: 23  LSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGR-Q 81
           + G    V + W T+   ++ +    D                V  Y+  Y++ E     
Sbjct: 53  MQGNFVSVKIPWLTL--LDINIDFRLDXXXXXXXXXXXXXXXAVVYYATQYLSKEHDNLP 110

Query: 82  RFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMT 141
           RF+ +L  F+  M            ++ WE   ++SF+LI   + +  ++  A ++ ++T
Sbjct: 111 RFYVYLLLFMFSMLGIVTANNTILMYVFWELTSVSSFLLIVYWYSKGDSQFGAIQSFMIT 170

Query: 142 RXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPL 201
                           +TGT  +    +Q  D                     KSAQ P 
Sbjct: 171 VFGGLALLAGFIMIYIVTGTNSITSIIEQ-SDKIAQSHXXXXXXXXXXXGAFTKSAQFPF 229

Query: 202 TAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAA 261
             WLP+AMAAPTPVSA +HSATM  AG+FL+ R   +   +   +  V +VG  T +  A
Sbjct: 230 HIWLPKAMAAPTPVSAYLHSATMVKAGIFLLFRFTSVLGLSDFYIYSVTFVGLITMIFGA 289

Query: 262 LVATAQYDLKRLLAWSTVSQ-----------------XXXXXXXXXXXXXXXXXFHLTVH 304
           + AT Q+D+K +LA+ST+SQ                                  FHL  H
Sbjct: 290 VNATRQFDMKAILAYSTISQLGMIVSMVGLGGGFAQHPTGELSKIYGMILFAALFHLMNH 349

Query: 305 ATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEE 364
           A +K ALF+ VG ++  TGTRD+R+L GL K  P T              P L+G+ S+E
Sbjct: 350 ALYKGALFMGVGIIDHETGTRDIRRLSGLKKVFPITHIVMLLSALSMAGIPFLNGFLSKE 409

Query: 365 ELLRQAVS 372
                 VS
Sbjct: 410 MFFDGLVS 417


>NU5M_CHICK RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 605

 Score =  144 bits (363), Expect = 2e-36
 Identities = 96/335 (28%), Positives = 145/335 (43%), Gaps = 8/335 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +  F++ +SL  D        +  ++   +  ++  YMA E    +FF +L  F+  
Sbjct: 69  WQFIPNFKIPISLKMDMYSMMFFPIALFVTWSILEFATWYMASEPFITKFFTYLLTFLIA 128

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            F+ WEGVG+ SF+LIG   G+A+A  AA +A++  R           
Sbjct: 129 MLTLTIANNMFLLFVGWEGVGIMSFLLIGWWQGRAEANTAALQAMIYNRIGDIGLILSMA 188

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  T ++    QQ+                      GKSAQ  L  WLP AM  PT
Sbjct: 189 WLASSLNTWEI----QQITHPNQTPTLPLLGLILAAT---GKSAQFGLHPWLPAAMEGPT 241

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++R  P                      AA  A  Q D+K++
Sbjct: 242 PVSALLHSSTMVVAGIFLLIRTHPFLSSNKXXXXXXXXXXXXXXXFAATCALTQNDIKKI 301

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG-ALERATGTRDLRQLGG 332
           +A+ST SQ                  H++ HA FK+ LFL  G  +    G +D+R++G 
Sbjct: 302 IAFSTSSQLGLMMVTIGLDLPQLAFLHISTHAFFKAMLFLCSGLIIHSLNGEQDIRKMGC 361

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
           L K LP T              P L+G++S++ ++
Sbjct: 362 LQKTLPMTTSCLTIGNLALMGTPFLAGFYSKDLII 396


>NU5M_TETNG RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 612

 Score =  144 bits (362), Expect = 2e-36
 Identities = 112/356 (31%), Positives = 165/356 (46%), Gaps = 8/356 (2%)

Query: 25  GADAEVA-LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRF 83
           GA+A +  L+W     F++ +SL  D        +  ++   +  ++  YM  +    RF
Sbjct: 63  GAEAVITNLSWMNTHTFDINISLKFDHYSIIFTPVALYVTWSILEFASWYMHADPFMNRF 122

Query: 84  FAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRX 143
           F +L  F+  M            FI WEGVG+ SF+LIG  + +A A  AA +A+L  R 
Sbjct: 123 FKYLLTFLIAMIILVTANNMFQLFIGWEGVGIMSFLLIGWWYARADANTAALQAVLYNRV 182

Query: 144 XXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                            + ++   F   +D                    GKSAQ  L  
Sbjct: 183 GDIGLVFSMAWMATHLNSWEIQQIFFSSKDMDXXXXXXXXXXXXX-----GKSAQFGLHP 237

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALV 263
           WLP AM  PTPVSAL+HS+TM  AG+FL++R  PL E+ P                    
Sbjct: 238 WLPSAMEGPTPVSALLHSSTMVVAGIFLLIRTSPLMENNPXXXXXXXXXXXXXXXXXXXX 297

Query: 264 ATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERAT 322
              Q D+K+++A+ST SQ                  H+  HA FK+ LFL  G+ +    
Sbjct: 298 XXXQNDIKKIVAFSTSSQLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLN 357

Query: 323 GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA-VSVHTAW 377
             +D+R++GG+    P+T              P L+G++S++ ++     S   AW
Sbjct: 358 DEQDIRKMGGMHHLTPFTSSCLTIGSLALTGTPFLAGFFSKDAIIEALNTSYLNAW 413


>NU5C_MORIN RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 754

 Score =  143 bits (361), Expect = 3e-36
 Identities = 144/407 (35%), Positives = 193/407 (47%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F + LA+  ++     +++ +W     F L      D L   M           
Sbjct: 48  LSIIMLFSTYLAIQQVNNPSIYLSIWSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFFA++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDQGYLRFFAYMSFFNTSMVGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+                 
Sbjct: 168 RPTAANACQKAFVTNRVXXXXXXXXXXXXYWITGSLEFRDLFEIFXXXXXXXXXXXXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FL  RL PLF   
Sbjct: 228 XXXXXXXXGAIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLGARLLPLFIVM 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +                   AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNXXXXXXXXXXXXXXXXXFAQKDIKRGLAYSTMSQLGYMMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     +++L  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMESIVGYSPDKSQNLVLMGGLKKHVPITKTSFLLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L  +WS++E+L  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLGCFWSKDEILNDSWLYSPIFAIIAFSTAGLTAFYMFRIYLLTF 454


>NU5C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  142 bits (359), Expect = 5e-36
 Identities = 134/365 (36%), Positives = 178/365 (48%), Gaps = 13/365 (3%)

Query: 49  DRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFI 108
           D L   M  L+  + + V +YS  YM+ + G  RFFA++ FF   M            + 
Sbjct: 90  DPLSCIMVILITTVGIFVLIYSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQIYF 149

Query: 109 AWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFF 168
            WE VG+ S++LIG    +  A  A  KA +  R               +TG+ +     
Sbjct: 150 FWELVGMCSYLLIGFWFTRPIAANACQKAFVTNRVGDFXXXXXXXXXYWVTGSFEFQDXX 209

Query: 169 QQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATM 224
                                       I KSAQ PL  WLP+AM  PTP+SALIH+ATM
Sbjct: 210 XXXXXXXXXXXXXXXXXXXXXXXXXMGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATM 269

Query: 225 AAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXX 284
            AAG+FLV RL PLF                          AQ D+KR LA+ST+SQ   
Sbjct: 270 VAAGIFLVARLLPLFXXXXXXXXXXXXXXXXXXXXXXXXXXAQKDIKRGLAYSTMSQLGY 329

Query: 285 XXXXXXXXXXXXXXFHLTVHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGK 335
                         FHL  HA  K+ LFL  G    ++E   G     ++++  +GGL K
Sbjct: 330 MMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMEALVGYSPDKSQNMILMGGLTK 389

Query: 336 RLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRA 395
            +P T              P L+ +WS++E+L  ++     + +       L   Y+ R 
Sbjct: 390 HVPITKTAFLLGTLSLCGIPPLACFWSKDEILNDSLLFSPIFAIIACSTAGLTAFYMFRI 449

Query: 396 AMATF 400
            + TF
Sbjct: 450 YLLTF 454


>MNHA1_STAES RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  142 bits (359), Expect = 5e-36
 Identities = 119/377 (31%), Positives = 174/377 (46%), Gaps = 19/377 (5%)

Query: 13  IFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVP 72
           I+  +L  + +SG +    L W       +  +L  D LG   + L+  I   V +YS+ 
Sbjct: 43  IYFISLISMTMSGNNVMKNLNWMP--HIGMNFNLYVDGLGLLFSLLITGIGSLVVLYSIG 100

Query: 73  YMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQ 132
           Y++       F+ +L  F+G M            ++ WE               +  +  
Sbjct: 101 YLSKSEQLGNFYCYLLLFMGAMLGVVLSDNFIILYLFWEXXXXXXXXXXXXWREKKASIY 160

Query: 133 AAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX 192
            A K+L++T                 T T  +     +  D                   
Sbjct: 161 GAQKSLIITVXXXXXXXXXXXXXXXATDTFSIQAMISKASDIQNSPFFILVMILFMIGAF 220

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
             KSAQ+P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  +  V
Sbjct: 221 T-KSAQVPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARITPIFAISEGWVWTITLV 279

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXXXXXX 296
           G  T   A+L AT Q+DLK +LA+STVSQ                               
Sbjct: 280 GLITLFWASLNATKQHDLKGILAFSTVSQLGMIMSMLGIGAVSYHYQGANSQLYVAGFVA 339

Query: 297 XXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             FHL  HATFK ALF+  G ++ +TGTRD+++LGGL   +P +              P 
Sbjct: 340 AIFHLINHATFKGALFMITGGIDHSTGTRDVKKLGGLLTIMPISFTLTVITTLSMAGVPP 399

Query: 357 LSGYWSEEELLRQAVSV 373
            +G+ S+E+ L   ++V
Sbjct: 400 FNGFLSKEKFLESMINV 416


>MNHA1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  142 bits (359), Expect = 5e-36
 Identities = 119/377 (31%), Positives = 174/377 (46%), Gaps = 19/377 (5%)

Query: 13  IFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVP 72
           I+  +L  + +SG +    L W       +  +L  D LG   + L+  I   V +YS+ 
Sbjct: 43  IYFISLISMTMSGNNVMKNLNWMP--HIGMNFNLYVDGLGLLFSLLITGIGSLVVLYSIG 100

Query: 73  YMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQ 132
           Y++       F+ +L  F+G M            ++ WE               +  +  
Sbjct: 101 YLSKSEQLGNFYCYLLLFMGAMLGVVLSDNFIILYLFWEXXXXXXXXXXXXWREKKASIY 160

Query: 133 AAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX 192
            A K+L++T                 T T  +     +  D                   
Sbjct: 161 GAQKSLIITVXXXXXXXXXXXXXXXATDTFSIQAMISKASDIQNSPFFILVMILFMIGAF 220

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
             KSAQ+P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  +  V
Sbjct: 221 T-KSAQVPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARITPIFAISEGWVWTITLV 279

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXXXXXX 296
           G  T   A+L AT Q+DLK +LA+STVSQ                               
Sbjct: 280 GLITLFWASLNATKQHDLKGILAFSTVSQLGMIMSMLGIGAVSYHYQGANSQLYVAGFVA 339

Query: 297 XXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             FHL  HATFK ALF+  G ++ +TGTRD+++LGGL   +P +              P 
Sbjct: 340 AIFHLINHATFKGALFMITGGIDHSTGTRDVKKLGGLLTIMPISFTLTVITTLSMAGVPP 399

Query: 357 LSGYWSEEELLRQAVSV 373
            +G+ S+E+ L   ++V
Sbjct: 400 FNGFLSKEKFLESMINV 416


>NUOL_RICBR RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 642

 Score =  142 bits (358), Expect = 7e-36
 Identities = 79/208 (37%), Positives = 115/208 (55%)

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
           +GKSAQ+ L  WLP+AM  PTPVSALIH+ATM  AGVFLV R   LFE++P+ L  +  +
Sbjct: 235 MGKSAQIGLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARCSYLFEYSPMVLQFITII 294

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALF 312
           G  T L AA +A  Q D+K+++A+ST SQ                 FHL  HA FK+ LF
Sbjct: 295 GGITCLFAASIAIMQNDIKKIIAYSTCSQLGYMFMACGVSAYNSGIFHLVTHAFFKALLF 354

Query: 313 LSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
           LS G++  A   +D+ ++G L  ++P T                L+G++S++ +L  A S
Sbjct: 355 LSAGSVIHAVHEQDIFKMGELRNKMPITYGNFLIGSLALIGIYPLAGFYSKDSILEAAYS 414

Query: 373 VHTAWGVFMLVLILLAGIYIGRAAMATF 400
             +   +F ++  +L  IY  +  M  F
Sbjct: 415 SGSFMFIFGILAAILTAIYSMKIIMLVF 442



 Score = 48.1 bits (113), Expect = 2e-07
 Identities = 30/91 (32%), Positives = 43/91 (47%)

Query: 32  LTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFV 91
           L W  V  F++  S+  D+L   M   V W++  V +YS+ YM+ + G  R         
Sbjct: 66  LPWIEVSQFKVDWSIYIDQLTSIMFIAVTWVSSVVHIYSLGYMSRDKGIVRXXXXXXXXX 125

Query: 92  GMMXXXXXXXXXXXXFIAWEGVGLASFVLIG 122
                          F  WEGVG+ S++LIG
Sbjct: 126 XXXXXXVSADNFLQLFFGWEGVGICSYLLIG 156


>NU5C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 729

 Score =  142 bits (358), Expect = 7e-36
 Identities = 123/346 (35%), Positives = 173/346 (50%), Gaps = 13/346 (3%)

Query: 68  VYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQ 127
           +YS  YM  + G  RF+A+LS F   M            ++ WE VG+ S++L+G    +
Sbjct: 109 IYSDSYMCYDRGYTRFYAYLSLFTASMLGLVLSPNLIQLYVFWELVGMCSYLLVGFWFAR 168

Query: 128 AKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP----FFQQVEDXXXXXXXXXX 183
           + A  A  KA +  R                TG+ ++      F +  E           
Sbjct: 169 SSAANACQKAFVTNRXXXXXXXXXXXXXYWTTGSFEISELCDRFAKLKEIGFSNPILTNI 228

Query: 184 XXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP 243
                    + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+F + R++ L    P
Sbjct: 229 IAFLLLAGPVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFFIARIYGLISTLP 288

Query: 244 LALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV 303
           L +    W               Q DLK+ LA+ST+SQ                 FHL  
Sbjct: 289 LVMQASSWXXXXXXXXXXXXXXXQRDLKKGLAYSTMSQLGYMVLALGIGAYQSALFHLVT 348

Query: 304 HATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXX 354
           HA  K+ LFL  G    ++E+  G     ++++  +GGL K +P                
Sbjct: 349 HAYSKALLFLGAGSVIHSIEKVVGYSPNRSQNMFFMGGLRKYMPIXXXXXXXXXXXXXXI 408

Query: 355 PLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
           P L+ +WS++E++ ++       G+       L   Y+ R  + TF
Sbjct: 409 PPLACFWSKDEIIHESWLSSLPLGILASGTAGLTAFYMFRIYLLTF 454


>NU5C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  142 bits (357), Expect = 9e-36
 Identities = 125/407 (30%), Positives = 177/407 (43%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADA-EVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  IF   L++  ++G+   +   +W     F     L  D L   M           
Sbjct: 48  LSIVMIFSFNLSIQQINGSSIYQYVCSWTINNDFSFEFGLLIDSLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFFA++SF    M             I WE VG+ S++LIG    
Sbjct: 108 XXYSDNYMSHDQGYLRFFAYMSFSNISMLGLVTSSNLIQIHIFWELVGVCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAANACQKAFVTNRVXXXXXXXXXXXXYWITGSFEFRDLFEIFNNLIYNNQVNSLFVI 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   
Sbjct: 228 LCASLLFVGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFTVI 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
           P  +                    Q D+KR LA+ST+SQ                 FHL 
Sbjct: 288 PYIMNXXXXXXXXXXXXXXXXXXXQKDIKRSLAYSTMSQLGYIMLALGMGSYRAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMESIVGYSPDKSQNMILMGGLKKYVPITKTAFFLGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E++  +      + +       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEIINDSWLYSPIFAIIACSTAGLTAFYMFRTYLLTF 454


>NU5M_CROLA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 612

 Score =  141 bits (356), Expect = 1e-35
 Identities = 104/384 (27%), Positives = 164/384 (42%), Gaps = 15/384 (3%)

Query: 9   AVGGIFISALAVLPLS---GADAEVALT---WFTVGPFELTVSLAADRLGWWMATLVAWI 62
           AV   F+  +++LPL+       E  +T   W     F++ +S   D        +  ++
Sbjct: 44  AVSSAFL--ISLLPLAVFLDQGTETIVTNWHWMNTTMFDINISFKFDYYSLVFTPIALYV 101

Query: 63  ALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIG 122
              +  ++  YM  +    RFF +L  F+  M            FI WEGVG+ SF+LIG
Sbjct: 102 TWSILEFASWYMHADPYVNRFFKYLLTFLIAMITLVTANNMFQLFIGWEGVGIMSFLLIG 161

Query: 123 QHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXX 182
             +G+A A  AA +A +  R                  + ++   F   +D         
Sbjct: 162 WWYGRADANTAALQAWIYNRVGDIGLIMSMAWLAMNLNSWEIQQIFFLSKDFDMTLPLMG 221

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                      GKSAQ  L  WLP AM  PTPVSAL+HS+TM  AG+FL++RL  + E+ 
Sbjct: 222 LILAAT-----GKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGIFLLIRLHAIMENN 276

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
                             A  A  Q D+K+++A+ST SQ                  H+ 
Sbjct: 277 QXXXXXXXXXXXXXXXFTAACALTQNDIKKIVAFSTSSQLGLMMVTIGLNQPQLAFLHIC 336

Query: 303 VHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYW 361
            HA FK+ LFL  G+ +      +D+R++GGL   LP+T              P L+G++
Sbjct: 337 THAFFKAMLFLCSGSIIHSLNDEQDIRKMGGLQNLLPFTSTCLTIGSLALTGTPFLAGFF 396

Query: 362 SEEELLR-QAVSVHTAWGVFMLVL 384
           S++ ++     S   AW + + ++
Sbjct: 397 SKDAIIEAMNTSYLNAWALTLTLI 420


>NU5M_CHLRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 546

 Score =  141 bits (356), Expect = 1e-35
 Identities = 102/341 (29%), Positives = 153/341 (44%), Gaps = 17/341 (4%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           TWF+VG F    +   D L   M   V  +++ V +Y+  YM  +     F  +LS+F G
Sbjct: 65  TWFSVGTFHAGWTFNFDLLTANMLFTVTGVSMAVHMYACDYMRQDPHLNLFLGYLSYFTG 124

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M             + WEG+G+ S++LIG    +  A ++A KA+L+ R          
Sbjct: 125 FMCVLVAADNLLVMLVGWEGIGVCSYLLIGYWSHRLSAVKSAQKAILVNRVSDGLLMWGV 184

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAP 212
                  G+ +         D                   +GKSAQ+    WL +AM  P
Sbjct: 185 LWVWYHLGSLEY--------DLLNVYSASGFVGLSILIGAMGKSAQILFHVWLADAMEGP 236

Query: 213 TPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKR 272
           TPVSALIH+AT+  AGV+L++RL     H    + V++ VG+ TA +A +    Q DLKR
Sbjct: 237 TPVSALIHAATLVTAGVYLLVRL-----HIHDEMFVII-VGSLTAFMAGVFGATQSDLKR 290

Query: 273 LLAWSTVSQXXXXXXXXXXXXXXXXXF--HLTVHATFKSALFLSVG-ALERATGTRDLRQ 329
           ++A+ST SQ                    HL  HA+FK+ALFL+ G  +    G + + +
Sbjct: 291 VIAYSTCSQLGYMMVSLGLGETGGEASMGHLMTHASFKAALFLAAGMVISGNGGNQHIAR 350

Query: 330 LGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
            GG      +T              P LSG++S+E +L  A
Sbjct: 351 YGGSAHSAMFTMLTLMVASLSLIGWPELSGFYSKETILNLA 391


>NU5M_SALSA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 612

 Score =  140 bits (354), Expect = 2e-35
 Identities = 91/342 (26%), Positives = 144/342 (42%), Gaps = 6/342 (1%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F++ +S   D        +  ++   +  ++  YM  +    RFF +L  F+  
Sbjct: 73  WMNTTTFDINLSFKFDHYSIIFTPIALYVTWSILEFASWYMHADPNMNRFFKYLLLFLIA 132

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            FI WEGVG+ SF+LIG  +G+A A  AA +A++  R           
Sbjct: 133 MIILVTANNMFQLFIGWEGVGIMSFLLIGWWYGRADANTAAMQAVIYNRVGDIGLILSMA 192

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                  + ++   F   ++                    GKSAQ  L  WLP AM  PT
Sbjct: 193 WFATNLNSWEIQQMFASSKELDLTLPLMGLILAAT-----GKSAQFGLHPWLPSAMEGPT 247

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AG+FL++RL PL E+                         Q D+K++
Sbjct: 248 PVSALLHSSTMVVAGIFLLIRLHPLMENNQXXXXXXXXXXXXXXXXXXXXXXXQNDIKKI 307

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+  HA FK+ LFL  G+ +      +D+R++GG
Sbjct: 308 VAFSTSSQLGLMMVTIGLNQPQLAFLHICTHAFFKAMLFLCSGSIIHSLNDEQDIRKMGG 367

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
           +    P+T              P L+G++S++ ++    + H
Sbjct: 368 MHNLTPFTSSCLTIGSLALTGTPFLAGFFSKDAIIEALNTSH 409


>NU5C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 652

 Score =  140 bits (354), Expect = 2e-35
 Identities = 123/350 (35%), Positives = 163/350 (46%), Gaps = 13/350 (3%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W     F L +    D                   Y+  YM+ + G  RFFA+LS F   
Sbjct: 75  WIVTNNFLLEIGYFVDPXXXXXXXXXXXXXXXXXXYTDGYMSYDEGYVRFFAYLSLFTTS 134

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M            ++ WE VG+ S++LIG    +  A  A  KA +  R           
Sbjct: 135 MLGLVLSPNLLQIYVFWELVGMCSYLLIGFWFTRPAAADACQKAFVTNRVXXXXXXXXXX 194

Query: 154 XXXXITGTTQLP----PFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAM 209
               +TG+ +         Q  E                    + KSAQ PL  WLP+AM
Sbjct: 195 XXYWMTGSFEFDVISMKLLQLAEYDNFNTQLAXXXXXXXXXXPVAKSAQFPLHVWLPDAM 254

Query: 210 AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYD 269
             PTP+SALIH+ATM AAGVFLV R+FP+F   P  + +                  Q D
Sbjct: 255 EGPTPISALIHAATMVAAGVFLVARMFPIFSQFPFLMDLXXXXXXXXXXXXXXXXVTQVD 314

Query: 270 LKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA----LERATG-- 323
           LK+ LA+ST+SQ                 FHL  HA  K+ LFLS G+    +E   G  
Sbjct: 315 LKKGLAYSTMSQLGYMIMAMGMGSYTASLFHLMTHAYSKALLFLSAGSTIHGMEPIVGFN 374

Query: 324 ---TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
               +++  +GG+ K +P T              P L+ +WS++ +L  A
Sbjct: 375 PAKNQNMSLMGGIRKYMPITGNAFLIGTLSLCGIPPLACFWSKDAILSNA 424


>MRPA_BACPF RecName: Full=Na(+)/H(+) antiporter subunit A;AltName:
           Full=Multiple resistance and pH homeostasis protein
           A;AltName: Full=Mrp complex subunit A;
          Length = 805

 Score =  140 bits (354), Expect = 2e-35
 Identities = 116/404 (28%), Positives = 171/404 (42%), Gaps = 31/404 (7%)

Query: 14  FISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPY 73
           FI  L++    G   E  + W  V    +  ++  D L    A            YS+ Y
Sbjct: 45  FIQYLSITSTGGV-VEHTIPW--VPSLGINFTVFVDGLSLLFAXXXXXXXXXXXXYSIFY 101

Query: 74  MADEA-GRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQ 132
           ++ +      F+ +L  F+G M            ++ WE   LAS +LI     + K+  
Sbjct: 102 LSKKTESLNNFYVYLLMFMGAMLGVVLSDNLIVLYVFWELTSLASSLLISYWFHREKSTY 161

Query: 133 AAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX 192
            A K++L+T                +TGT  +    + V D                   
Sbjct: 162 GAQKSMLITVFGGFAMLGGFSLLYVMTGTFSIRGIIENV-DLVTSSELFLPAMILVLLGA 220

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
             KSAQ P   WLP+AM APTPVSA +HSATM  AG++LV RL P+F  +     ++   
Sbjct: 221 FTKSAQFPFHIWLPDAMEAPTPVSAYLHSATMVKAGIYLVARLTPVFAGSAEWFWLLTGF 280

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXXXXXXXXXX 295
           G  T L  +  A  Q DLK +LA+STVSQ                               
Sbjct: 281 GVVTLLWGSTSAVRQKDLKGILAFSTVSQLGLIMTLLGLGSAAIYFGESVDPAFYSFAIM 340

Query: 296 XXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
              FHL  HATFK +LF++ G ++  TGTRD+R+LGGL   +P T              P
Sbjct: 341 AAIFHLINHATFKGSLFMTAGIIDHETGTRDIRKLGGLMAIMPVTFTVSLIGLASMAGLP 400

Query: 356 LLSGYWSEE----ELLR----QAVSVHTAWGVFMLVLILLAGIY 391
             +G+ S+E     LLR     A ++ T +G+ ++VL  +A ++
Sbjct: 401 PFNGFLSKEMFFTALLRATEMNAFNMET-FGIIIVVLAWIASVF 443


>MNHA1_STAS1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 805

 Score =  140 bits (354), Expect = 2e-35
 Identities = 114/350 (32%), Positives = 162/350 (46%), Gaps = 17/350 (4%)

Query: 40  FELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXX 99
           F +  +L  D LG   + L+  I   + +YS+ Y++ +     F+ +L  F+G M     
Sbjct: 68  FGMNFNLYVDGLGLLFSLLITGIGCLIVLYSISYLSRQEQLGHFYCYLLLFMGAMLGLVL 127

Query: 100 XXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXIT 159
                  ++ WE               +  +   A K++L+T                  
Sbjct: 128 SDNLIILYLFWEXXXXXXXXXXXXWRDKQASIYGAQKSMLVTVFXXXXXXXXXXXXXXXX 187

Query: 160 GTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALI 219
            TT +        +                   + KSAQ P   WLP+AM APTPVSA +
Sbjct: 188 XTTSIQELINNASEIQTSPFFIFSMILVLIGA-MTKSAQFPFYVWLPDAMEAPTPVSAYL 246

Query: 220 HSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTV 279
           HSATM  AG++LV R+ P+F  +   +  V  VG  T   A+L AT Q DLK +LA+STV
Sbjct: 247 HSATMVKAGLYLVARMTPIFAVSQGWIWTVTAVGLITLFWASLNATKQQDLKGILAFSTV 306

Query: 280 SQ----------------XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATG 323
           SQ                                 FHL  HATFK ALF+  GA++ +TG
Sbjct: 307 SQLGMIMAMLGVGAVSFHFEGAESQIYIAAFTAAIFHLINHATFKGALFMITGAVDHSTG 366

Query: 324 TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
           TRD+++LGGL   +P +              P  +G+ S+E+ L   + V
Sbjct: 367 TRDVKKLGGLLTIMPISFTITLITSLSMAGIPPFNGFLSKEKFLESMIEV 416


>NU5M_ELEMA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  140 bits (352), Expect = 3e-35
 Identities = 119/340 (35%), Positives = 169/340 (49%), Gaps = 9/340 (2%)

Query: 58  LVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLAS 117
           +  +I   +  +S+ YM  +    RFF +                    F+ WEGVG+ S
Sbjct: 95  IALFITWSIMEFSLWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEGVGIMS 154

Query: 118 FVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXX 177
           F+LI   HG+  A  AA +A+L  R                  + +    FQQ+      
Sbjct: 155 FLLISWWHGRTDANTAALQAMLYNRIGDMGFIMMMAWFIIHLNSWE----FQQI--FXXX 208

Query: 178 XXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                              AQ  L  WLP AM  PTPVSAL+HS+TM  AGVF ++R +P
Sbjct: 209 XXXXXXXXXXXXXXXXXXXAQFGLHPWLPSAMEGPTPVSALLHSSTMVMAGVFTLIRFYP 268

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
           L E+        L +GA T L  A+ A  Q D+K+++A ST SQ                
Sbjct: 269 LMENNLTIQTSTLCLGAITTLFTAICALTQNDIKKIIALSTSSQLGLMMVTIGINQPHLA 328

Query: 298 XFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             H+  HA FK+ LFLS G+ +      +D+R++GGL K +P T              P 
Sbjct: 329 FTHMCTHAFFKAMLFLSSGSIIHNLDNEQDIRKMGGLYKTMPITSTAIIIGSLALTGMPF 388

Query: 357 LSGYWSEEELLRQA-VSVHTAWGVFM-LVLILLAGIYIGR 394
           L+G++S++ ++  A +S    W + + L+ + +   Y  R
Sbjct: 389 LTGFYSKDPIIETANMSYINTWALLITLIAVSMTASYSTR 428


>NU5C_AGRST RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 739

 Score =  140 bits (352), Expect = 3e-35
 Identities = 136/407 (33%), Positives = 188/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSVQLSIQQINGSSIYQYLWSWTVNNDFSLEFGYLIDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDGYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPLAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG              
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGXXXXXXXXXXXXXX 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
                    VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 XXXXXXXXXVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSIIHSMEPLVGYSPDKSQNMVLMGGLRKYIPITRSTFLWGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_SACOF RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 738

 Score =  139 bits (350), Expect = 6e-35
 Identities = 136/407 (33%), Positives = 188/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSLHLSIQQINGSSIYQYLWSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG              
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGXXXXXXXXXXXXXX 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
                    VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 XXXXXXXXXVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYVPITRTTFLCGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5C_SACHY RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 738

 Score =  139 bits (350), Expect = 6e-35
 Identities = 136/407 (33%), Positives = 188/407 (46%), Gaps = 14/407 (3%)

Query: 8   LAVGGIFISALAVLPLSGADAEVAL-TWFTVGPFELTVSLAADRLGWWMATLVAWIALPV 66
           L++  +F   L++  ++G+     L +W     F L      D L   M           
Sbjct: 48  LSIAMVFSLHLSIQQINGSSIYQYLWSWTINNDFSLEFGYLVDPLTSIMXXXXXXXXXXX 107

Query: 67  AVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHG 126
             YS  YM+ + G  RFF ++SFF   M            +  WE VG+ S++LIG    
Sbjct: 108 XXYSDDYMSHDEGYLRFFVYISFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFT 167

Query: 127 QAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQ----QVEDXXXXXXXXX 182
           +  A  A  KA +  R               ITG+ +    F+     + +         
Sbjct: 168 RPIAASACQKAFVTNRVXXXXXXXXXXXXXWITGSLEFRDLFKIANNWIPNNGINSXXXX 227

Query: 183 XXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHA 242
                     + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG              
Sbjct: 228 XXXXXXXXGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGXXXXXXXXXXXXXX 287

Query: 243 PLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT 302
                    VG  T  + A +A AQ D+KR LA+ST+SQ                 FHL 
Sbjct: 288 XXXXXXXXXVGTITLFLGATLALAQRDIKRSLAYSTMSQLGYMMLALGIGSYQAALFHLI 347

Query: 303 VHATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXX 353
            HA  K+ LFL  G    ++E   G     ++++  +GGL K +P T             
Sbjct: 348 THAYSKALLFLGSGSVIHSMEPLVGYSPDKSQNMVLMGGLRKYVPITRTTFLCGTLSLCG 407

Query: 354 XPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            P L+ +WS++E+L  +      +G+       L   Y+ R  + TF
Sbjct: 408 IPPLACFWSKDEILSNSWLYSPFFGIIASFTAGLTAFYMFRIYLLTF 454


>NU5M_MAMPR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 603

 Score =  138 bits (348), Expect = 1e-34
 Identities = 118/340 (34%), Positives = 168/340 (49%), Gaps = 9/340 (2%)

Query: 58  LVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLAS 117
           +  +I   +  +S+ YM  +    RFF +                    F+ WEGVG+ S
Sbjct: 92  IALFITWSIMEFSLWYMHSDPHINRFFKYXXXXXXXXXXXVSANNLLQLFMGWEGVGIMS 151

Query: 118 FVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXX 177
           F+LI   HG+  A  AA +A+L  R                  + +    FQQ+      
Sbjct: 152 FLLISWWHGRTDANTAALQAMLYNRIGDMGFIMMMAWFIIHLNSWE----FQQI--FXXX 205

Query: 178 XXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP 237
                               Q  L  WLP AM  PTPVSAL+HS+TM  AGVF ++R +P
Sbjct: 206 XXXXXXXXXXXXXXXXXXXXQFGLHPWLPSAMEGPTPVSALLHSSTMVMAGVFTLIRFYP 265

Query: 238 LFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXX 297
           L E+        L +GA T L  A+ A  Q D+K+++A ST SQ                
Sbjct: 266 LMENNLTVQTSTLCLGAITTLFTAICALTQNDIKKIIALSTSSQLGLMMVTIGINQPHLA 325

Query: 298 XFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             H+  HA FK+ LFLS G+ +      +D+R++GGL K +P T              P 
Sbjct: 326 FTHMCTHAFFKAMLFLSSGSIIHNLDNEQDIRKMGGLYKTMPITSTAIIIGSLALTGMPF 385

Query: 357 LSGYWSEEELLRQA-VSVHTAWGVFM-LVLILLAGIYIGR 394
           L+G++S++ ++  A +S    W + + L+ + +   Y  R
Sbjct: 386 LTGFYSKDPIIETANMSYINTWALLVTLIAVSMTASYSTR 425


>MNHA2_STAHJ RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  138 bits (348), Expect = 1e-34
 Identities = 103/375 (27%), Positives = 155/375 (41%), Gaps = 23/375 (6%)

Query: 18  LAVLP--LSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMA 75
           LA +P  L G   E  + W      ++ +    D LG     +++ I + V  Y+  Y++
Sbjct: 46  LAQIPNVLHGKFVEFKIPWMPA--IDVNLDFRLDGLGLMFGLIISIIGVAVFFYATQYLS 103

Query: 76  -DEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAA 134
            +     R                        ++ WE   ++SF+LI   +  A+++  A
Sbjct: 104 VNRDNLPRXXXXXXXXXXXXXGIVVSNNTILMYVFWELTSVSSFLLISYWYSNAESQLGA 163

Query: 135 FKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIG 194
            ++ ++T                ITGT  +     Q                        
Sbjct: 164 IQSFIITVLGGLALLTGFIMLYIITGTNTISELLTQSHSISEHALFIPMMIMLLIGAFT- 222

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ P   WLP+AMAAPTPVSA +HSATM  AG+FL+ +  P+   +   + +V +VG 
Sbjct: 223 KSAQFPFHIWLPKAMAAPTPVSAYLHSATMVKAGIFLLFKFTPILGLSDSYIYIVTFVGL 282

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXXXXXXXXXXXX 297
            T +  ++ A  QYDLK +LA+ST+SQ                                 
Sbjct: 283 ITMIFGSVTALRQYDLKGILAYSTISQLGMIMSMVGLGGGIAQHSSGPMAETYTLILFAG 342

Query: 298 XFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLL 357
            FHL  HA FK ALF+ VG ++   GTRD+R+L G+ K  P                PLL
Sbjct: 343 LFHLMNHAIFKCALFMGVGIIDHEAGTRDIRRLSGMRKFFPKMNLVMTLAALSMAGVPLL 402

Query: 358 SGYWSEEELLRQAVS 372
           +G+ S+E      VS
Sbjct: 403 NGFLSKEMFFDSLVS 417


>NU5C_JASNU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 745

 Score =  136 bits (342), Expect = 5e-34
 Identities = 104/375 (27%), Positives = 154/375 (41%), Gaps = 16/375 (4%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F        D L   M+ L+  + + V VYS  YMA + G  R          
Sbjct: 74  SWTINNDFSFEFGYLIDPLTSIMSMLITTVGIMVLVYSDNYMAHDQGYLRXXXXXXXXXX 133

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
                         +I WE VG+ S++LIG    +  A  A  KA +  R          
Sbjct: 134 XXLGLVTSSNLIQIYIFWELVGMCSYLLIGFWFTRPLAANACQKAFVTNRVGDFCLLLGI 193

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX----IGKSAQLPLTAWLPEA 208
                ITG+ +   FF+ +++                       + KSAQ PL  WLP+A
Sbjct: 194 LGFYWITGSFEFRDFFEILKNLIYNNEVNSSFLTLCASLLFTGAVAKSAQFPLHVWLPDA 253

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           M  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +                 Q 
Sbjct: 254 MEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPYIMNFISXXXXXXXXXXXXXXXXQK 313

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGT---- 324
           D+KR LA+ST+SQ                 FHL  HA  K+ LFL  G++  +  T    
Sbjct: 314 DIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITHAYSKALLFLGSGSIIHSMETLVGY 373

Query: 325 -----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGV 379
                +++  +GGL K +P +              P L+ +WS++E+L  +        +
Sbjct: 374 SPDKSQNMVLMGGLRKHIPSSQISFLLGTLSLCGIPPLACFWSKDEILNDSGFYSP---I 430

Query: 380 FMLVLILLAGIYIGR 394
           F +++   AG+ + R
Sbjct: 431 FAIIVWTAAGLTLFR 445


>NU5M_BRALA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 598

 Score =  135 bits (341), Expect = 6e-34
 Identities = 90/332 (27%), Positives = 144/332 (43%), Gaps = 8/332 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +G + L +S   D        +  ++   + ++S  YM+ +     F  +L  F+  
Sbjct: 61  WVKLGGYSLMISFRFDLYTCCFFVVGLYVTWNILMFSFYYMSTDPRIDLFCKYLGLFLIA 120

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M             I WEGVG+ S++LI   + ++ A  AA +A+   R           
Sbjct: 121 MLLLVSAESLFQLLIGWEGVGIMSYLLISWWYARSDANTAALQAIFYNRVGDIGLLIMLM 180

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                 G       +                         GKSAQL L  WLP AM  PT
Sbjct: 181 WSLVTLGDWSFTGLYA-------LDFVNTFFLLGVVLAAAGKSAQLGLHPWLPAAMEGPT 233

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVS+L+HS+TM  AGVFL++R  P+  +      +V ++G  T L +A+ A AQ D+K++
Sbjct: 234 PVSSLLHSSTMVVAGVFLLIRFSPIILNHKEIQLMVFFLGTMTTLFSAICALAQNDMKKV 293

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                  H+ +HA FK+ LF+  G+ +      +D+R++GG
Sbjct: 294 VAFSTASQLGLMVTAVGAGAPQLAFLHICMHAFFKAMLFMCSGSFIHGLQNEQDVRKMGG 353

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEE 364
           L    P T              P L+G++S++
Sbjct: 354 LYSAAPITSVCFFIGSAALMGVPFLAGFFSKD 385


>NU5C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 740

 Score =  135 bits (339), Expect = 1e-33
 Identities = 129/345 (37%), Positives = 169/345 (48%), Gaps = 13/345 (3%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA++ FF   M            +  WE VG+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMGFFNTSMLGLVTSSNLIQIYFFWELVGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               +TG+ +                         
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWVTGSFEFQDXXXXXXXXXXXXXXXXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   I KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF     
Sbjct: 230 XXXXXMGPIAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFXXXXX 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
                                AQ D+KR LA+ST+SQ                 FHL  H
Sbjct: 290 XXXXXXXXXXXXXXXXXXXXXAQKDIKRGLAYSTMSQLGYMMLALGMGSYRSALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEAIVGYSPDKSQNMILMGGLTKHVPITKTAFLLGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATF 400
            L+ +WS++E+L  ++     + +       L   Y+ R  + TF
Sbjct: 410 PLACFWSKDEILTDSLLFSPIFAIIACSTAGLTAFYMFRIYLLTF 454


>NU5M_DANRE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 606

 Score =  134 bits (338), Expect = 1e-33
 Identities = 94/354 (26%), Positives = 144/354 (40%), Gaps = 7/354 (1%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W     F + +S   D       ++  +I   +  ++  YMA                 
Sbjct: 67  SWMNTQAFNVDLSFKFDYYSVTFTSIALFITWSILEFASWYMASYPQXXXXXXXXXXXXM 126

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            FI WEGVG+ SF+LIG   G+ +A  A+ +A++  R          
Sbjct: 127 SMIILVTANNLFQLFIGWEGVGIMSFLLIGWWFGRTEANTASLQAVIYNRMGDIGFILTL 186

Query: 153 XXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAP 212
                   +  +   F   +D                    GKSAQ  L  WLP AM  P
Sbjct: 187 AWMAMYLNSWDIQQIFILSKDFDMTIPQIGLIIAAT-----GKSAQFTLHPWLPSAMEGP 241

Query: 213 TPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKR 272
           TPVSAL+HS+TM  AG+FL++RL P+ E   LA  +                  Q D+K+
Sbjct: 242 TPVSALLHSSTMVVAGIFLLIRLHPIMETNKLAPTIXXXXXXXXXXXXXXXXXXQNDIKK 301

Query: 273 LLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLG 331
           ++A+ST SQ                 FH+  HA FK+ LFL  GA +      +D+R++G
Sbjct: 302 IVAFSTSSQLGLMMVAIGLNQPHLAFFHICTHAFFKAMLFLCSGAIIHSLNNEQDIRKMG 361

Query: 332 GLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH-TAWGVFMLVL 384
           G    LP T              P L+G++S++ +L    + H  AW + + ++
Sbjct: 362 GTYHTLPMTTNYLTIGKMALMGTPFLAGFFSKDAILEAMTTSHLNAWALTLTLI 415


>NU5M_PELSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 605

 Score =  134 bits (337), Expect = 2e-33
 Identities = 95/353 (26%), Positives = 154/353 (43%), Gaps = 9/353 (2%)

Query: 42  LTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXX 101
           L +S+  D       ++  +I   +  Y+  YMA +   ++                   
Sbjct: 77  LAMSIKIDYYSLIFISIALFITRAILQYTKWYMASDRDLKKXXXXXXXXXXXXXXXXAAN 136

Query: 102 XXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGT 161
                 + W  +GL S++LI   HG+ +A  +  +A+L  R                  +
Sbjct: 137 NFFPMLVGWGTMGLMSYLLISWWHGRTEATTSGLQAILYNRLADIGFILTFSWCITYMSS 196

Query: 162 TQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHS 221
             L  FF                        +GKSAQ  +  WLP AM  PTPVSAL+HS
Sbjct: 197 LDLNTFFAT------STLVTGVPILGMLMAAMGKSAQFGMHPWLPAAMEGPTPVSALLHS 250

Query: 222 ATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           +TM  AGV+L++ + P+           L +GA TAL A+  A  Q DLK+++A+ST+SQ
Sbjct: 251 STMVTAGVYLLIGMHPILSQTQGFSEACLTMGAATALYASFKALLQNDLKKIIAFSTLSQ 310

Query: 282 XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERAT-GTRDLRQLGGLGKRLPWT 340
                             HL +HA FK+ +FL  G++  A  G +D+R++ G+ K  P T
Sbjct: 311 LGFMMATVGLNHPNLAFMHLCMHAFFKAMMFLCAGSISHALFGEQDIRKMSGMIKVTPIT 370

Query: 341 XXXXXXXXXXXXXXPLLSGYWSEEELLRQAV--SVHTAWGVFMLVLILLAGIY 391
                         P L+G++S++ ++   +   ++  W   +L+  +   IY
Sbjct: 371 ASCFTLSTLALAGFPFLTGFFSKDLIIETILLSKINMLWATMLLISTMFTAIY 423


>NU5M_BRAFL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 599

 Score =  134 bits (337), Expect = 2e-33
 Identities = 92/333 (27%), Positives = 145/333 (43%), Gaps = 9/333 (2%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +G + L +S   D        +  ++   + ++S  YM+ +     F  +L  F+  
Sbjct: 61  WVKLGGYSLMISFRFDLYTCCFFVVGLYVTWNILMFSFYYMSTDPRIDLFCKYLGLFLIA 120

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
           M             I WEGVG+ S++LI   + ++ A  AA +A+   R           
Sbjct: 121 MLLLVSAESLFQLLIGWEGVGIMSYLLISWWYARSDANTAALQAIFYNRVGDIGLLIMLM 180

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                 G       +                         GKSAQL L  WLP AM  PT
Sbjct: 181 WSLVTLGDWSFTGLYA-------LDFVNTFFLLGVVLAAAGKSAQLGLHPWLPAAMEGPT 233

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVS+L+HS+TM  AGVFL++R  P+  +      +V ++G  T L +A+ A AQ D+K++
Sbjct: 234 PVSSLLHSSTMVVAGVFLLIRFSPIILNHKEIQLMVFFLGTMTTLFSAICALAQNDMKKV 293

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXF-HLTVHATFKSALFL-SVGALERATGTRDLRQLG 331
           +A+ST SQ                 F H+ +HA FK+ LF+ S G +      +D+R++G
Sbjct: 294 VAFSTASQLGLMVTVVAGAGAPQLAFLHICMHAFFKAMLFMCSGGFIHGLQNEQDVRKMG 353

Query: 332 GLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEE 364
           GL    P T              P L+G++S++
Sbjct: 354 GLHSAAPITSVCFFIGSAALMGVPFLAGFFSKD 386


>MNHA1_STAHJ RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 803

 Score =  132 bits (331), Expect = 9e-33
 Identities = 121/386 (31%), Positives = 173/386 (44%), Gaps = 18/386 (4%)

Query: 13  IFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVP 72
           +FI  L+++  + +   V  T   +    +   L  D L    + L+  I   V +YS+ 
Sbjct: 41  LFIYFLSLISTTQSGNTVIKTLNWMPHIGMNFDLYLDGLSILFSLLITGIGSLVVLYSIG 100

Query: 73  YMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQ 132
           Y++       F+ +L  F+G M            ++ WE               +  +  
Sbjct: 101 YLSKSEQLGNFYCYLLLFMGAMLGVVLSDNLIILYLFWEXXXXXXXXXXXXWREKKASIY 160

Query: 133 AAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX 192
            A K+L++T                   +  L        +                   
Sbjct: 161 GAQKSLIITVXXXXXXXXXXXXXXXAGDSLSLHELIANASEIQHSPLFIFAMVLIMLGAF 220

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
             KSAQ+P   WLP+AM APTPVSA +HSATM  AG++LV R+ PLF  +   +  +  V
Sbjct: 221 T-KSAQVPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLVARVTPLFAISQGWIWTITLV 279

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXXXXXX 296
           G  T   A+L AT Q DLK +LA+STVSQ                               
Sbjct: 280 GLITLFWASLNATKQQDLKGILAFSTVSQLGMIMSMLGIGAVSYHFEGSQSQLYIAGFTA 339

Query: 297 XXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPL 356
             FHL  HATFK ALF+  GA++  TGTRD+++LGGL   +P +              P 
Sbjct: 340 AVFHLVNHATFKGALFMITGAVDHVTGTRDVKKLGGLLTIMPISFTITVITALSMAGIPP 399

Query: 357 LSGYWSEEELLRQAVSVHTAWGVFML 382
            +G+ S+E+ L   + +  A  VF L
Sbjct: 400 FNGFLSKEKFLEAMIEISHA-NVFSL 424


>NU5M_PICCA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;
          Length = 644

 Score =  131 bits (330), Expect = 1e-32
 Identities = 115/339 (33%), Positives = 166/339 (48%), Gaps = 8/339 (2%)

Query: 73  YMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQ 132
           YM D++   RF+ +L+ F   M            F+ WE +G+ASF+LIG  +      +
Sbjct: 102 YMKDDSHNPRFYTYLALFTLFMIILVLGDNYLILFLGWEYIGIASFLLIGFWYNNIDNIK 161

Query: 133 AAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXX 192
           ++  AL + +                         F  V                     
Sbjct: 162 SSLNALFINKIGDXXXXXXXXXXXXXXXXXXXXXXFSLVS--YXXXXXXXXXXLCLVIAA 219

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
             KSAQ  L  WL  AMA PTPVS L+H+AT+  AG++L++R  P+ E+ P  L   LW+
Sbjct: 220 SAKSAQFGLHNWLIWAMAGPTPVSVLLHAATLVIAGIYLLMRSSPILENCPNILLFNLWL 279

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALF 312
           GA T+LI+ L+A    D+KR++A ST+SQ                 +H+  H+ +K+ LF
Sbjct: 280 GAITSLISGLIAINSNDIKRIIALSTMSQLGIMFISIGLSSYNLTLYHVLCHSLYKALLF 339

Query: 313 LSVGALERATGT--RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQA 370
           +  G +  +     +D+R +GGL   +P T              P L+GY+         
Sbjct: 340 ICAGTIIHSLNNELQDIRFMGGLLIYMPITYICMLIGSLSLMGLPSLTGYYXXXXXXXXX 399

Query: 371 VSVHTAWGVFMLVLI----LLAGIYIGRAAMATFGLAPQ 405
                  G+ +  L+    LL  IYI +    +F   PQ
Sbjct: 400 XXXXXXXGLIIYWLVVLSSLLTNIYILKLIYYSFINIPQ 438


>NU5C_PHAVU RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 750

 Score =  131 bits (329), Expect = 2e-32
 Identities = 110/315 (34%), Positives = 157/315 (49%), Gaps = 13/315 (4%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS  YM+ + G  RFFA+++ F   M            +  WE +G+ S++LIG    + 
Sbjct: 110 YSDNYMSHDQGYLRFFAYMTLFNISMLGLVTSSNLIQIYFFWELIGMCSYLLIGFWFTRP 169

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            A  A  KA +  R               ITG+ +    FQ + +               
Sbjct: 170 IAANACQKAFVTNRVGDFXXXXXXXXXYWITGSLEFRDLFQIINNLISKNEMNXXXXXXX 229

Query: 189 XXXX----IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                   + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+               
Sbjct: 230 XXXXXCGSVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIXXXXXXXXXXXXXXQ 289

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVH 304
            +  + ++G  T ++ A +A AQ D+K+ LA+ST+SQ                 FHL  H
Sbjct: 290 IMNTIAFIGLITVILGATLAIAQKDIKKNLAYSTMSQLGYMMLALGMGSYRGALFHLITH 349

Query: 305 ATFKSALFLSVG----ALERATG-----TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXP 355
           A  K+ LFL  G    ++E   G     ++++  +GGL K +P T              P
Sbjct: 350 AYSKALLFLGSGSIIHSMEALVGYSPAKSQNMVFMGGLTKHVPITKFFFLVGTLSLCGIP 409

Query: 356 LLSGYWSEEELLRQA 370
             + +WS++E+L  +
Sbjct: 410 PFACFWSKDEILNDS 424


>MNHA2_STAAR RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  131 bits (329), Expect = 2e-32
 Identities = 101/394 (25%), Positives = 158/394 (40%), Gaps = 26/394 (6%)

Query: 30  VALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGR-QRFFAWLS 88
           V++ W T    ++ V L  D                V  Y+  Y++       RF+ +L+
Sbjct: 60  VSIPWMT--SLDINVDLRLDGXXXXXXXXXXXXXXAVFFYATQYLSSRKDNLPRFYLYLT 117

Query: 89  FFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXX 148
            F+  M            ++ WE   ++SF+LI   +    ++  A ++ ++T       
Sbjct: 118 LFMFSMLGIVLADNTILMYVFWELTSVSSFLLISYWYNNGDSQFGAMQSFMITVFGGLAL 177

Query: 149 XXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA 208
                    +TGT  +     Q  D                     KSAQ P   WLP A
Sbjct: 178 LVGFIMLYIMTGTNNITEILGQA-DHIKNHALFIPMIIMFLLGAFTKSAQFPFHIWLPRA 236

Query: 209 MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQY 268
           MAAPTPVSA +HSATM  AG+F           + + + +V +VG  T L  ++ A  Q+
Sbjct: 237 MAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNMYIYIVTFVGLITMLFGSITALKQW 296

Query: 269 DLKRLLAWSTVSQ-----------------XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
           DLK +LA+ST+SQ                                  FHL  HA FK AL
Sbjct: 297 DLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIASIYVFVLFAALFHLMNHAIFKCAL 356

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F+ VG L+   G+RD+R L G+ +  P                P L+G+ S+E  L    
Sbjct: 357 FMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMMIAALSMAGVPFLNGFLSKEMFLDALT 416

Query: 372 SVH--TAWGVFMLVLILLAGIYIGRAAMATFGLA 403
                + + +  +++I+  G+    A++ TF  A
Sbjct: 417 QTGQLSQFSLISMIIIVCMGVI---ASIFTFTYA 447


>NU5M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 637

 Score =  130 bits (328), Expect = 2e-32
 Identities = 121/361 (33%), Positives = 176/361 (48%), Gaps = 7/361 (1%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W +  P  ++++   D+      ++   +   +  +S  YM ++     FF         
Sbjct: 100 WLSNTPLNISLNFIYDQYFLVFLSVALIVTWSIMEFSFYYMTEDPNSSAFFRXXXXXXXX 159

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXX 153
                        F+ WEG G  SF+LI     +  A  +A +A++  R           
Sbjct: 160 XXXXXCSNSLFLIFLGWEGGGFLSFLLISWWTTRNDASSSALEAVITNRIGNIGLITFMA 219

Query: 154 XXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPT 213
                                                    KSAQ  L  WLP  +  PT
Sbjct: 220 LS---AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSAQFGLHPWLPALLEGPT 276

Query: 214 PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRL 273
           PVSAL+HS+TM  AGVFL++R   LF    +  ++VL +G  TAL AA  A AQ+D+K++
Sbjct: 277 PVSALLHSSTMVVAGVFLLVRTSELFSSPLITHSLVLILGGTTALFAASTAIAQHDIKKI 336

Query: 274 LAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGG 332
           +A+ST SQ                 FH+  HA FK+ LFL  G+ +   +  +DLR++GG
Sbjct: 337 IAYSTTSQLGLMVTAIGIGQPALAFFHICTHAFFKAMLFLCSGSVIHSLSDEQDLRKMGG 396

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR-QAVSVHTAWGVFM-LVLILLAGI 390
           L K LP T              PLL+G++S++ +L   + SV    G+ + +V  +L  +
Sbjct: 397 LSKLLPVT-SSCLILGSLALMAPLLAGFYSKDLILEATSASVLNLLGIVLSIVATMLTAV 455

Query: 391 Y 391
           Y
Sbjct: 456 Y 456


>NU5M_YARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 655

 Score =  129 bits (324), Expect = 6e-32
 Identities = 102/304 (33%), Positives = 149/304 (49%), Gaps = 4/304 (1%)

Query: 66  VAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHH 125
           V +YS+ YM  +  + RFF+ LS F   M            F+ WE +G+ S++LI    
Sbjct: 99  VHIYSIGYMETDPHQVRFFSLLSMFTFWMIILVTGSNYFVLFVGWEFIGVTSYLLISFWV 158

Query: 126 GQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXX 185
            + +A ++A  A+LM R               + GT      F                 
Sbjct: 159 TRLQAMKSALSAVLMNRFGDAFFVLGLCVIAYVFGTLNYSTIFATA--YLINTDXXXXXX 216

Query: 186 XXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLA 245
                    KSAQ  L  WL  AM  PTPVS+L+H+AT+  AG++L+LR   + E+ P  
Sbjct: 217 XXXXXXXXXKSAQFGLHNWLTLAMEGPTPVSSLLHAATLVTAGIYLLLRSANILEYTPTV 276

Query: 246 LAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHA 305
           L ++LW+GA T L A L+A    DLKR++A ST+SQ                        
Sbjct: 277 LFIILWIGALTTLSAGLIAICSNDLKRIIALSTMSQLGMMTIAIGLSAYNXXXXXXXXXX 336

Query: 306 TFKSALFLSVGALERA--TGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
                  +S G++  +    ++D+R  GGL   LP+T              P L+GY+++
Sbjct: 337 XXXXXXXMSAGSIIHSILNESQDIRTYGGLLSYLPYTYICITIASLSLMAMPGLTGYYTK 396

Query: 364 EELL 367
           + ++
Sbjct: 397 DIII 400


>MNHA2_STAAN RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  128 bits (321), Expect = 1e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YIYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASIFTFTYA 447


>MNHA2_STAAM RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  128 bits (321), Expect = 1e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YIYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASIFTFTYA 447


>MNHA2_STAA9 RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  128 bits (321), Expect = 1e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YIYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASIFTFTYA 447


>MNHA2_STAA2 RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  128 bits (321), Expect = 1e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YIYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASIFTFTYA 447


>MNHA2_STAA1 RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  128 bits (321), Expect = 1e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YIYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASIFTFTYA 447


>MNHA2_STAAW RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAMQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAAU RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAAT RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAAS RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAMQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAAE RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAAC RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAA8 RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA2_STAA3 RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  127 bits (320), Expect = 2e-31
 Identities = 99/357 (27%), Positives = 151/357 (42%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +    ++  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDSQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITEILGQA-DHIKNHGLFIPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YVYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L G+ +  P         
Sbjct: 333 SIYVFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSGMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (312), Expect = 1e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWIWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASKA 419


>MNHA1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;AltName: Full=Mrp complex
           subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>MNHA1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  124 bits (311), Expect = 2e-30
 Identities = 104/324 (32%), Positives = 145/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y++       F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLSKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWVWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>NUOL_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit L;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit L;AltName: Full=NDH-1 subunit L;
          Length = 615

 Score =  124 bits (310), Expect = 3e-30
 Identities = 114/393 (29%), Positives = 160/393 (40%), Gaps = 20/393 (5%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           +W ++   ++  SL  D L   M  +         ++S  YM D+ G  RFFA+ + F+ 
Sbjct: 66  SWISINELDIDCSLILDGLSLSMLAMXXXXXXXXHIFSTWYMKDKEGYSRFFAYTNLFIA 125

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXX 152
            M            ++ WE V + S++LIG ++        A KA + TR          
Sbjct: 126 SMSLLVLADNFLFMYLGWEIVSICSYLLIGFYYKTTNNTSCALKAFVFTRISDVFLIISM 185

Query: 153 XXXXXITGTTQLPPF-----FQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPE 207
                  GT           F  VED                   +GKSAQLPL  WL +
Sbjct: 186 FLIYNKYGTFNFQEIKFLSNFLNVEDCFDXXXXXXXXXXGV----MGKSAQLPLHTWLSD 241

Query: 208 AMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQ 267
           AM  PTPVSALIH+ATM  AGV+L+ R   LF   P                       Q
Sbjct: 242 AMVGPTPVSALIHAATMVTAGVYLIARTHFLFLLTPKXXXXXXXXXXXXXXXXXXXXXVQ 301

Query: 268 YDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS-ALFLSVGALERATGTRD 326
            D+KR+LA+ST+SQ                  HL VHA FK+                ++
Sbjct: 302 QDIKRILAYSTMSQIGYMFLALGVKAWTAAIVHLIVHAIFKAXXXXXXXXXXXXCNNEKN 361

Query: 327 LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLL-SGYWSEEELLRQAVSVHTAWGVFMLVLI 385
           +  L  +  + P                PL+ SG++S+  +L   +      G F L LI
Sbjct: 362 IFNLSKVSSKCPLLYVSFLVGGASLVSFPLITSGFYSKGNILFSVLKD----GYFNLFLI 417

Query: 386 -----LLAGIYIGRAAMATFGLAPQAVMPANRR 413
                 L  IY  R     F  +  + + +N+R
Sbjct: 418 GLFCSFLTSIYTFRMIFVIFHRSSVSFVFSNKR 450


>MNHA2_STAAB RecName: Full=Putative antiporter subunit
           mnhA2;AltName: Full=Mrp complex subunit A2;
          Length = 800

 Score =  124 bits (310), Expect = 3e-30
 Identities = 98/357 (27%), Positives = 149/357 (41%), Gaps = 22/357 (6%)

Query: 66  VAVYSVPYMADEAGR-QRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQH 124
           V  Y+  Y++       RF+ +L+ F+  M            +I WE   ++SF+LI   
Sbjct: 94  VFFYATQYLSSRKDNLPRFYFYLTLFMFSMIGIVLSDNTILMYIFWELTSVSSFLLISYW 153

Query: 125 HGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXX 184
           +     +  A ++ ++T                +TGT  +     Q  D           
Sbjct: 154 YNNGDNQFGAIQSFMITVFGGLALLVGFIMLYIMTGTNNITDILGQA-DHIKNHGLFMPM 212

Query: 185 XXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL 244
                     KSAQ P   WLP AMAAPTPVSA +HSATM  AG+F           + +
Sbjct: 213 IFMFLLGAFTKSAQFPFHIWLPRAMAAPTPVSAYLHSATMVKAGIFXXXXXXXXXXXSNM 272

Query: 245 ALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ-----------------XXXXXX 287
            + +V +VG  T L  ++ A  Q+DLK +LA+ST+SQ                       
Sbjct: 273 YIYIVTFVGLITMLFGSITALKQWDLKGILAYSTISQLXXXXXXXXXXXXYAQHQQDAIA 332

Query: 288 XXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXX 347
                      FHL  HA FK ALF+ VG L+   G+RD+R L  + +  P         
Sbjct: 333 SIYTFVLFGALFHLMNHAIFKCALFMGVGILDHEAGSRDIRILSEMRQLFPKMNLVMTIA 392

Query: 348 XXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIG-RAAMATFGLA 403
                  P L+G+ S+E  L  A++       F L+  ++A +++G  A++ TF  A
Sbjct: 393 ALSMAGVPFLNGFLSKEMFL-DALTQTGQLSQFSLI-SMIAIVFVGVIASVFTFTYA 447


>MNHA1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit A1;AltName:
           Full=Mnh complex subunit A1;
          Length = 801

 Score =  123 bits (309), Expect = 3e-30
 Identities = 104/324 (32%), Positives = 144/324 (44%), Gaps = 17/324 (5%)

Query: 69  YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
           YS+ Y+        F+ +L  F+G M            ++ WE               + 
Sbjct: 97  YSIGYLNKSEQLGNFYCYLLLFMGAMLGVVLSDNVIILYLFWEXXXXXXXXXXXXWRERQ 156

Query: 129 KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +   A K+L++T                 T +  +    Q   +               
Sbjct: 157 ASIYGAQKSLIITVFXXXXXXXXXXXXAIPTQSFSIQYMIQHASEIQNSPFFIFAMILIM 216

Query: 189 XXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV 248
                 KSAQ P   WLP+AM APTPVSA +HSATM  AG++L+ R+ P+F  +   +  
Sbjct: 217 IGAFT-KSAQFPFYIWLPDAMEAPTPVSAYLHSATMVKAGLYLIARMTPIFAASQGWIWT 275

Query: 249 VLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ----------------XXXXXXXXXXX 292
           V  VG  T   A+L AT Q DLK +LA+STVSQ                           
Sbjct: 276 VTLVGLITLFWASLNATKQQDLKGILAFSTVSQLGMIMAMLGIGAISYHYQGDDSKIYAA 335

Query: 293 XXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXX 352
                 FHL  HATFK ALF+  GA++ +TGTRD+++LGGL   +P +            
Sbjct: 336 AFTAAIFHLINHATFKGALFMITGAVDHSTGTRDVKKLGGLLTIMPISFTITVITALSMA 395

Query: 353 XXPLLSGYWSEEELLRQAVSVHTA 376
             P  +G+ S+E  L    +   A
Sbjct: 396 GVPPFNGFLSKESFLETTFTASQA 419


>NU5M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 574

 Score =  122 bits (307), Expect = 6e-30
 Identities = 85/195 (43%), Positives = 125/195 (64%), Gaps = 3/195 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGVFL++R +            +L+V  
Sbjct: 193 KSAQMPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFYNFLSSVWWFTTFLLFVAV 252

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T L+A L A+++ D+K+++A ST+SQ                 FH+  HA FK+ LF+ 
Sbjct: 253 STTLMAGLSASSECDMKKIIALSTLSQXXXXXXXXXXXXXXXXFFHMVTHAMFKALLFVC 312

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
            G+ +     ++DLR +G L K++P T              P +SG++S++ ++    S+
Sbjct: 313 AGSFIHSHMHSQDLRWMGNLTKQMPTTTSCLIMANLALCGFPFMSGFYSKDMIVE--ASL 370

Query: 374 HTAWGVFMLVLILLA 388
           +      M+ LIL A
Sbjct: 371 YYPHNSLMINLILFA 385


>NU5M_CANAL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 552

 Score =  122 bits (306), Expect = 7e-30
 Identities = 69/212 (32%), Positives = 112/212 (52%), Gaps = 6/212 (2%)

Query: 201 LTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIA 260
           L AWL +AM  PTPVSAL+H+ATM  AGV++++R + + E+ P  L ++ W+G  T L++
Sbjct: 184 LHAWLLQAMEGPTPVSALLHAATMVCAGVYVLVRSYMILEYTPTMLLIICWLGGLTTLVS 243

Query: 261 ALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALER 320
            L+A    D+KR++A ST+SQ                 +HL  HA FK+ LF+  G++  
Sbjct: 244 GLIAIVTNDIKRVIALSTMSQLSIMVLAIGISAYDLAIYHLYCHAFFKALLFMGAGSVIH 303

Query: 321 A--TGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWG 378
           +    ++D+R+ GGL + LP++              P L+GY+S++ ++      +T  G
Sbjct: 304 SFVAESQDMRKYGGLIEYLPFSYTAILIASLSLMAIPGLTGYYSKDIIIESLYGSYTLSG 363

Query: 379 VFMLVLIL----LAGIYIGRAAMATFGLAPQA 406
             +  + +    L  IY  R    TF   P A
Sbjct: 364 YILYYIAVGSATLTSIYSLRVLYLTFMGVPNA 395



 Score = 60.5 bits (145), Expect = 3e-11
 Identities = 34/110 (30%), Positives = 52/110 (47%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVG 92
           TW ++G   +   L+ D L   +   V  I L V  Y++ YM+ +  R RF+  LS F  
Sbjct: 18  TWISLGDIVIPFGLSLDSLAMTVIVPVGIITLCVLAYAIEYMSHDPNRNRFYIILSIFAV 77

Query: 93  MMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTR 142
            M            FI WE VG+ S++LI     +  A ++A  A+L+ R
Sbjct: 78  FMTILVVSDNYLMMFIGWEFVGVISYLLISFWSTRITAMKSALSAILLNR 127


>NU5M_CANPA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 555

 Score =  119 bits (297), Expect = 8e-29
 Identities = 67/206 (32%), Positives = 110/206 (53%), Gaps = 6/206 (2%)

Query: 201 LTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIA 260
           L AWL +AM  PTPVSAL+H+ATM  AGV++++R + + E+AP  L  + W+G  T L++
Sbjct: 185 LHAWLLQAMEGPTPVSALLHAATMVCAGVYVLVRSYFILEYAPSLLIGICWLGGVTTLVS 244

Query: 261 ALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALER 320
            L+A    D+K+++A ST+SQ                 +HL  HA FK+ LF+  G++  
Sbjct: 245 GLIAIVTNDIKKVIALSTMSQLSIMVLAIGISSYDLAIYHLYCHAFFKALLFMGAGSVIH 304

Query: 321 A--TGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWG 378
           +  + T+D+R+ GGL   LP++              P L+GY+S++ ++      +T  G
Sbjct: 305 SYISETQDMRKYGGLVNYLPFSYTAILIASLSLMAIPGLTGYYSKDIIIESLYGTYTFSG 364

Query: 379 VFMLVLIL----LAGIYIGRAAMATF 400
             +  + +    L  +Y  R    TF
Sbjct: 365 YILYYMAVGSATLTSLYSIRVLYLTF 390



 Score = 56.2 bits (134), Expect = 7e-10
 Identities = 32/109 (29%), Positives = 50/109 (45%)

Query: 34  WFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGM 93
           W  +G   +   L+ D L   +   V  + L V +Y++ YM+ +  R  F+  LS F   
Sbjct: 20  WLNIGDIIIPYGLSLDSLAMTVMIPVGIVTLCVLLYAIEYMSHDPNRNTFYIILSVFAIF 79

Query: 94  MXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTR 142
           M            FI WE VG+ S++LI     +  A +AA  A+L+ R
Sbjct: 80  MTILVVSDNYIMMFIGWEFVGVISYLLISFWSTRIAAMKAALSAILLNR 128


>NU5M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 643

 Score =  119 bits (297), Expect = 8e-29
 Identities = 100/262 (38%), Positives = 136/262 (51%), Gaps = 5/262 (1%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP 166
           FI WEGVG  SF+LI     +A A  +A +A++  R                  T  LP 
Sbjct: 167 FIGWEGVGFLSFLLISWWTSRANANNSAIQAVIYNRVGDIGXXXXXXXXXXXXNTWSLPE 226

Query: 167 FFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAA 226
            F                          KSAQ  L  WLP AM  PTPV ++ HS+TM  
Sbjct: 227 IFS----ISAPNTFNNXXXXXXXXXXXXKSAQFGLHPWLPAAMEGPTPVFSIRHSSTMVV 282

Query: 227 AGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXX 286
           AG+FL++RL PL+  +       L +G+           +Q+D+K+++A+ST SQ     
Sbjct: 283 AGIFLLIRLSPLYACSSNFNTWCLILGSXXXXXXXXXXXSQHDIKKIVAYSTTSQLGLMM 342

Query: 287 XXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATGTRDLRQLGGLGKRLPWTXXXXX 345
                       FH+  HA FK+ LFLS G+ +      +D+R++GGL   LP T     
Sbjct: 343 VAIGLNQPSIALFHICTHAFFKAMLFLSSGSIIHSLNDEQDIRKMGGLHFILPNTAACII 402

Query: 346 XXXXXXXXXPLLSGYWSEEELL 367
                    P L G++S++ +L
Sbjct: 403 LGSLALSGIPFLPGFYSKDLIL 424


>HYFD_ECOLI RecName: Full=Hydrogenase-4 component D;       
           EC=1.-.-.-;
          Length = 479

 Score =  115 bits (288), Expect = 9e-28
 Identities = 116/371 (31%), Positives = 160/371 (43%), Gaps = 21/371 (5%)

Query: 30  VALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEA------GRQRF 83
           V LT   VG   L   L  DR+                 YS  Y+ D+       G  R+
Sbjct: 57  VTLTLVNVGDVAL-FGLVIDRVSXXXXXXXXXXXXXXXXYSTGYLTDKNREHPHNGTNRY 115

Query: 84  FAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRX 143
           +A+L  F+G M               +E  G  S+ LI  +    KA+++A KALL+T  
Sbjct: 116 YAFLLVFIGAMAXXXXXXXXXXXXXFFEITGGCSWALISYYQSD-KAQRSALKALLITHI 174

Query: 144 XXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTA 203
                          TGT  L    +   D                    GKSAQLP+ A
Sbjct: 175 GSLGLYLAAATLFLQTGTFALSAMSELHGDARYLVYGGILFAAW------GKSAQLPMQA 228

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAF-TALIAAL 262
           WLP+AM APTP+SA +H+A+M   GV++  R      + P  +  V  V A  T L   L
Sbjct: 229 WLPDAMEAPTPISAYLHAASMVKVGVYIFARAIIDGGNIPHVIGGVGMVMALVTILYGFL 288

Query: 263 VATAQYDLKRLLAWSTVSQ------XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG 316
           +   Q D+KRLLAWST++Q                        ++  HA  KS  FL  G
Sbjct: 289 MYLPQQDMKRLLAWSTITQLGWMFFGLSLSIFGSRLALEGSIAYIVNHAFAKSLFFLVAG 348

Query: 317 ALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTA 376
           AL  + GTR L +L G+   LP                P  +G++S+  L     ++   
Sbjct: 349 ALSYSCGTRLLPRLRGVLHTLPLPGVGFCVAALAITGVPPFNGFFSKFPLFAAGFALSVE 408

Query: 377 WGVFMLVLILL 387
           + + +  +ILL
Sbjct: 409 YWILLPAMILL 419


>NU5M_ALBCO RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 545

 Score =  114 bits (284), Expect = 3e-27
 Identities = 109/358 (30%), Positives = 163/358 (45%), Gaps = 17/358 (4%)

Query: 20  VLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAG 79
           VL +  +   +    F+       ++L  D++      +V  I+  V +++  YM+++  
Sbjct: 16  VLNMQNSSYLLMFNLFSTQSVNFNLALICDKVSTSFLVVVLLISSCVFLFANEYMSEDHY 75

Query: 80  RQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALL 139
             RF   L  FV  M                      SF LI  ++    A  +AF  L 
Sbjct: 76  NIRFGWILISFVASMGILILSGSIFTXXXXXXXXXXTSFALIA-YYDNYNASSSAFLTL- 133

Query: 140 MTRXXXXXXXXXXXXXXXITG-TTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQ 198
           MT                +TG T   PP+                           KSAQ
Sbjct: 134 MTNRLGDVLIIATFSVILVTGLTVHFPPY-----------TLVWLSSILFTIASFTKSAQ 182

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLAL-AVVLWVGAFTA 257
            P +AWLP AMAAPTPVSAL+HS+T+  AG++L++R F + + AP  + +++  VG+ T 
Sbjct: 183 YPFSAWLPAAMAAPTPVSALVHSSTLVTAGIYLMIRCF-MVDGAPAEMYSLMGLVGSITC 241

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVG- 316
           L+   VA  +YDLK+++A ST+SQ                      HA FK+ LFL  G 
Sbjct: 242 LLGGSVALFEYDLKKVIALSTLSQLGVMMYSXXXXXXXXXXXXXYGHAMFKAMLFLGAGL 301

Query: 317 ALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
            L  + GT+DLR LG L    P                P +S ++S+  +L + + ++
Sbjct: 302 ILMMSYGTQDLRLLGSLLYSSPIVISLLNISMLCLMGFPFVSSFYSKHLILEKMLDMN 359


>NU5M_DROME RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 572

 Score =  111 bits (277), Expect = 2e-26
 Identities = 62/174 (35%), Positives = 93/174 (53%), Gaps = 2/174 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGV+L++R F +                
Sbjct: 191 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIR-FNIIXXXXXXXXXXXXXXX 249

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
               +A L A  ++DLK+++A ST+SQ                 FHL  HA FK+ LF+ 
Sbjct: 250 XXXFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFLKLAMFHLLTHALFKALLFMC 309

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            GA +     ++D+R +GGL   +P T              P L+G++S++ +L
Sbjct: 310 AGAIIHNMNNSQDIRLMGGLSIHMPLTSACFNVSNLALCGMPFLAGFYSKDMIL 363


>NU5M_DROYA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 573

 Score =  110 bits (276), Expect = 2e-26
 Identities = 62/174 (35%), Positives = 93/174 (53%), Gaps = 2/174 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGV+L++R F +                
Sbjct: 191 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIR-FNIVXXXXXXXXXXXXXXX 249

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
               +A L A  ++DLK+++A ST+SQ                 FHL  HA FK+ LF+ 
Sbjct: 250 XXMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFYKLAMFHLLTHALFKALLFMC 309

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            GA +     ++D+R +GGL   +P T              P L+G++S++ +L
Sbjct: 310 AGAIIHNMNNSQDIRLMGGLSIHMPLTSACFNVSNLALCGMPFLAGFYSKDMIL 363


>NU5C_PEA RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase subunit 5;
          Length = 124

 Score =  109 bits (273), Expect = 5e-26
 Identities = 57/121 (47%), Positives = 73/121 (60%)

Query: 193 IGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
           + KSAQ PL  WLP+AM  PTP+SALIH+ATM AAG+FLV RL PLF   P  +  +  +
Sbjct: 2   VAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLLPLFIVIPSIMTGIALI 61

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALF 312
           G  T ++ A +A AQ D+K+ LA+ST+SQ                 FHL  HA  K+ LF
Sbjct: 62  GIITVVLGATLAIAQKDIKKNLAYSTMSQLGYMMLALGMGSYRAALFHLITHAYSKALLF 121

Query: 313 L 313
           L
Sbjct: 122 L 122


>NU5H_NYCOV RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
               EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit 5;
          Length = 1849

 Score =  103 bits (258), Expect = 3e-24
 Identities = 79/325 (24%), Positives = 127/325 (39%), Gaps = 11/325 (3%)

Query: 69   YSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQA 128
            + V YM  EA      A L  F   +             I WE  G  S  LI  ++ + 
Sbjct: 1320 FGVEYMLREAFAYNVLATLVLFSASIICFIVSYSFGLMIIFWEISGTLSLFLIDMYYARI 1379

Query: 129  KARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXX 188
            +  QA  +   + R               +     LP  F  +                 
Sbjct: 1380 RTTQAVTRTFALNRFGDLWMFTASIEIYSLCHNDALPTLFALLPYAQFNLSILGNLIFDF 1439

Query: 189  XXXXI----------GKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPL 238
                +           K AQ  L  WLP+AM APTP SALIHS+T+   G+F++LR  P+
Sbjct: 1440 TIPTVIVFSIFSAAACKCAQFLLFVWLPDAMEAPTPASALIHSSTLVVMGIFMILRFAPI 1499

Query: 239  FEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX 298
               +   L ++  +G+ T    A++AT   DLK+ +A+ST+SQ                 
Sbjct: 1500 LHLSVYTLYIMSILGSLTVAYGAILATQTSDLKKAVAYSTISQIGYLFTGCAFLAFRATL 1559

Query: 299  FHLTVHATFKSALFLSVG-ALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLL 357
             +L +HA  K+ LF+ VG  +    GT  LR++GG+   +P                P  
Sbjct: 1560 IYLILHAICKALLFVLVGYIVHMFGGTTSLRRMGGIYYIVPDIAIYMFILCMVLAGAPYT 1619

Query: 358  SGYWSEEELLRQAVSVHTAWGVFML 382
             G++++E ++    +  +    F++
Sbjct: 1620 VGFFAKELIVTTLTNTSSPVATFII 1644


>NU5M_RHISA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 552

 Score =  101 bits (251), Expect = 2e-23
 Identities = 75/174 (43%), Positives = 107/174 (61%), Gaps = 2/174 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P +AWLP AMAAPTPVSAL+HS+T+  AGV+L++R F L  +  +  A ++ +  
Sbjct: 185 KSAQIPFSAWLPAAMAAPTPVSALVHSSTLVTAGVYLLIR-FDLLFNNNIFSAFLMKISL 243

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T +++ + A  + DLK+++A+                      FHL VHA FKS LFL 
Sbjct: 244 MTMIMSGMNAFFENDLKKIIAFXXXXXXXXXXXXXXXXXXXXXFFHLIVHAIFKSMLFLC 303

Query: 315 VG-ALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            G  +    G +D+R L    K  P                P + G++S++ ++
Sbjct: 304 AGFVIHNLMGNQDIRFLSDFFKFSPLILSCMMIGMFSLMGFPFIGGFYSKDVIM 357


>NU5M_ARTSF RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 541

 Score =  101 bits (251), Expect = 2e-23
 Identities = 102/333 (30%), Positives = 147/333 (44%), Gaps = 15/333 (4%)

Query: 66  VAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHH 125
           V +YS  YM  E    RF   +  F+  M             + W+G+G+ S++LI   +
Sbjct: 61  VMIYSSYYMMGETFVNRFMYMMLGFISSMVLLIMSSDGLSLMLGWDGLGITSYLLI-MFY 119

Query: 126 GQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXX 185
               +  +    +L  R                        F+ +  D            
Sbjct: 120 KNYNSSSSGMITILSNRVGDVLILWSLGLM-----------FYSKSWDYXXXXXXXXXXX 168

Query: 186 XXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLA 245
                    KSAQLP +AWLP AMAA               AG++L++RL P FE +   
Sbjct: 169 XXXXXXXXTKSAQLPFSAWLPAAMAAXXXXXXXXXXXXXXXAGIYLMIRLSPSFEESGCF 228

Query: 246 LAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHA 305
           L VV+  GA T+  + L A  + DLKR++A ST+SQ                        
Sbjct: 229 LLVVM--GALTSFFSGLAAFGENDLKRVIALSTLSQLGVMMFSLGLGLTLFCYXXXXXXX 286

Query: 306 TFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEE 365
                  +  G +  + G +D R++GG+   LP+T              P LSG++S++ 
Sbjct: 287 XXXXXXXMCSGVVIHSLGVQDNRRMGGVSSMLPYTSYIILVCSLSLMGFPYLSGFFSKDL 346

Query: 366 LLRQAVSVHTAW-GVFMLVLILLAGIYIGRAAM 397
           ++  + S+   +  V MLV  LL   Y  R AM
Sbjct: 347 IIESSESLCMLFPSVLMLVSCLLTSTYSSRIAM 379


>NU5M_MYTED RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 568

 Score =  100 bits (249), Expect = 3e-23
 Identities = 99/322 (30%), Positives = 141/322 (43%), Gaps = 12/322 (3%)

Query: 66  VAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHH 125
           VA Y   YMA+E    RF   +  FV  M             I W+G+GL SF+L+  + 
Sbjct: 68  VATYCKWYMAEELYYNRFMGLVWLFVLSMVFMILVPNLLMLLIGWDGLGLTSFLLVAYYQ 127

Query: 126 GQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXX 185
              K+  AA    L  R                 G   L   +  V+             
Sbjct: 128 NN-KSLSAAMLTALTNRIGDVLVLISISIFLSEGGW--LIYSYHPVQ-------MWLNLG 177

Query: 186 XXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLA 245
                  + KSAQ+P  AWLP AMAA               AGV+LVLR F +    P  
Sbjct: 178 FMVVFAGMTKSAQMPFCAWLPAAMAAXXXXXXXXXXXXXXXAGVYLVLRSFYIISSNPYV 237

Query: 246 LAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHA 305
             V++ +  FT ++A   A   +DLK+++A ST                    FHL  HA
Sbjct: 238 TQVLMILSLFTLVLAGSSAVFAFDLKKVIALSTXXXXXXXXXXXXXXXXXVAFFHLVTHA 297

Query: 306 TFKSALFLSVGALERAT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEE 364
            FK+ LFL  G +  +    +D+R L  L + LP +              P +SG++S++
Sbjct: 298 VFKALLFLGAGGVIHSNQSIQDIRGLSSLWQGLPVSMGAMSVAIVSLSGAPFMSGFFSKD 357

Query: 365 ELLR-QAVSVHTAWGVFMLVLI 385
            ++    +     +G ++L L+
Sbjct: 358 LMIELSMMDSSVTYGCYLLELL 379


>NU5M_ASCSU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 547

 Score = 98.2 bits (243), Expect = 1e-22
 Identities = 52/141 (36%), Positives = 81/141 (57%), Gaps = 2/141 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ P + WLP+AM+APTP+S+L+HS+T+  AG+ L++    +  +  + + +++ VG 
Sbjct: 178 KSAQFPFSGWLPKAMSAPTPISSLVHSSTLVTAGLVLIMNFSEMILNKDV-IMIIMVVGV 236

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           FT   +++ A  + DLK+++A ST+SQ                  HL  HA FKS LF+ 
Sbjct: 237 FTMFFSSMAALVEEDLKKVVALSTLSQMGFSMLTVGIGLSFVSFIHLLSHALFKSCLFMQ 296

Query: 315 VGALERAT-GTRDLRQLGGLG 334
           VG L   + G +D R    LG
Sbjct: 297 VGYLIHCSLGQQDGRNYSNLG 317


>NU5M_AEDAE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 580

 Score = 95.5 bits (236), Expect = 1e-21
 Identities = 61/174 (35%), Positives = 94/174 (54%), Gaps = 2/174 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGV+L++R   L +++ L   ++L V  
Sbjct: 197 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNILLDNSKLGQFLLL-VSG 255

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T  +A L A  ++DLK+++A ST+SQ                               + 
Sbjct: 256 LTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSIGYYXXXXXXXXXXXXXXXXXXMC 315

Query: 315 VGALERAT-GTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            G +   T   +D+R +GGL   +P T              P L+G++S++ +L
Sbjct: 316 AGVIIHNTKNAQDIRFMGGLSMSMPLTCSCFNIANLALCGMPFLAGFYSKDLIL 369


>NU5M_LOCMI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 572

 Score = 95.1 bits (235), Expect = 1e-21
 Identities = 107/344 (31%), Positives = 166/344 (48%), Gaps = 10/344 (2%)

Query: 27  DAEVALTW--FTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFF 84
           D  + + W  F++    + ++   D +     + V +I+  V  YS  YM +E    RF 
Sbjct: 27  DYSLFIEWELFSLNSSMVVMTFIIDWMSLVFMSFVMYISSLVIYYSNDYMHNEKNINRFI 86

Query: 85  AWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXX 144
             +  F+  M               W+G+GL S+ L+  ++   K+  A     L  R  
Sbjct: 87  MIVLMFILSMAFXXXXXXXXXXXXGWDGLGLVSYCLV-IYYQNVKSYNAGMLTALSNRIG 145

Query: 145 XXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAW 204
                          G+         + D                      SAQ+P ++W
Sbjct: 146 DVAILISISWMLNF-GSWNXXXXXXFISDSFEXXXXXXXXXXXXXXX----SAQIPFSSW 200

Query: 205 LPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVA 264
           LP AMAAPTPVSAL+HS+T+  AGV+L++R  P+          +L++G  T  ++ L A
Sbjct: 201 LPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNPMLMVYDFGW-YILFIGCLTMFMSGLGA 259

Query: 265 TAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA-LERATG 323
             ++DLK+++A ST+SQ                               +  G+ +     
Sbjct: 260 NFEFDLKKIIALSTLSQLGLMMSILSMGYSDXXXXXXXXXXXXXXXXXMCAGSMIHNLRD 319

Query: 324 TRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
           ++D+R +G +   +P T              P L+G++S++ +L
Sbjct: 320 SQDIRFMGSIIHFMPLTSICFNVSSLCLCGMPFLAGFYSKDLIL 363


>NU5C2_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase subunit 5,
           organellar chromatophore 2;         EC=1.6.5.-;AltName:
           Full=NAD(P)H dehydrogenase subunit 5 2;
          Length = 618

 Score = 94.7 bits (234), Expect = 2e-21
 Identities = 48/146 (32%), Positives = 81/146 (55%), Gaps = 1/146 (0%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           K AQ P+  WL EAM  P P S ++ ++ +   G  ++++L P+  H+ + +AV+L +G 
Sbjct: 241 KCAQFPMHLWLDEAMEGPNPAS-ILRNSVVVTCGAIVLMKLMPILHHSQITIAVLLAIGT 299

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            +AL  +LV+ AQ D+KR L++ST +                    L  HA  K+ L +S
Sbjct: 300 ISALGGSLVSIAQVDIKRTLSYSTTAYLGLVFIAIALEQPALALLTLFAHAIAKALLSMS 359

Query: 315 VGALERATGTRDLRQLGGLGKRLPWT 340
           +G++   +  +D+ +LGGLG R+P T
Sbjct: 360 IGSVIAVSNCQDITELGGLGSRMPAT 385


>NU5M_PARTE RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 570

 Score = 92.8 bits (229), Expect = 6e-21
 Identities = 74/192 (38%), Positives = 103/192 (53%), Gaps = 1/192 (0%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ     WLP++M AP P SALIHSAT+ +AGVFL++R +P+ E +            
Sbjct: 233 KSAQFGFHVWLPDSMEAPVPASALIHSATLVSAGVFLIMRFYPILELSLYFKXXXXXXXX 292

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
                       Q DLK++LA+ST+S                   +L VH  FK+  FL 
Sbjct: 293 XXXXXXXXXXXFQTDLKKILAYSTISHCGFLIFLCSFGNFKLVIVYLFVHGFFKAISFLC 352

Query: 315 VGALER-ATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
           VG L R +   +DLR++G   K LP                P   G++S+  L   +  +
Sbjct: 353 VGNLIRFSKSYQDLRRMGSFFKYLPAEXXXXXXXXXXXXXXPFFFGFYSKTLLFMISDVL 412

Query: 374 HTAWGVFMLVLI 385
           +    +F ++L+
Sbjct: 413 YFRDAIFCMILL 424


>NU5M_PEA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;     
              EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;Flags: Fragment;
          Length = 183

 Score = 90.9 bits (224), Expect = 2e-20
 Identities = 58/175 (33%), Positives = 77/175 (44%), Gaps = 7/175 (4%)

Query: 82  RFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMT 141
           RF  +LS     M            F+ WEGVGLAS++LI     + +A +AA KA+ + 
Sbjct: 6   RFMCYLSILTFFMPMLVTGDNSLQLFLGWEGVGLASYLLIHFWFTRLQADKAATKAMPVN 65

Query: 142 RXXXXXXXXXXXXXXXITGTTQLPPFFQQVE-------DXXXXXXXXXXXXXXXXXXXIG 194
           R               +  T      F +                             +G
Sbjct: 66  RVGDFGLAPGISGRFTLFQTVDFSTIFARASAPRNSWISCNMRLNAITLICILLLIGAVG 125

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVV 249
           KSAQ+    W P+AM  PTPVSALIH+ATM  AGVF++ R  PLFE+ P AL V+
Sbjct: 126 KSAQIGSHTWSPDAMEGPTPVSALIHAATMVTAGVFMIARCSPLFEYPPTALIVI 180


>NU5M_ANOGA RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 580

 Score = 90.9 bits (224), Expect = 2e-20
 Identities = 58/178 (32%), Positives = 94/178 (52%), Gaps = 2/178 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGV+L++R   +  +  +A  ++L V  
Sbjct: 197 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNDVLMNWWMAQFLLL-VSG 255

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T  +A L A  ++DLK+++A ST+SQ                               + 
Sbjct: 256 LTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFYXXXXXXXXXXXXXXXXXXMC 315

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
            G+ +     ++D+R +G L   +P T              P L+G++S++ +L   +
Sbjct: 316 AGSIIHNMKNSQDIRMMGSLSMSMPLTCSCFNVANLALCGMPFLAGFYSKDLILEMVM 373


>NU5M_ANOAR RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;Flags: Fragment;
          Length = 384

 Score = 90.9 bits (224), Expect = 2e-20
 Identities = 58/178 (32%), Positives = 94/178 (52%), Gaps = 2/178 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGV+L++R   +  +  +A  ++L V  
Sbjct: 197 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNDVLMNWWMAQFLLL-VSG 255

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T  +A L A  ++DLK+++A ST+SQ                               + 
Sbjct: 256 LTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFYXXXXXXXXXXXXXXXXXXMC 315

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
            G+ +     ++D+R +G L   +P T              P L+G++S++ +L   +
Sbjct: 316 AGSIIHNMKNSQDIRMMGSLSMSMPLTCSCFNVANLALCGMPFLAGFYSKDLILEMVM 373


>NU5M_ANOQU RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 576

 Score = 87.4 bits (215), Expect = 3e-19
 Identities = 56/174 (32%), Positives = 91/174 (52%), Gaps = 2/174 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AG++L++R   L     +   ++L +  
Sbjct: 193 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGLYLLIRFNILLTDWWMGQFMLL-ISG 251

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T  +A L A  ++DLK+++A ST+SQ                               + 
Sbjct: 252 LTMFMAGLGANFEFDLKKIIALSTLSQLGLMMSILSMGFYXXXXXXXXXXXXXXXXXXMC 311

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            G+ +     ++D+R +G L   +P T              P L+G++S++ +L
Sbjct: 312 AGSIIHNMKNSQDIRMMGSLSMSMPLTCSCFNVANLALCGMPFLAGFYSKDLIL 365


>NU5M_APILI RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 554

 Score = 75.5 bits (184), Expect = 1e-15
 Identities = 49/174 (28%), Positives = 79/174 (45%), Gaps = 3/174 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P + WLP AM A               AG++L++R   L +        ++ + +
Sbjct: 187 KSAQIPFSTWLPMAMMAXXXXXXXXXXXXXXXAGIYLLIRYVNLLDFN--YKNYIMLIAS 244

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            T L A LVA  + DLK+++A+ST+SQ                  HL +HA FKS +F+ 
Sbjct: 245 LTMLFAGLVANFELDLKKVVAYSTLSQLGFMMSMLSIGSTELVFLHLFIHAMFKSLMFMC 304

Query: 315 VGA-LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
           VG+ +      +D+R   G+    P                P L GY+S++ ++
Sbjct: 305 VGSYMHYMYSNQDIRMYYGMYYIYPMKSMILIFSILSLCGFPFLVGYYSKDLII 358


>MRPD_BACPF RecName: Full=Na(+)/H(+) antiporter subunit D;AltName:
           Full=Multiple resistance and pH homeostasis protein
           D;AltName: Full=Mrp complex subunit D;
          Length = 493

 Score = 72.8 bits (177), Expect = 7e-15
 Identities = 53/181 (29%), Positives = 77/181 (42%), Gaps = 5/181 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPL-FEHAP-LALAVVLWV 252
           K    PL  WLP +   P    A +    +   G++ ++R F L F H P     ++L +
Sbjct: 219 KGGLFPLYFWLPRSYFGPPAAIAALFGGLLTKVGIYAIMRTFTLIFNHDPGFTHTLILIL 278

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSA-- 310
              T     L A +Q+D KR+L++  +SQ                               
Sbjct: 279 AGLTMFFGVLGAVSQFDFKRILSYHIISQVGYMVMGLGIYTQLXXXXXXXXXXXXXXXXX 338

Query: 311 -LFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LFL  GA +R TGT DL+++GGL K  PW               P LSG++S+  L+  
Sbjct: 339 XLFLFAGATQRITGTTDLKKMGGLLKTHPWLAWMFFISAISLAGIPPLSGFFSKFALILA 398

Query: 370 A 370
           A
Sbjct: 399 A 399


>NUOM_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 509

 Score = 70.1 bits (170), Expect = 4e-14
 Identities = 47/150 (31%), Positives = 72/150 (48%), Gaps = 5/150 (3%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA-VVLWV 252
           K   +P+ +WLP+A A APT  S  +    +  A   L+    PLF +A    A + +W+
Sbjct: 236 KMPVVPVHSWLPDAHAQAPTAGSVDLAGILLKTAAYGLIRFALPLFPNASAEFAPIAMWL 295

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
           G       AL++ AQ D+KRL+A+S+VS                       +  H    +
Sbjct: 296 GIIGIFYGALLSFAQTDIKRLVAYSSVSHMGFVMIGIYSGSQVALQGVVVQMIAHGLSAA 355

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPW 339
           ALF+  G L     TRD+R++GGL  R+P+
Sbjct: 356 ALFILCGQLYERLHTRDMRKMGGLWSRMPY 385


>Y051_MYCTU RecName: Full=Uncharacterized protein Rv0083/MT0090;
          Length = 640

 Score = 68.9 bits (167), Expect = 1e-13
 Identities = 74/238 (31%), Positives = 105/238 (44%), Gaps = 10/238 (4%)

Query: 44  VSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXX 103
           V +  DRLG +   L   +A PV  Y + Y+  E   +   A +  FV  M         
Sbjct: 45  VHIELDRLGGFFMALTGAVAAPVGCYLIGYVRREHLGRVPMAVVPLFVAAMLLVPAAGSV 104

Query: 104 XXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQ 163
               +AWE + +AS +L+   H + + R A     +MT+                  + +
Sbjct: 105 TTFLLAWELMAIASLILVLSEHARPQVRSAGLWYAVMTQLGFIAIXXXXXXXXXXXXSDR 164

Query: 164 LPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMA-APTPVSALIHSA 222
                   +                      K+  +PL AWLP A   AP+PVSAL+ SA
Sbjct: 165 FAGLGAVCDGVRAAVFMLTLVGFG------SKAGLVPLHAWLPRAHPEAPSPVSALM-SA 217

Query: 223 TMAAAGVFLVLRL-FPLFEHAPLALAVVLW-VGAFTALIAALVATAQYDLKRLLAWST 278
            M   G++ ++R    L    P    + L  VG  +AL   L A+   DLKRLLA+ST
Sbjct: 218 AMVNLGIYGIVRFDLQLLGPGPRWWGLALLAVGGTSALYGVLQASVAADLKRLLAYST 275


>NUOM_RICPR RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 491

 Score = 67.8 bits (164), Expect = 2e-13
 Identities = 45/174 (25%), Positives = 78/174 (44%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV-VLWV 252
           K+  +P   WLP+A + APT  S ++    +   G   +  L PLF +A    A+ V+++
Sbjct: 226 KTPMIPFHTWLPDAHVQAPTTGSVILAGILLKLGGYGFLRVLLPLFPNASQEFAIYVIYL 285

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
                + A+LVA AQ D+K+++A+S+++                     F +  H    S
Sbjct: 286 SVIAIIYASLVALAQKDIKQMIAYSSIAHMGYVTIGIFSFTEIGISGAIFQMLSHGIISS 345

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           +LFL VG L     T+++ + GG+  ++P                P  SG+  E
Sbjct: 346 SLFLIVGTLYERLHTKEIAKYGGVANKMPILATFFMIAMLSSIGLPSTSGFIGE 399


>NU5M_CAEEL RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 527

 Score = 67.0 bits (162), Expect = 4e-13
 Identities = 44/141 (31%), Positives = 66/141 (46%), Gaps = 2/141 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ P ++WLP+AM+A               AG+ L++    L       ++ VL +G 
Sbjct: 177 KSAQFPFSSWLPKAMSAXXXXXXXXXXXXXXXAGLILLMNFNNLVMQKDF-ISFVLIIGL 235

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           FT   ++L +  + DLK+++A ST+SQ                  HL  HA FKS LF+ 
Sbjct: 236 FTMFFSSLASLVEEDLKKVVALSTLSQMGFSMVTLGLGLSFISFIHLVSHALFKSCLFMQ 295

Query: 315 VGALERAT-GTRDLRQLGGLG 334
           VG +   + G +D R     G
Sbjct: 296 VGYIIHCSFGQQDGRNYSNNG 316


>HYFB_ECOLI RecName: Full=Hydrogenase-4 component B;       
           EC=1.-.-.-;
          Length = 672

 Score = 67.0 bits (162), Expect = 4e-13
 Identities = 56/220 (25%), Positives = 87/220 (39%), Gaps = 26/220 (11%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLAL---AVVLWVGA 254
           +PL +WLP            + S  M   G+F +L++   L     L L    +V+ +GA
Sbjct: 225 MPLHSWLPRXXXXXXXXXXXLMSGVMVKIGIFGILKVAMDLLAQTGLPLWWGILVMAIGA 284

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ--------------XXXXXXXXXXXXXXXXXFH 300
            +AL+  L A A+ D+KRLLAWSTV                                 FH
Sbjct: 285 ISALLGVLYALAEQDIKRLLAWSTVENVGIILLAVGVAMVGLSLHDPLLTVVGLLGALFH 344

Query: 301 LTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGY 360
           L  H             +     T D+ ++G L KR+PWT              P L+G+
Sbjct: 345 LLNHXXXXXXXXXXXXXIISRLHTHDMEKMGALAKRMPWTAAACLIGCLAISAIPPLNGF 404

Query: 361 WSE----EELLR----QAVSVHTAWGVFMLVLILLAGIYI 392
            SE    + L      +AV++  A  + M++L +  G+ +
Sbjct: 405 ISEWYTWQSLFSLSRVEAVALQLAGPIAMVMLAVTGGLAV 444


>NUOM_ECOLI RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 509

 Score = 66.2 bits (160), Expect = 6e-13
 Identities = 59/215 (27%), Positives = 86/215 (40%), Gaps = 14/215 (6%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA-VVLWV 252
           K   +PL  WLP+A + APT  S  +    +  A   L+    PLF +A    A + +W+
Sbjct: 234 KMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPNASAEFAPIAMWL 293

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G       A +A AQ D+KRL+A+++VS                       +  H    +
Sbjct: 294 GVIGIFYGAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAA 353

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL-- 367
            LF+  G L     TRD+R +GGL  ++ W               P    +  E  +L  
Sbjct: 354 GLFILCGQLYERIHTRDMRMMGGLWSKMKWLPALSLFFAVATLGMPGTGNFVGEFMILFG 413

Query: 368 -RQAVSVHTAWGVFMLV------LILLAGIYIGRA 395
             Q V V T    F LV      L +L   Y G+A
Sbjct: 414 SFQVVPVITVISTFGLVFASVYSLAMLHRAYFGKA 448


>NUOM_ECO57 RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 509

 Score = 66.2 bits (160), Expect = 6e-13
 Identities = 59/215 (27%), Positives = 86/215 (40%), Gaps = 14/215 (6%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA-VVLWV 252
           K   +PL  WLP+A + APT  S  +    +  A   L+    PLF +A    A + +W+
Sbjct: 234 KMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPNASAEFAPIAMWL 293

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G       A +A AQ D+KRL+A+++VS                       +  H    +
Sbjct: 294 GVIGIFYGAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAA 353

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL-- 367
            LF+  G L     TRD+R +GGL  ++ W               P    +  E  +L  
Sbjct: 354 GLFILCGQLYERIHTRDMRMMGGLWSKMKWLPALSLFFAVATLGMPGTGNFVGEFMILFG 413

Query: 368 -RQAVSVHTAWGVFMLV------LILLAGIYIGRA 395
             Q V V T    F LV      L +L   Y G+A
Sbjct: 414 SFQVVPVITVISTFGLVFASVYSLAMLHRAYFGKA 448


>NUOM_RICBR RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 494

 Score = 65.5 bits (158), Expect = 1e-12
 Identities = 49/194 (25%), Positives = 82/194 (42%), Gaps = 5/194 (2%)

Query: 204 WLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV-VLWVGAFTALIAA 261
           WLP+A + APT  S ++    +   G   +  L PL  +A    A+ V+W+     + A+
Sbjct: 237 WLPDAHVQAPTSGSVILAGILLKLGGYGFLRVLLPLLPNASQEFAIYVIWLSVIAIIYAS 296

Query: 262 LVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGAL 318
           LVA AQ D+K+++A+S+++                     F +  H    S LFL VG L
Sbjct: 297 LVALAQKDMKKMIAYSSITHMGYVTIGIFSFTDSGVSGALFQMLSHGIISSCLFLIVGTL 356

Query: 319 ERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWG 378
                T+++ + GG+  ++P                P  SG+  E   L     V+    
Sbjct: 357 YERLHTKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKVNVIAT 416

Query: 379 VFMLVLILLAGIYI 392
               + I+L  IY+
Sbjct: 417 FLAALGIILGAIYM 430


>NU5M_ANOQN RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;Flags: Fragment;
          Length = 265

 Score = 65.1 bits (157), Expect = 1e-12
 Identities = 34/70 (48%), Positives = 49/70 (70%), Gaps = 1/70 (1%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KSAQ+P ++WLP AMAAPTPVSAL+HS+T+  AGV+L++R   +  +  +A  ++L V  
Sbjct: 197 KSAQIPFSSWLPAAMAAPTPVSALVHSSTLVTAGVYLLIRFNDVLMNWWMAQFLLL-VSG 255

Query: 255 FTALIAALVA 264
            T  +A L A
Sbjct: 256 LTMFMAGLGA 265


>NUOM_RICFE RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 493

 Score = 64.7 bits (156), Expect = 2e-12
 Identities = 48/199 (24%), Positives = 83/199 (41%), Gaps = 5/199 (2%)

Query: 199 LPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV-VLWVGAFT 256
           +P   WLP+A + APT  S ++    +   G   +  L PLF       A+ V+++    
Sbjct: 232 IPFHTWLPDAHVQAPTSGSVILAGILLKFGGYGFLRVLLPLFSSVSQEFAIYVIYLSVIA 291

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + A+LVA AQ D+K+++A+S+++                     F +  H    S LFL
Sbjct: 292 IIYASLVALAQKDMKKMIAYSSIAHMGYVTIGIFSFTEAGVSGAIFQMLSHGVISSCLFL 351

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
            VG L     T+++ + GG+  ++P                P  SG+  E   L     V
Sbjct: 352 IVGTLYERLHTKEIAKYGGVASKMPVLATFFMIAMLGSVGLPGTSGFIGEFLSLLGIYKV 411

Query: 374 HTAWGVFMLVLILLAGIYI 392
           +        + I+L  +Y+
Sbjct: 412 NVIATFIAALGIILGAVYM 430


>NQO13_PARDE RecName: Full=NADH-quinone oxidoreductase chain 13;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I,
           chain 13;AltName: Full=NDH-1, chain 13;
          Length = 513

 Score = 63.9 bits (154), Expect = 3e-12
 Identities = 55/206 (26%), Positives = 85/206 (41%), Gaps = 10/206 (4%)

Query: 195 KSAQLPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP-LALAVVLWV 252
           K    P+  WLP+A + APT  S L+ +  +   G   +    P+F  A  +A   V W+
Sbjct: 232 KMPMWPVHTWLPDAHVQAPTAGSVLLAAVLLKMGGYGFLRFSLPMFPVASGVAQPYVFWL 291

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
            A   +  +LVA AQ D+K+++A+S+V+                     F +  H     
Sbjct: 292 SAIAIVYTSLVALAQSDMKKVIAYSSVAHMGYVTMGVFAANQIGVDGAIFQMLSHGFISG 351

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           ALFL VG +     TR++   GGL  R+P                P  SG+  E   L  
Sbjct: 352 ALFLCVGVIYDRMHTREIDAYGGLVNRMPAYAAVFMFFTMANVGLPGTSGFVGEFLTLMG 411

Query: 370 AVSVHTAWGVFMLVLILLAGIYIGRA 395
              V T W    + L+  +G+ +  A
Sbjct: 412 VFRVDT-W----VALVATSGVILSAA 432


>MRPD_BACSU RecName: Full=Na(+)/H(+) antiporter subunit D;AltName:
           Full=Multiple resistance and pH homeostasis protein
           D;AltName: Full=Mrp complex subunit D;
          Length = 493

 Score = 63.9 bits (154), Expect = 3e-12
 Identities = 76/322 (23%), Positives = 138/322 (42%), Gaps = 7/322 (2%)

Query: 44  VSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXX 103
           + LAAD+    +    A I L V +YS   + ++  R  +++ + F +  +         
Sbjct: 70  IVLAADQFASLLVLTTAIIGLLVGLYSFRSVGEKRERSFYYSGVQFLLAGVSGAFLTGDL 129

Query: 104 XXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQ 163
              ++ +E + +AS++LI     + + R++  K ++                  +TGT  
Sbjct: 130 FNMYVFFELLLIASYMLIVLGGTKIQLRES-LKYIVFNIVSSALFVIGVGFLYAVTGTLN 188

Query: 164 LPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSAT 223
           +     ++ +                   + K    PL  WLP +  AP    + +  A 
Sbjct: 189 MADLSVKISESGQXXXXXXXXXXXXXXFGM-KGGIFPLYFWLPGSYYAPPAAISALFGAL 247

Query: 224 MAAAGVFLVLRLFPL-FEH-APLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           +   G++ + R+F L F H       +++W+ A T +   + + A  ++ +++ ++ ++ 
Sbjct: 248 LTKVGLYAITRVFTLIFIHDTAFTHQLMIWLAALTVIFGVIGSLAYSNVMKIVIYNIITA 307

Query: 282 XXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
                               ++L      K ALF+  G L   TGT  L ++GGL KR P
Sbjct: 308 VGVILFGVAVHTPASIQGAIYYLIHDMLIKGALFMLAGTLIALTGTASLHKMGGLIKRYP 367

Query: 339 WTXXXXXXXXXXXXXXPLLSGY 360
                           P LSG+
Sbjct: 368 VLGWMFFISAISLAGIPPLSGF 389


>NU5M_TRYBB RecName: Full=NADH-ubiquinone oxidoreductase chain 5;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           5;
          Length = 590

 Score = 62.4 bits (150), Expect = 9e-12
 Identities = 39/135 (28%), Positives = 62/135 (45%), Gaps = 1/135 (0%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           KS Q  L  WLP+AM  P PVSALIH+AT+   G+ L+  ++  F+        ++    
Sbjct: 223 KSTQFGLHIWLPDAMEGPIPVSALIHAATLVVCGIILLSFVYWCFDFWFSYFYNLIGWST 282

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
              ++  L     +D+KR +A+ST+ Q                      H  +K+ LF+ 
Sbjct: 283 LILILMTLCVFYNFDVKRYVAFSTICQISFSMFCCLCIDIYIGSLFFCYHMFYKATLFIV 342

Query: 315 VGA-LERATGTRDLR 328
           +G  +    G +DLR
Sbjct: 343 LGIWIHIFFGLQDLR 357


>NUOM_RICCN RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 493

 Score = 60.5 bits (145), Expect = 3e-11
 Identities = 38/145 (26%), Positives = 67/145 (46%), Gaps = 5/145 (3%)

Query: 199 LPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV-VLWVGAFT 256
           +P   WLP+A + APT  S ++    +   G   +  L PL        A+ V+++    
Sbjct: 232 IPFHTWLPDAHVQAPTSGSVILAGILLKLGGYGFLRVLLPLCPSVSQEFAIYVIYLSVIA 291

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + A+LVA AQ D+K+++A+S+++                     F +  H    S LFL
Sbjct: 292 IIYASLVALAQKDMKKMIAYSSIAHMGYVTIGIFSFTKAGVSGAIFQMLSHGVISSCLFL 351

Query: 314 SVGALERATGTRDLRQLGGLGKRLP 338
            VG L     T+++ + GG+  ++P
Sbjct: 352 IVGTLYERLHTKEIAKYGGVASKMP 376


>NUOM_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 512

 Score = 60.1 bits (144), Expect = 5e-11
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 5/202 (2%)

Query: 195 KSAQLPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K    P+  WLP+A + APT  S ++ +  +   G   +    P+F      +   +++ 
Sbjct: 233 KMPMWPVHTWLPDAHVQAPTAGSVVLAAVLLKMGGYGFLRFSLPMFPVGAETMTTFVFIL 292

Query: 254 AFTALI-AALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
           +  A++  +LVA AQ D+K+L+A+S+V+                     F +  H     
Sbjct: 293 SAVAIVYTSLVALAQEDMKKLIAYSSVAHMGYVTMGIFAANQQGVDGAIFQMLSHGFISG 352

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           ALFL VG +     TR++   GGL  R+P                P  SG+  E   L  
Sbjct: 353 ALFLCVGVIYDRMHTREIAAYGGLVNRMPAYALIFMFFTMANVGLPGTSGFVGEFLTLLG 412

Query: 370 AVSVHTAWGVFMLVLILLAGIY 391
              V+T   +F    ++L+  Y
Sbjct: 413 IFQVNTWVALFATSGVILSAAY 434


>MNHD2_STAS1 RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 501

 Score = 60.1 bits (144), Expect = 5e-11
 Identities = 55/200 (27%), Positives = 91/200 (45%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   EH+ +   +++++  
Sbjct: 222 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLIFDEHSGITHPLLVFLSC 281

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T LI A    A  D+K++ A+                         F+L      K+ L
Sbjct: 282 ITMLIGAFGVLAYRDIKKIAAYQVXXXXXXXXXXXXTNTIAGVNGAIFYLANDIVVKTLL 341

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P+               P  SG+  +  + + A+
Sbjct: 342 FFIIGSLVYITGLRQYKSLYGLAKQEPFFGVAFVVMILAIGGVPPFSGFPGKVFIFKGAI 401

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  ++
Sbjct: 402 ENGNYIGLALMIITSLIAMF 421


>HYCC_ECOLI RecName: Full=Formate hydrogenlyase subunit 3;       
           Short=FHL subunit 3;AltName: Full=Hydrogenase-3
           component C;
          Length = 608

 Score = 60.1 bits (144), Expect = 5e-11
 Identities = 57/155 (36%), Positives = 81/155 (52%), Gaps = 15/155 (9%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           +PL  W+P+           + S  +                +APL   + L V G  TA
Sbjct: 212 IPLHGWVPQXXXXXXXXXXXLFSTVVMKIXXXXXXXXXXXXXNAPLWWGIALLVLGMITA 271

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--------------FHLTV 303
            +  L A  +++++RLLA+ T+                                 +HL  
Sbjct: 272 FVGGLYALVEHNIQRLLAYHTLENXXXXXXXXXXXXXXXXXEQPALIALGLVGGLYHLLN 331

Query: 304 HATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
           H+ FKS LFL  G++   TG RD+ +LGG+GK++P
Sbjct: 332 HSLFKSVLFLGAGSVWFRTGHRDIEKLGGIGKKMP 366


>MNHD1_STAES RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 59.7 bits (143), Expect = 6e-11
 Identities = 43/179 (24%), Positives = 75/179 (41%), Gaps = 5/179 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA--VVLWV 252
           K+   P+  WLP A  AP         A +   GV+ + R   LF +  ++ +  V+L++
Sbjct: 223 KAGVFPMYVWLPGAYYAPPVAIITFFGALLTKVGVYAIARTLSLFFNNTVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A YD K+++ ++ +                      + T+H    K+
Sbjct: 283 ALLTIIFGCIGAIAYYDTKKIILYNIMIAVGVILVGIAMMNESGMTGAIYYTLHDMLVKA 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR 368
           +LFL +G + + T T DLR  GGL K  P                P  SG++ +  ++R
Sbjct: 343 SLFLLIGVMYKITKTTDLRHFGGLIKGYPILGWTFFIAALSLAGIPPFSGFYGKFYIVR 401


>MNHD1_STAEQ RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 59.7 bits (143), Expect = 6e-11
 Identities = 43/179 (24%), Positives = 75/179 (41%), Gaps = 5/179 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA--VVLWV 252
           K+   P+  WLP A  AP         A +   GV+ + R   LF +  ++ +  V+L++
Sbjct: 223 KAGVFPMYVWLPGAYYAPPVAIITFFGALLTKVGVYAIARTLSLFFNNTVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A YD K+++ ++ +                      + T+H    K+
Sbjct: 283 ALLTIIFGCIGAIAYYDTKKIILYNIMIAVGVILVGIAMMNESGMTGAIYYTLHDMLVKA 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR 368
           +LFL +G + + T T DLR  GGL K  P                P  SG++ +  ++R
Sbjct: 343 SLFLLIGVMYKITKTTDLRHFGGLIKGYPILGWTFFIAALSLAGIPPFSGFYGKFYIVR 401


>NUOM_RICTY RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 494

 Score = 59.3 bits (142), Expect = 8e-11
 Identities = 41/174 (23%), Positives = 74/174 (42%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAV-VLWV 252
           K   +P   WLP+A + APT  S ++    +       +  L PL  +     A+ V+++
Sbjct: 229 KIPMIPFHTWLPDAHVQAPTSGSVILAGILLKLGSYGFLRVLLPLLPNVSQEFAIYVIYL 288

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
                + ++LVA AQ D+K+++A+S+++                     F +  H    S
Sbjct: 289 SVIAIIYSSLVALAQKDIKQMIAYSSIAHMGYVTIGIFSFTETGISGAIFQMLSHGVVSS 348

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           +LFL VG L     T+++ + GG+  ++P                P  SG+  E
Sbjct: 349 SLFLIVGTLYERLHTKEIAKYGGVASKMPVLATFFMITMLSSIGLPSTSGFIGE 402


>NU4C2_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 535

 Score = 58.9 bits (141), Expect = 1e-10
 Identities = 52/196 (26%), Positives = 81/196 (41%), Gaps = 5/196 (2%)

Query: 200 PLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    T PV  L+    +   G  L+     +   A L  A VL V G    
Sbjct: 245 PLHTWLPDAHGEATAPVHMLLAGILLKMGGYALMRMNVGMLPDAHLYFAPVLIVLGVVNI 304

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + AAL + AQ +LKR +A+S++S                       +  H    ++LF  
Sbjct: 305 IFAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSLTEIGMSGAMLQMISHGLIGASLFFL 364

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
           VGA    T T +L ++GG+G ++P                P +SG+ +E  +     +  
Sbjct: 365 VGATYDRTHTLELEEMGGVGLKMPKIFSMFTACSLASLALPGMSGFVAELMVFIGMATTD 424

Query: 375 TAWGVFMLVLILLAGI 390
                F LV++ LA +
Sbjct: 425 AYSLPFRLVVVFLAAV 440


>MNHD2_STAAR RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 58.9 bits (141), Expect = 1e-10
 Identities = 56/200 (28%), Positives = 91/200 (45%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   +++ + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNGLIHPLLVTMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P+               P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPFFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAHJ RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 499

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 44/200 (22%), Positives = 84/200 (42%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  +   +++++  
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHTGVTHPLLVFMSC 280

Query: 255 FTALIAALVATAQYDLKRLLAWS---TVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
            T LI A    A  D+K++ ++    ++                   F+L      K+ L
Sbjct: 281 ITMLIGAFGVIAYRDIKKVASYQVILSIGFVILGLGSNTFAGVHGAIFYLANDIIVKTML 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   +G R+ + L GL K+ P+               P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYMSGYREYKYLCGLAKKEPFFGVAFVVMIFAIGGVPPFSGFPGKVLIFQGAI 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 ENGNFIGLALMIITSLLAMY 420


>MNHD1_STAAW RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAU RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;AltName: Full=Mrp complex
           subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAT RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAS RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAR RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAITRTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAN RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAM RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAE RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAC RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAAB RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAA9 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAA8 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAA3 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAA2 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD1_STAA1 RecName: Full=Na(+)/H(+) antiporter subunit D1;AltName:
           Full=Mnh complex subunit D1;
          Length = 498

 Score = 57.8 bits (138), Expect = 2e-10
 Identities = 42/174 (24%), Positives = 71/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWV 252
           K+   P+  WLP               A +   GV+ + R   LF  ++   +  V+L++
Sbjct: 223 KAGVFPMFVWLPSXXXXXXXXXXXFFGALLTKVGVYAIARTLSLFFSDNVSFSHYVILFL 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX--FHLTVHATF-KS 309
              T +   + A A  ++K+++ ++ +                      + T+H    K 
Sbjct: 283 ALLTIIFGCVGAVAYANIKKIILYNVMIAVGVILVGVAMMTESGMIGAIYYTLHDMLVKL 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + TGT DLRQ GGL KR P                P LSG++ +
Sbjct: 343 ALFLLIGIMIKITGTADLRQFGGLIKRYPVLGWSFFIAALSLAGIPPLSGFYGK 396


>MNHD2_STAAW RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAU RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 499

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 222 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 281

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 282 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 341

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 342 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 401

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 402 QNGNYIGLALMIITSLIAMY 421


>MNHD2_STAAT RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAS RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAN RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAM RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAE RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAC RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAAB RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAA9 RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAA8 RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAA3 RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAA2 RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>MNHD2_STAA1 RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 498

 Score = 57.4 bits (137), Expect = 3e-10
 Identities = 56/200 (28%), Positives = 89/200 (44%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF--EHAPLALAVVLWVGA 254
           A L L  WLP+A A      A + +A M   G + ++R F L   +H  L   ++  + A
Sbjct: 221 AALVLFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDQHNDLIHPLLATMAA 280

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            T +I A+   A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMVIGAIGVIAYKDIKKIAAYQVXXXXXXXXXXXXTNTFAGINGAIFYLVNDIVVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   TG R  + L GL K+ P                P  SG+  +  + + A+
Sbjct: 341 FFIIGSLVYITGYRQYQYLNGLAKKEPLFGVAFIIMIFAIGGVPPFSGFPGKVLIFQGAL 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
                 G+ ++++  L  +Y
Sbjct: 401 QNGNYIGLALMIITSLIAMY 420


>NU4C2_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 534

 Score = 57.0 bits (136), Expect = 4e-10
 Identities = 52/196 (26%), Positives = 80/196 (40%), Gaps = 5/196 (2%)

Query: 200 PLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    T PV  L+    +   G  L+     +   A L  A VL V G    
Sbjct: 245 PLHTWLPDAHGEATAPVHMLLAGILLKMGGYALMRMNAGMLPDAHLYFAPVLIVLGVVNI 304

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + AAL + AQ +LKR +A S++S                       +  H    ++LF  
Sbjct: 305 IFAALTSFAQRNLKRKIACSSISHMGFVLIGIGSLTEIGMSGAMLQMISHGLIGASLFFL 364

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
           VGA    T T +L ++GG+G ++P                P +SG+ +E  +     +  
Sbjct: 365 VGATYDRTHTLELEEMGGVGLKMPKIFSMFTACSLASLALPGMSGFVAEIMVFIGMATTD 424

Query: 375 TAWGVFMLVLILLAGI 390
                F LV++ LA +
Sbjct: 425 AYSLPFRLVVVFLAAV 440


>NU4M_MARPO RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 495

 Score = 56.2 bits (134), Expect = 7e-10
 Identities = 79/289 (27%), Positives = 120/289 (41%), Gaps = 14/289 (4%)

Query: 55  MATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVG 114
           + T +  I + V  YSV     E     FF   SF + +             ++ +E V 
Sbjct: 96  LTTFLTPICILVGFYSVKSYKKEY-MIAFFICESFLIAVFCSLDLLIF----YVFFESVL 150

Query: 115 LASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDX 174
           +  F++IG    + +  +AA++  L T                 TGTT L    Q +   
Sbjct: 151 IPMFIIIGVWGSRQRKIKAAYQFFLYTLMGSXXXXXXXXXXXXQTGTTDL----QILLTT 206

Query: 175 XXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR 234
                               K   +P+  WLPEA        ++I +  +   G +  LR
Sbjct: 207 EFSERRQILLWIAFFASFSVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLR 266

Query: 235 L-FPLFEHAPLALAVVLWVGAFTALI-AALVATAQYDLKRLLAWSTVSQXXXXXXXXXXX 292
              P+F  A L     ++  +  A+I  +L    Q DLK+++A+S+V+            
Sbjct: 267 FSIPMFPEATLYFTPFIYTLSVIAIIYTSLTTIRQIDLKKIIAYSSVAHMNFVTIGMFSL 326

Query: 293 XXXXXXFHLTV---HATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
                   + +   H    SALFL VGAL     TR ++  GGL   +P
Sbjct: 327 NIQGIEGSILLMLSHGLVSSALFLCVGALYDRHKTRIVKYYGGLVSTMP 375


>NU4C2_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, subunit D-2;
          Length = 525

 Score = 55.5 bits (132), Expect = 1e-09
 Identities = 46/198 (23%), Positives = 84/198 (42%), Gaps = 7/198 (3%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF---EHAPLALAVVLWVGAF 255
           +PL  WLP+A    T  + ++ +  +   G + ++R+        HA  A  +V+ +G  
Sbjct: 229 IPLHTWLPDAHGEATAPAHMLLAGILLKMGGYALIRMNAGILPDAHAYFAPVLVV-LGVV 287

Query: 256 TALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALF 312
             + AAL + AQ +LKR +A+S++S                       +  H    ++LF
Sbjct: 288 NIIYAALTSFAQRNLKRKIAYSSISHMGFVIIGFASFTDLGLSGAVLQMVSHGLIGASLF 347

Query: 313 LSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
             VGA    T T  L ++GG+GKR+P                P +SG+ +E  +     +
Sbjct: 348 FLVGATYDRTHTLMLDEMGGVGKRMPKIFAMFTACSMASLALPGMSGFVAELMVFVGFAT 407

Query: 373 VHTAWGVFMLVLILLAGI 390
                  F ++++ L  +
Sbjct: 408 SDAYSSTFKVIVVFLMAV 425


>NU4C1_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 525

 Score = 55.5 bits (132), Expect = 1e-09
 Identities = 46/198 (23%), Positives = 84/198 (42%), Gaps = 7/198 (3%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF---EHAPLALAVVLWVGAF 255
           +PL  WLP+A    T  + ++ +  +   G + ++R+        HA  A  +V+ +G  
Sbjct: 229 IPLHTWLPDAHGEATAPAHMLLAGILLKMGGYALIRMNAGILPDAHAYFAPVLVV-LGVV 287

Query: 256 TALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALF 312
             + AAL + AQ +LKR +A+S++S                       +  H    ++LF
Sbjct: 288 NIIYAALTSFAQRNLKRKIAYSSISHMGFVIIGFASFTDLGLSGAVLQMVSHGLIGASLF 347

Query: 313 LSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
             VGA    T T  L ++GG+GKR+P                P +SG+ +E  +     +
Sbjct: 348 FLVGATYDRTHTLMLDEMGGVGKRMPKIFAMFTACSMASLALPGMSGFVAELMVFVGFAT 407

Query: 373 VHTAWGVFMLVLILLAGI 390
                  F ++++ L  +
Sbjct: 408 SDAYSSTFKVIVVFLMAV 425


>NU4C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 534

 Score = 55.1 bits (131), Expect = 1e-09
 Identities = 50/198 (25%), Positives = 83/198 (41%), Gaps = 7/198 (3%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFE--HAPLALAVVLWVGAF 255
           +PL  WLP+A    T PV  L+    +   G  L+     L    HA  A A+++ +G  
Sbjct: 231 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNVELLPDAHAYFAPALII-LGVV 289

Query: 256 TALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALF 312
             + AAL + AQ +LKR +A+S++S                       +  H    ++LF
Sbjct: 290 NIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIASFTDLGMSGAVLQMVSHGLIGASLF 349

Query: 313 LSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVS 372
             VGA    T T  L ++GG+ + +P                P +SG+ +E  +     +
Sbjct: 350 FLVGATYDRTHTLILEEMGGVAQNMPKIFAMFTTCSMASLALPGMSGFVAELMVFVGLAT 409

Query: 373 VHTAWGVFMLVLILLAGI 390
                  F + +++LAGI
Sbjct: 410 SDAYSLAFRVPVVILAGI 427


>NU4M_CHOCR RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 492

 Score = 54.3 bits (129), Expect = 2e-09
 Identities = 87/294 (29%), Positives = 133/294 (45%), Gaps = 17/294 (5%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP 166
           +I +E V +  F+++G    + +  +AA++  L T                 TGTT L  
Sbjct: 140 YIYFESVLIPMFLIVGVWGSRQRKIRAAYQFFLYTXXXXXXXXXXXXNIYFQTGTTDLQI 199

Query: 167 F----FQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMA-APTPVSALIHS 221
                F ++                       K   +P   WLPEA A APT  S ++  
Sbjct: 200 LWYIQFSEISQIFLWLSFFASFAV--------KIPMIPFHIWLPEAHAEAPTAGSVILAG 251

Query: 222 ATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALI-AALVATAQYDLKRLLAWSTVS 280
             +   G   +    P+F  A +     ++  +  A+I A+L    Q DLK+++A+S+VS
Sbjct: 252 ILLKMGGYGFLRFSLPMFPVASIFFTPFIFTLSLVAIIYASLTTLRQIDLKKIIAYSSVS 311

Query: 281 QXXXXXXXXXXXXXXXXXFHLTV---HATFKSALFLSVGALERATGTRDLRQLGGLGKRL 337
                               + +   H    SALFL +G L     TR ++   GL + +
Sbjct: 312 HMGFVTIGIFSLNIQGIEGSILLMLSHGLVSSALFLCIGVLYDRYKTRVIKYYSGLIQVM 371

Query: 338 PWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIY 391
           P                P  S +  E  +L  +  ++    +F  + ++    Y
Sbjct: 372 PXXXXXXXXXXXXXXXXPGTSSFIGEVLVLLSSFQINKTLTLFASLGMIFGAAY 425


>NUON_ERWT9 RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 485

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 93/415 (22%), Positives = 151/415 (36%), Gaps = 27/415 (6%)

Query: 19  AVLPLSGADAEVALTWFT--VGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMAD 76
           A L + G +  +   +F    GP ++T  L  D    +   LV   +L    ++ P++A 
Sbjct: 38  ATLAVVGLNLALFSLYFVGQAGPMDVTPLLRIDAYSMFYTGLVILASLATCTFAYPWLAT 97

Query: 77  EA-GRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAF 135
               R+ F+                      FI  E + L  F L+G    Q ++ +AA 
Sbjct: 98  YPDNREEFYXXXXXXXXXXXXXXXXXHLASLFIGIELISLPLFGLVGYAFQQKRSLEAAI 157

Query: 136 KALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGK 195
           K  +++                 +G        + + D                     K
Sbjct: 158 KYTILSAAASSFLLFGMALVYADSGNLGFMALGRSLNDDVIHQPLLLAGLGLMIVGFGFK 217

Query: 196 SAQLPLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLA----LAVVL 250
            + +P   W P+    AP PVS  +  AT +   +F VL    LF +AP+A    +  VL
Sbjct: 218 LSLVPFHLWTPDVYQGAPAPVSTFL--ATASKIAIFGVL--MRLFMYAPMANSEGVRTVL 273

Query: 251 WVGAFTALIAA-LVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
            + A  +++   L+A +Q ++KRLL +S+++                     TV      
Sbjct: 274 GIIAVASMLFGNLMAISQSNIKRLLGYSSIAHLGYLLVALIAVQSQQLSVE-TVGVYLAG 332

Query: 310 ALFLSVGALE---------RATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGY 360
            LF S+GA           R      L    GL    P                P+  G+
Sbjct: 333 YLFSSLGAFGVVSLMSSPYRGPDAESLYSYRGLFWHRPILAAVMTVMMLSLAGIPMTLGF 392

Query: 361 WSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATFGLAPQAVM----PAN 411
             +  ++   V+ H  W    +VL    G+Y       +  L+P  +M    PAN
Sbjct: 393 IGKFYVIAVGVNAHLWWLTGAVVLGSAIGLYYYLRMTVSLYLSPPELMQRDSPAN 447


>NU4M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 495

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 69/233 (29%), Positives = 101/233 (43%), Gaps = 9/233 (3%)

Query: 111 EGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQ 170
           E V +  F++IG    + +  +AA++  L T                 TGTT L    Q 
Sbjct: 147 ESVLIPMFIIIGVWGSRQRKIKAAYQFFLYTXXXXXXXXXXXXXXXFQTGTTDL----QI 202

Query: 171 VEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVF 230
           +                       K   +P+  WLPEA        ++I +  +   G +
Sbjct: 203 LLTTEFSERRQIFLWIAFFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGILLKFGTY 262

Query: 231 LVLRL-FPLFEHAPLALAVVLW-VGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXX 288
             LR   P+F  A L     ++ + A   +  +L    Q DLK+++A+S+V+        
Sbjct: 263 GFLRFSIPMFPEATLCFTPFIYTLSAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIG 322

Query: 289 XXXXXXXXXXFHLTV---HATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
                       + +   H    SALFL VG L     TR +R  GGL   +P
Sbjct: 323 MFSPNIQGIGGSILLMLSHGLVSSALFLCVGVLYDRHKTRLVRYYGGLVSTMP 375


>NU4C3_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 3;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 3;
          Length = 550

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 51/201 (25%), Positives = 76/201 (37%), Gaps = 5/201 (2%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV- 252
           K A  PL  WLP+A   A +PVS L+    +   G  L+     L   A +  A +L + 
Sbjct: 225 KLAIFPLHTWLPDAHGEASSPVSMLLAGVLLKMGGYGLMRFNMELLPDAHVRFAPLLVIL 284

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
           G    +  A  +  Q ++KR LA+S+VS                       +  H    S
Sbjct: 285 GVVNIVYGAFSSFGQTNMKRRLAYSSVSHMGFVLIGIASFTDLGINGAMLQMLSHGLIAS 344

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LF   G     T T  L ++GGLG+ +P                P +SG+  E  +   
Sbjct: 345 VLFFLAGVTYDRTKTMVLAEVGGLGQVMPKVFAMFTVGALASLALPGMSGFVGELSVFVG 404

Query: 370 AVSVHTAWGVFMLVLILLAGI 390
             S  T    F  + + LA +
Sbjct: 405 LASSDTYSATFRTITVFLAAV 425


>NU4C3_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-3;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, subunit D-3;
          Length = 560

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 50/201 (24%), Positives = 76/201 (37%), Gaps = 5/201 (2%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVL-WV 252
           K A  PL  WLP+A   A  PVS ++    +   G  L+     L   A +  A VL  +
Sbjct: 224 KLAIFPLHTWLPDAHGEASAPVSMILAGVLLKMGGYGLIRLNLELLPDAHIYFAPVLATL 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    +   L + AQ  +KR LA+S+VS                       +  H    +
Sbjct: 284 GVINIIYGGLNSFAQTHMKRRLAYSSVSHMGFVLLGIASFTDVGVSGAMLQMLSHGLIAA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LF   G     T T  +  LGG+G+ +P                P +SG+ SE ++   
Sbjct: 344 VLFFLAGVTYDRTHTMAMDNLGGIGQAMPKVFALFTAGTMASLALPGMSGFVSELKVFIG 403

Query: 370 AVSVHTAWGVFMLVLILLAGI 390
             +       F  V++ LA +
Sbjct: 404 VTTSDIYSPTFCTVMVFLAAV 424


>NU4C2_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 534

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 57/205 (27%), Positives = 90/205 (43%), Gaps = 21/205 (10%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFE---------HAPLALAVV 249
           +PL  WLP+A    T   A +H   M  AG+ L +  + LF          HA  A  +V
Sbjct: 231 VPLHTWLPDAHGEAT---APVH---MLLAGILLKMGGYALFRMNAGMLPEAHARFAPILV 284

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHAT 306
           L +G    L AAL + AQ +LKR +A+S++S                       +  H  
Sbjct: 285 L-LGVVNILYAALTSFAQRNLKRKIAYSSISHMGFVLIGLGSFTQLGLSGSMLQMVSHGL 343

Query: 307 FKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEEL 366
             ++LF  VGA    T T  L ++GG+G+++                 P +SG+ + E +
Sbjct: 344 IGASLFFLVGATYDRTHTLMLDEMGGVGQKMRKMFAMWTTCAMASLALPGMSGFVA-ELM 402

Query: 367 LRQAVSVHTAWGV-FMLVLILLAGI 390
           +    +   A+G+ F +V+I LA I
Sbjct: 403 VFVGFATSDAYGLPFKVVVISLAAI 427


>NU4C2_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 534

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 57/205 (27%), Positives = 90/205 (43%), Gaps = 21/205 (10%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFE---------HAPLALAVV 249
           +PL  WLP+A    T   A +H   M  AG+ L +  + LF          HA  A  +V
Sbjct: 231 VPLHTWLPDAHGEAT---APVH---MLLAGILLKMGGYALFRMNAGMLPEAHARFAPILV 284

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHAT 306
           L +G    L AAL + AQ +LKR +A+S++S                       +  H  
Sbjct: 285 L-LGVVNILYAALTSFAQRNLKRKIAYSSISHMGFVLIGLGSFTQLGLSGSMLQMVSHGL 343

Query: 307 FKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEEL 366
             ++LF  VGA    T T  L ++GG+G+++                 P +SG+ + E +
Sbjct: 344 IGASLFFLVGATYDRTHTLMLDEMGGVGQKMRKMFAMWTTCAMASLALPGMSGFVA-ELM 402

Query: 367 LRQAVSVHTAWGV-FMLVLILLAGI 390
           +    +   A+G+ F +V+I LA I
Sbjct: 403 VFVGFATSDAYGLPFKVVVISLAAI 427


>NU4C2_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 561

 Score = 53.9 bits (128), Expect = 3e-09
 Identities = 50/201 (24%), Positives = 76/201 (37%), Gaps = 5/201 (2%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVL-WV 252
           K A  PL  WLP+A   A  PVS ++    +   G  L+     L   A +  A VL  +
Sbjct: 225 KLAIFPLHTWLPDAHGEASAPVSMILAGVLLKMGGYGLIRLNLELLPDAHIYFAPVLATL 284

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    +   L + AQ  +KR LA+S+VS                       +  H    +
Sbjct: 285 GVINIIYGGLNSFAQTHMKRRLAYSSVSHMGFVLLGIASFTDVGVSGAMLQMLSHGLIAA 344

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LF   G     T T  +  LGG+G+ +P                P +SG+ SE ++   
Sbjct: 345 VLFFLAGVTYDRTHTMAMDNLGGIGQAMPKVFALFTAGTMASLALPGMSGFVSELKVFIG 404

Query: 370 AVSVHTAWGVFMLVLILLAGI 390
             +       F  V++ LA +
Sbjct: 405 VTTSDIYSPTFCTVMVFLAAV 425


>NU4C_SYNR3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 544

 Score = 53.5 bits (127), Expect = 4e-09
 Identities = 47/170 (27%), Positives = 71/170 (41%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L      +F  A +  A +L V G   
Sbjct: 254 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALFRFNASMFPDAHVQFAPLLVVLGVVN 313

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 314 IIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSPLAASGAMLQMISHGLIGASLFF 373

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            VGA    T T  L ++GG+G+R+                 P +SG+ SE
Sbjct: 374 LVGATYDRTHTLQLDEMGGVGQRMRKMFAMWTACSLASLALPGMSGFVSE 423


>NU4C_PROM5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 546

 Score = 53.1 bits (126), Expect = 6e-09
 Identities = 49/199 (24%), Positives = 85/199 (42%), Gaps = 9/199 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P+  HA  A  +++ +G 
Sbjct: 249 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPV-AHAQFAPLLIV-LGV 306

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 307 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 366

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE  +    V
Sbjct: 367 FFLVGATYDRTKTLKLDEMGGVGQKMRIMFALWTACSLASLALPGMSGFVSELMVFTGFV 426

Query: 372 SVHTAWGVFMLVLILLAGI 390
           +       F +V+  LA +
Sbjct: 427 TDEVYTLPFRVVMASLAAV 445


>NU4C2_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 553

 Score = 53.1 bits (126), Expect = 6e-09
 Identities = 48/201 (23%), Positives = 75/201 (37%), Gaps = 5/201 (2%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV- 252
           K A  PL  WLP+A   A  PVS ++    +   G  L+     L   A +  A +L + 
Sbjct: 226 KLAIFPLHTWLPDAHGEASAPVSMILAGVLLKMGGYGLIRLNMGLLPDAHIYFAPILAIL 285

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    +  A  +  Q ++KR LA+S+VS                       +  H    +
Sbjct: 286 GVVNIIYGAFASFGQQNMKRRLAYSSVSHMGFVLLGIASFTDVGISGAMLQMLSHGLIAA 345

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LF   G     T T  L ++GG+ + +P                P +SG+ SE  +   
Sbjct: 346 VLFFLAGVTYDRTHTLALNEMGGIAQAMPKVFALFTAGAMASLALPGMSGFASEITVFIG 405

Query: 370 AVSVHTAWGVFMLVLILLAGI 390
             S       F +V + LA +
Sbjct: 406 VTSSDVYSQTFRVVTVFLASV 426


>NDHF_BACSU RecName: Full=Probable NADH-quinone oxidoreductase
           subunit 5;         EC=1.6.99.5;AltName: Full=NADH
           dehydrogenase subunit 5;
          Length = 505

 Score = 53.1 bits (126), Expect = 6e-09
 Identities = 79/281 (28%), Positives = 107/281 (38%), Gaps = 8/281 (2%)

Query: 37  VGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQRFFAWLSFFVGMMXX 96
           VGP+ L      D L   M   V  I   +  +SV Y+  +   +++F   +F  G    
Sbjct: 65  VGPWHL------DSLACLMTFFVLAIGFIIQRFSVRYLMGDRSYRKYFTLFTFTTGAASM 118

Query: 97  XXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXX 156
                      + W    +   +LI  +     A +AA  +                   
Sbjct: 119 TWLSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRXXXXXXXXXXXAMMWLF 178

Query: 157 XITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVS 216
             TG  QL                            I  +AQ P   WL E++ APTPVS
Sbjct: 179 HATGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWPFQRWLVESIVAPTPVS 238

Query: 217 ALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAW 276
           A++H+  + A G+ L  R  PLF H                     ++  Q D KR L  
Sbjct: 239 AIMHAGLVNAGGIILT-RFSPLF-HXXXXXXXXXXXXXXXXXXXTGISLVQVDYKRQLVG 296

Query: 277 STVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA 317
           ST+ Q                         FK+ LFL  G+
Sbjct: 297 STIGQMGFMLIQCXXXXXXXXXXXXXXXXXFKATLFLQAGS 337


>MNHD2_STAES RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 500

 Score = 53.1 bits (126), Expect = 6e-09
 Identities = 65/200 (32%), Positives = 103/200 (51%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP-LFEHAP-LALAVVLWVGA 254
           A L +  WLP+A A      A + +A M   G + ++R F  LF+H P +   +++++  
Sbjct: 221 AALVIFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDHHPSVTHTLLVFMAC 280

Query: 255 FTALIAALVATAQYDLKRLLAWST---VSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
            T +I A    A  D+K++ A+                         F+L      K+ L
Sbjct: 281 ITMIIGAFGVIAYKDIKKIAAYQVXXXXXXXXXXXXXHTISGVNGAIFYLANDIIVKTLL 340

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   +G R+ + L GL KR                     SG+  +  + + A+
Sbjct: 341 FFVIGSLVYMSGYRNYQYLSGLAKREXXXXXXXXXXXXXXXXXXXFSGFPGKVLIFQGAI 400

Query: 372 SVHTAWGVFMLVLILLAGIY 391
           +     G+ ++++  L  +Y
Sbjct: 401 TNGNYIGLALMIVTSLIAMY 420


>MNHD2_STAEQ RecName: Full=Putative antiporter subunit
           mnhD2;AltName: Full=Mrp complex subunit D2;
          Length = 499

 Score = 53.1 bits (126), Expect = 6e-09
 Identities = 65/200 (32%), Positives = 103/200 (51%), Gaps = 5/200 (2%)

Query: 197 AQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP-LFEHAP-LALAVVLWVGA 254
           A L +  WLP+A A      A + +A M   G + ++R F  LF+H P +   +++++  
Sbjct: 220 AALVIFMWLPKAYAVLNTELAALFAALMTKVGAYALIRFFTLLFDHHPSVTHTLLVFMAC 279

Query: 255 FTALIAALVATAQYDLKRLLAWST---VSQXXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
            T +I A    A  D+K++ A+                         F+L      K+ L
Sbjct: 280 ITMIIGAFGVIAYKDIKKIAAYQVXXXXXXXXXXXXXHTISGVNGAIFYLANDIIVKTLL 339

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  +G+L   +G R+ + L GL KR                     SG+  +  + + A+
Sbjct: 340 FFVIGSLVYMSGYRNYQYLSGLAKREXXXXXXXXXXXXXXXXXXXFSGFPGKVLIFQGAI 399

Query: 372 SVHTAWGVFMLVLILLAGIY 391
           +     G+ ++++  L  +Y
Sbjct: 400 TNGNYIGLALMIVTSLIAMY 419


>NU4M_WHEAT RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 495

 Score = 52.8 bits (125), Expect = 7e-09
 Identities = 40/149 (26%), Positives = 63/149 (42%), Gaps = 5/149 (3%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLW-V 252
           K   +P+  WLPEA        ++I +  +   G +  LR   P+F  A L     ++ +
Sbjct: 227 KVPMVPVHIWLPEAHVEAPTAGSVILAGILLKLGTYGFLRFSIPMFPEATLCFTPFIYTL 286

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV---HATFKS 309
            A   +  +L    Q DLK+++A+S+V+                    + +   H    S
Sbjct: 287 SAIAIIYTSLTTLRQIDLKKIIAYSSVAHMNLVTIGMFSLNIQGIGGSILLMLSHGLVSS 346

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLP 338
           ALFL VG L     TR +R  GGL   +P
Sbjct: 347 ALFLCVGVLYDRHKTRLVRYYGGLVSTMP 375


>NU2C_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 525

 Score = 52.8 bits (125), Expect = 7e-09
 Identities = 75/246 (30%), Positives = 109/246 (44%), Gaps = 23/246 (9%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLM----TRXXXXXXXXXXXXXXXITGTT 162
           F++ E +G+AS+++ G      ++ +AA K LL     T                 T   
Sbjct: 136 FVSLETLGIASYLMAGYTKRDPRSSEAALKYLLTGASSTAIFXXXXXXXXXXXXXQTQLA 195

Query: 163 QLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIG-KSAQLPLTAWLPEAM-AAPTPVSALIH 220
            + P+                         IG K A +P   W P+    +PTPV A + 
Sbjct: 196 AIAPYLANA-------GLVGILALVFCLGGIGFKLAAVPFHQWTPDVYEGSPTPVVAFL- 247

Query: 221 SATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAW 276
           S    AAG  L +R    +FP       A+  VL +   T ++  +VA AQ  LKRLLA+
Sbjct: 248 SVGSKAAGFALAIRFLATVFPAMTEEWRAVLSVLAI--LTMVLGNVVAIAQTRLKRLLAY 305

Query: 277 STVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGL 333
           S++ Q                    F+L V+       FL V      TGT ++ +  GL
Sbjct: 306 SSIGQAGFVLIGLVAGTEAGYASLIFYLMVYLAMNLGAFLCVTLFSLKTGTDEINEYSGL 365

Query: 334 GKRLPW 339
            ++ P+
Sbjct: 366 YQKDPF 371


>NU4C_PROMP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 546

 Score = 52.4 bits (124), Expect = 9e-09
 Identities = 49/199 (24%), Positives = 82/199 (41%), Gaps = 9/199 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P+       L +VL  G 
Sbjct: 249 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPIAHAQFSPLLIVL--GV 306

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 307 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 366

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE  +    V
Sbjct: 367 FFLVGATYDRTKTLKLDEMGGVGQKMRIMFALWTACSLASLALPGMSGFVSELMVFTGFV 426

Query: 372 SVHTAWGVFMLVLILLAGI 390
           +       F +++  LA I
Sbjct: 427 TDEVYTLPFRVIMASLAAI 445


>NU4C_PROM4 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 558

 Score = 52.4 bits (124), Expect = 9e-09
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 9/172 (5%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P   HA  A  +++ +G 
Sbjct: 250 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPA-AHAQFAPLLIV-LGV 307

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 308 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 367

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 368 FFLVGATYDRTRTLQLNEMGGVGQKMRIMFALWTTCSLASLALPGMSGFVSE 419


>NU4C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 563

 Score = 52.0 bits (123), Expect = 1e-08
 Identities = 46/170 (27%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L+     L   A    A +L V G   
Sbjct: 250 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALMRFNAQLLPEAHAQFAPLLIVLGVVN 309

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 310 IIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSALGTSGAMLQMISHGLIGASLFF 369

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 370 LVGATYDRTHTLQLEEMGGVGQKMRIMFALWTVCALASLALPGMSGFVSE 419


>NU4C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 557

 Score = 52.0 bits (123), Expect = 1e-08
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 9/172 (5%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P   HA  A  +++ +G 
Sbjct: 250 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPA-AHAQFAPLLIV-LGV 307

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 308 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSTLGTSGAMLQMISHGLIGASL 367

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 368 FFLVGATYDRTHTLQLNEMGGVGQKMRIMFALWTVCSLASLALPGMSGFVSE 419


>NU4C2_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, subunit D-2;
          Length = 559

 Score = 52.0 bits (123), Expect = 1e-08
 Identities = 50/201 (24%), Positives = 74/201 (36%), Gaps = 5/201 (2%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV- 252
           K A  P   WLP+A   A  PVS ++    +   G  L+     L E A +  A +L + 
Sbjct: 224 KLAIFPFHTWLPDAHGEASAPVSMILAGVLLKMGGYGLIRLNLGLLEDAHVYFAPILVIL 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
           G    +     + AQ ++KR LA+S+VS                       +  H    +
Sbjct: 284 GVVNIIYGGFSSFAQDNMKRRLAYSSVSHMGFVLLGIASFTDLGISGAMLQMLSHGLIAA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LF   G     T T  L Q+G +GK +P                P +SG+ SE  +   
Sbjct: 344 VLFFLAGVTYDRTHTLSLAQMGNIGKVMPTVFALFTMGAMASLALPGMSGFVSELAVFVG 403

Query: 370 AVSVHTAWGVFMLVLILLAGI 390
             S       F  V + LA +
Sbjct: 404 VSSSDIYSTPFKTVTVFLAAV 424


>NU4C2_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 526

 Score = 52.0 bits (123), Expect = 1e-08
 Identities = 45/196 (22%), Positives = 83/196 (42%), Gaps = 5/196 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP--LFEHAPLALAVVLWVGAFTA 257
           PL  WLP+A    T  + ++ +  +   G + +LR+    L +   L   V++ +G    
Sbjct: 230 PLHTWLPDAHGEATAPAHMLLAGILLKMGGYALLRMNAGMLPDAHALFGPVLVILGVVNI 289

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + AAL + AQ +LKR +A+S++S                       +  H    ++LF  
Sbjct: 290 VYAALTSFAQRNLKRKIAYSSISHMGFVLIGMASFTDLGTSGAMLQMISHGLIGASLFFM 349

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
           VGA    T T  L ++GG+GK++                 P +SG+ +E  +     +  
Sbjct: 350 VGATYDRTHTLMLDEMGGVGKKMKKIFAMWTTCSMASLALPGMSGFVAELMVFVGFATSD 409

Query: 375 TAWGVFMLVLILLAGI 390
                F ++++ LA +
Sbjct: 410 AYSPTFRVIIVFLAAV 425


>NU4C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 558

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 46/172 (26%), Positives = 74/172 (43%), Gaps = 9/172 (5%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLV---LRLFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T PV  L+    +   G  L+     + P+  HA  A  +V+ +G 
Sbjct: 250 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALMRFNAEILPV-AHAQFAPLLVV-LGV 307

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 308 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSELGTSGAMLQMISHGLIGASL 367

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 368 FFLVGATYDRTHTLQLDEMGGIGQKMRIMFALWTVCCLASLALPGMSGFVSE 419


>NU4C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 546

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 9/172 (5%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P   HA  A  +++ +G 
Sbjct: 242 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNCELLPA-AHAQFAPLLIV-LGV 299

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 300 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGVGSFSALGTSGAMLQMISHGLIGASL 359

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 360 FFLVGATYDRTHTLQLDEMGGVGQKMRTMFALWTVCALASLALPGMSGFVSE 411


>NU4C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 538

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 52/197 (26%), Positives = 79/197 (40%), Gaps = 5/197 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L+     L   A    A +L V G   
Sbjct: 237 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPDAHAQFAPLLIVLGVVN 296

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 297 IIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASLFF 356

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
            VGA    T T  L ++GG+G+ +                 P +SG+ SE  +    V+ 
Sbjct: 357 LVGATYDRTHTLQLDEMGGIGQNMRIMFALWTACAFASLALPGMSGFISELMVFVGFVTD 416

Query: 374 HTAWGVFMLVLILLAGI 390
                 F +V+  LA I
Sbjct: 417 EVYTLPFRIVVASLAAI 433


>NU4C_PROM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 538

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 52/197 (26%), Positives = 79/197 (40%), Gaps = 5/197 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L+     L   A    A +L V G   
Sbjct: 237 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPDAHAQFAPLLIVLGVVN 296

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 297 IIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASLFF 356

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
            VGA    T T  L ++GG+G+ +                 P +SG+ SE  +    V+ 
Sbjct: 357 LVGATYDRTHTLQLDEMGGIGQNMRIMFALWTACAFASLALPGMSGFISELMVFVGFVTD 416

Query: 374 HTAWGVFMLVLILLAGI 390
                 F +V+  LA I
Sbjct: 417 EVYTLPFRIVVASLAAI 433


>NU4C1_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 529

 Score = 51.6 bits (122), Expect = 2e-08
 Identities = 44/170 (25%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L+     +   A    A VL + G   
Sbjct: 229 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNVDMLPAAHAKFAPVLVILGVVN 288

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 289 IIYAALTSYAQRNLKRKIAYSSISHIGFVLIGIASFTNLGMSGAVLQMVSHGLIGASLFF 348

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            VGA    T T  L ++GG+G+++                 P +SG+ +E
Sbjct: 349 LVGATYDRTHTLILEEMGGVGQKMKKIFAMFTACSLASLALPGMSGFVAE 398


>NU4C_SYNSC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 533

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 44/172 (25%), Positives = 71/172 (41%), Gaps = 9/172 (5%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P        L +VL  G 
Sbjct: 230 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNCELLPAAHSQFAPLLIVL--GV 287

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 288 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGVGSFSALGTSGAMLQMISHGLIGASL 347

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 348 FFLVGATYDRTHTLQLDEMGGIGQKMRIMFALWTVCALASLALPGMSGFVSE 399


>NU4C_PROMS RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 534

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 49/199 (24%), Positives = 84/199 (42%), Gaps = 9/199 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P+  HA  A  +++ +G 
Sbjct: 237 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPV-AHAQFAPLLIV-LGV 294

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 295 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 354

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  VGA    T T  L ++ G+G+++                 P +SG+ SE  +    V
Sbjct: 355 FFLVGATYDRTKTLKLDEMSGVGQKMRIMFALWTACSLASLALPGMSGFVSELMVFTGFV 414

Query: 372 SVHTAWGVFMLVLILLAGI 390
           +       F +V+  LA I
Sbjct: 415 TDEVYTLPFRVVMASLAAI 433


>NU4C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 563

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 46/170 (27%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L+     L   A    A +L V G   
Sbjct: 250 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALMRFNAQLLPEAHAQFAPLLIVLGVVN 309

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 310 IIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSALGTSGAMLQMISHGLIGASLFF 369

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 370 LVGATYDRTHTLQLDEMGGVGQKMRIMFALWTVCALASLALPGMSGFVSE 419


>NU4C_PROM2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 534

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 49/199 (24%), Positives = 84/199 (42%), Gaps = 9/199 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P+  HA  A  +++ +G 
Sbjct: 237 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPV-AHAQFAPLLIV-LGV 294

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 295 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 354

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  VGA    T T  L ++ G+G+++                 P +SG+ SE  +    V
Sbjct: 355 FFLVGATYDRTKTLKLDEMSGVGQKMRIMFALWTACSLASLALPGMSGFVSELMVFTGFV 414

Query: 372 SVHTAWGVFMLVLILLAGI 390
           +       F +V+  LA I
Sbjct: 415 TDEVYTLPFRVVMASLAAI 433


>NU4C_PROM0 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 531

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 49/199 (24%), Positives = 84/199 (42%), Gaps = 9/199 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P+  HA  A  +++ +G 
Sbjct: 234 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPV-AHAQFAPLLIV-LGV 291

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 292 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 351

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  VGA    T T  L ++ G+G+++                 P +SG+ SE  +    V
Sbjct: 352 FFLVGATYDRTKTLKLDEMSGVGQKMRIMFALWTACSLASLALPGMSGFVSELMVFTGFV 411

Query: 372 SVHTAWGVFMLVLILLAGI 390
           +       F +V+  LA I
Sbjct: 412 TDEVYTLPFRVVMASLAAI 430


>NU4C1_SYNJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 526

 Score = 51.2 bits (121), Expect = 2e-08
 Identities = 45/169 (26%), Positives = 66/169 (39%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A + A  P+S ++    +   G  L+     +   A +  A VL V GA   
Sbjct: 229 PLHTWLPDAHSEASAPISMILAGVLLKMGGYGLIRLNVGILSEAHVYFAPVLAVLGAVNI 288

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           +  AL A  Q  LKR LA+S+++                       +  H    + LF  
Sbjct: 289 VYGALAALGQNYLKRRLAYSSIAHMGFVLIGIAAFTELGLNGALLQMISHGLIAAVLFFL 348

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            G     T T  L +LGGL K++P                P +SG+  E
Sbjct: 349 TGITYERTHTLALDKLGGLAKQMPKAFALFTAGSLASLALPGMSGFVGE 397


>NU4M_PROWI RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 523

 Score = 50.8 bits (120), Expect = 3e-08
 Identities = 53/237 (22%), Positives = 91/237 (38%), Gaps = 9/237 (3%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP 166
           +I +E V +  F++IG    + +  +AA++  L T                 TGT  +  
Sbjct: 174 YIFFESVLIPMFIIIGVWGSRERKIRAAYQFFLYTLFGSVLMLLAILLIYFQTGTLDIEM 233

Query: 167 FFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAA 226
            +  + D                     K   +P+  WLPEA        ++I +  +  
Sbjct: 234 LY--LSDFSETRQCILWLAFFASFAV--KVPMVPVHIWLPEAHVEAPTAGSVILAGILLK 289

Query: 227 AGVFLVLRL-FPLFEHAPLALAVVLWVGAFTALIAALVATA-QYDLKRLLAWSTVSQXXX 284
            G +  LR   PLF +A +    +++  +  A++     T  Q DLK+++A+S+V+    
Sbjct: 290 LGTYGFLRFSIPLFPYACIYFTPLIYTMSVIAIVYTSCTTIRQIDLKKIIAYSSVAHMNF 349

Query: 285 XXXXXXXXXXXXXXFHLTV---HATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
                           + +   H     ALFL VG L     TR LR   G G+ +P
Sbjct: 350 VTIGLFSQNTQGIEGSILLMISHGLVSPALFLCVGVLYDRHKTRLLRYYSGCGQTMP 406


>NU4C1_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 527

 Score = 50.8 bits (120), Expect = 3e-08
 Identities = 45/197 (22%), Positives = 83/197 (42%), Gaps = 7/197 (3%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLF---EHAPLALAVVLWVGAFT 256
           PL  WLP+A    T  + ++ +  +   G + +LR+        HA  A  +V+ +G   
Sbjct: 229 PLHTWLPDAHGEATAPAHMLLAGILLKMGGYALLRMNAGMLPDAHAVFAPVLVI-LGVVN 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 288 IVYAALTSFAQRNLKRKIAYSSISHMGFVLIGMASFTDIGLSGAVLQMISHGLIGASLFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSV 373
            VGA    T T  L ++GG+G+++                 P +SG+ +E  +     + 
Sbjct: 348 LVGATYDRTHTLILDEMGGVGQKMKKVFAMWTTCSMASLALPGMSGFVAEVMVFIGFATS 407

Query: 374 HTAWGVFMLVLILLAGI 390
                 F +++I L+ +
Sbjct: 408 DAYSSTFKVLVIFLSAV 424


>NU4C1_SYNJB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 528

 Score = 50.8 bits (120), Expect = 3e-08
 Identities = 44/169 (26%), Positives = 65/169 (38%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A + A  P+S ++    +   G  L+     +   A +  A VL V G    
Sbjct: 229 PLHTWLPDAHSEASAPISMILAGVLLKMGGYGLIRMNVGMLSEAHVYFAPVLAVLGVVNI 288

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           +  AL A  Q  LKR LA+S+++                       +  H    + LF  
Sbjct: 289 IYGALAAFGQNHLKRRLAYSSIAHMGFVLIGISAFTELGINGAVLQMISHGLIAAVLFFL 348

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            G     T T  L +LGGL K++P                P +SG+  E
Sbjct: 349 TGITYERTHTLALDKLGGLAKQMPKAFALFTAGSLASLALPGMSGFVGE 397


>Y1309_METJA RecName: Full=Uncharacterized protein MJ1309;
          Length = 481

 Score = 50.1 bits (118), Expect = 5e-08
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 7/183 (3%)

Query: 215 VSALI--HSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKR 272
           +SA++  +S  +    + ++L+LF   ++   A AV++ +G    +   ++A  Q D K+
Sbjct: 231 ISAMLQTYSKFVLVGLMIIILKLFNGLDYFASAHAVLIALGVLAMVFGVVMALLQSDYKK 290

Query: 273 LLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQ 329
           LLA+  +SQ                    FH   H  +KSALFL    +    G+ +L +
Sbjct: 291 LLAYHAISQGGYVATGLALGTPLGIVAGIFHAINHVIYKSALFLGAYIVSCKRGS-NLHK 349

Query: 330 LGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAG 389
           LGGL   +P                P  +G+ S+  L + A+ V+    + ++++I+  G
Sbjct: 350 LGGLLPLMPSVAFMVLCAKLAISGIPPFNGFQSKWMLAQAAMQVNMP-EIAIIMIIVSIG 408

Query: 390 IYI 392
            ++
Sbjct: 409 TFV 411


>NU4M_BRACM RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 495

 Score = 50.1 bits (118), Expect = 5e-08
 Identities = 69/233 (29%), Positives = 100/233 (42%), Gaps = 9/233 (3%)

Query: 111 EGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQ 170
           E V +  F++IG    + +  +AA++  L T                 TGTT L    Q 
Sbjct: 147 ESVPIPMFIIIGVWGSRQRKIKAAYQFFLYTXXXXXXXXXXXXXXXFQTGTTDL----QI 202

Query: 171 VEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA-MAAPTPVSALIHSATMAAAGV 229
                                   K   +P+  WLPEA + APT  S ++    +     
Sbjct: 203 SLTTEFSERRQIFLWIASFASFAVKVPMVPVHIWLPEAHVEAPTAGSVILAGIPLKFGTH 262

Query: 230 FLVLRLFPLFEHAPLALAVVLW-VGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXX 288
             +    P+F  A L     ++ + A   +  +L  + Q DLK+++A+S+V+        
Sbjct: 263 GFLRFSIPMFPEATLCSTPFIYTLSAIAIIYTSLTTSRQIDLKKIIAYSSVAHMNLVTIG 322

Query: 289 XXXXXXXXXX---FHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
                          +  H    SALFL VG L     TR +R  GGL   +P
Sbjct: 323 MFSPNIQGIGGSILPMLSHGLVPSALFLCVGVLYDRHKTRLVRYYGGLVSTMP 375


>NU4C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 548

 Score = 50.1 bits (118), Expect = 5e-08
 Identities = 44/172 (25%), Positives = 74/172 (43%), Gaps = 9/172 (5%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P   HA  A  +++ +G 
Sbjct: 242 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNCELLPA-AHAQFAPLLIV-LGV 299

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 300 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSVLGSSGAMLQMISHGLIGASL 359

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           F  VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 360 FFLVGATYDRTHTLLLDEMGGIGQKMRIMFALWTVCALASLALPGMSGFVSE 411


>NU4C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 551

 Score = 50.1 bits (118), Expect = 5e-08
 Identities = 45/170 (26%), Positives = 70/170 (41%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFT 256
           +PL  WLP+A    T PV  L+    +   G  L+     +   A    A +L V G   
Sbjct: 250 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALMRFNAEMLPDAHAQFAPLLVVLGVVN 309

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + AAL + AQ +LKR +A+S++S                       +  H    ++LF 
Sbjct: 310 IIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSALGTSGAMLQMISHGLIGASLFF 369

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            VGA    T T  L ++GG+G+++                 P +SG+ SE
Sbjct: 370 LVGATYDRTHTLQLDEMGGVGQKMRIMFALWTVCSLASLALPGMSGFVSE 419


>NU4C_PROM9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 534

 Score = 50.1 bits (118), Expect = 5e-08
 Identities = 48/199 (24%), Positives = 83/199 (41%), Gaps = 9/199 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +PL  WLP+A    T    ++ +  +   G + +LR    L P   HA  A  +++ +G 
Sbjct: 237 VPLHTWLPDAHGEATAPVHMLLAGILLKMGGYALLRFNAQLLPA-AHAQFAPLLIV-LGV 294

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSAL 311
              + AAL + AQ +LKR +A+S++S                       +  H    ++L
Sbjct: 295 VNIIYAALTSFAQRNLKRKIAYSSISHMGFVLIGIGSFSSLGTSGAMLQMVSHGLIGASL 354

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
           F  VGA    T T  L ++ G+G+++                 P +SG+ SE  +    V
Sbjct: 355 FFLVGATYDRTKTLKLDEMSGVGQKMRIMFALWTACSLASLALPGMSGFVSELMVFTGFV 414

Query: 372 SVHTAWGVFMLVLILLAGI 390
           +       F +++  LA I
Sbjct: 415 TDEVYTLPFRVIMASLAAI 433


>NU4C_GLOVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 4;
          Length = 526

 Score = 50.1 bits (118), Expect = 5e-08
 Identities = 44/169 (26%), Positives = 67/169 (39%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMAAPT-PVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    T PV  L+    +   G  L+      F  A    A +L V G    
Sbjct: 226 PLHTWLPDAHGEATAPVHMLLAGILLKMGGYALIRMNVGFFPEATQLFAPLLIVLGIVNI 285

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + AAL +  Q +LKR +A+S++S                       +  H    ++LF  
Sbjct: 286 IYAALTSFGQRNLKRKIAYSSISHMGFVLIGVGSLSEIGMGGAMLQMISHGLIGASLFFL 345

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           VGA    T T  L ++GG+  ++P                P +SG+ +E
Sbjct: 346 VGATYDRTHTLILSEMGGIAPKMPKIFAMFTACSMASLALPGMSGFVAE 394


>NU2C_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 521

 Score = 49.7 bits (117), Expect = 6e-08
 Identities = 67/275 (24%), Positives = 105/275 (38%), Gaps = 18/275 (6%)

Query: 17  ALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMAD 76
           ALA+  LS A A + L W T            D L      +V   A    + S+ Y+  
Sbjct: 45  ALAITGLSAAIAVLTLQWNTSQNLAFLGGFNGDNLSIVFRGIVLLSAAVTILLSIRYVEQ 104

Query: 77  EAGRQRFFAW--LSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAA 134
                  F    L+  +G M            F++ E + ++S++L G      ++ +AA
Sbjct: 105 SGTSLGEFITILLTASLGGMFLSGANELVTI-FVSLETLSISSYLLTGYMKRDPRSNEAA 163

Query: 135 FKALLMTRXXXXXXXXXXXXXXXITG-TTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI 193
            K LL+                 + G  TQLP   +++ +                    
Sbjct: 164 LKYLLIGAASSAIFLYGVSLLYGLAGGETQLPAIAEKLGEAQPLALLISLIFVIAGIAF- 222

Query: 194 GKSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
            K + +P   W P+    +PTP+ A + S    AAG  L +RL      A        W 
Sbjct: 223 -KISAVPFHQWTPDVYEGSPTPIVAFL-SVGSKAAGFALAIRLLVTAYPA----LTEQWH 276

Query: 253 GAFTAL------IAALVATAQYDLKRLLAWSTVSQ 281
             FTAL      +  +VA AQ  +KRLLA+S+++Q
Sbjct: 277 FVFTALAILSLVLGNVVALAQTSMKRLLAYSSIAQ 311


>NU2C_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 521

 Score = 49.7 bits (117), Expect = 6e-08
 Identities = 67/275 (24%), Positives = 105/275 (38%), Gaps = 18/275 (6%)

Query: 17  ALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMAD 76
           ALA+  LS A A + L W T            D L      +V   A    + S+ Y+  
Sbjct: 45  ALAITGLSAAIAVLTLQWNTSQNLAFLGGFNGDNLSIVFRGIVLLSAAVTILLSIRYVEQ 104

Query: 77  EAGRQRFFAW--LSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAA 134
                  F    L+  +G M            F++ E + ++S++L G      ++ +AA
Sbjct: 105 SGTSLGEFITILLTASLGGMFLSGANELVTI-FVSLETLSISSYLLTGYMKRDPRSNEAA 163

Query: 135 FKALLMTRXXXXXXXXXXXXXXXITG-TTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXI 193
            K LL+                 + G  TQLP   +++ +                    
Sbjct: 164 LKYLLIGAASSAIFLYGVSLLYGLAGGETQLPAIAEKLGEAQPLALLISLIFVIAGIAF- 222

Query: 194 GKSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV 252
            K + +P   W P+    +PTP+ A + S    AAG  L +RL      A        W 
Sbjct: 223 -KISAVPFHQWTPDVYEGSPTPIVAFL-SVGSKAAGFALAIRLLVTAYPA----LTEQWH 276

Query: 253 GAFTAL------IAALVATAQYDLKRLLAWSTVSQ 281
             FTAL      +  +VA AQ  +KRLLA+S+++Q
Sbjct: 277 FVFTALAILSLVLGNVVALAQTSMKRLLAYSSIAQ 311


>NUON2_RHIME RecName: Full=NADH-quinone oxidoreductase subunit N 2; 
                  EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N 2;
          Length = 479

 Score = 49.3 bits (116), Expect = 8e-08
 Identities = 49/204 (24%), Positives = 82/204 (40%), Gaps = 6/204 (2%)

Query: 79  GRQRFFAWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKAL 138
           GR  ++  L F +  M            ++  E + L ++VL G    + ++ +AA K +
Sbjct: 105 GRSEYYVLLLFALVGMMIMASAIDLLSIYVGLELMVLCTYVLTGFLRKERRSNEAALKYV 164

Query: 139 LMTRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQ 198
           ++                 +TGTTQL    + V                     + K   
Sbjct: 165 ILGAVSTAIFLYGVSLIYGLTGTTQLDRMAEAVSGGPLDPALLLAVVFIVAGL-VFKIGA 223

Query: 199 LPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLF--PLFEHAPLALAVVLWVGAF 255
           +P   W+P+    APT ++A + S    AAG  ++LR+F  PL E A             
Sbjct: 224 VPFHMWVPDVYEGAPTTITAFM-SVAPKAAGFAVILRVFLNPLVE-ASNXXXXXXXXXXX 281

Query: 256 TALIAALVATAQYDLKRLLAWSTV 279
           T  + + VA  Q + KRLLA+S++
Sbjct: 282 TMALGSFVALVQDNFKRLLAYSSI 305


>NU4C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 501

 Score = 49.3 bits (116), Expect = 8e-08
 Identities = 44/174 (25%), Positives = 70/174 (40%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV- 252
           K   +PL  WLP+        + ++ +  +   G + ++R+   L  HA    A  L V 
Sbjct: 224 KLPMVPLHTWLPDTHGEAHYSTCMLLAGILLKMGGYGLIRINMELLSHAHSIFAPWLVVI 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           GA   + +AL + +Q +LKR +A+S+VS                       +  H    +
Sbjct: 284 GAIQIVYSALTSLSQLNLKRRIAYSSVSHMGFVLIGIGSTTDIGVNGAILQMISHGLIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF S G     T T  L Q+GG+   +P                P LSG+ +E
Sbjct: 344 ALFFSAGVTYDRTRTLFLNQMGGIATSIPKIFTMFSSFSMASLALPGLSGFVAE 397


>NU2C_CHAGL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 500

 Score = 49.3 bits (116), Expect = 8e-08
 Identities = 45/180 (25%), Positives = 73/180 (40%), Gaps = 17/180 (9%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K + +P   W P+    +PTPV A + S     AG+ L +R+    FP  E+    L  +
Sbjct: 226 KISAVPFHQWTPDVYEGSPTPVVAFL-SVASKTAGLALTIRIIATIFPYLENEWQFLLQI 284

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           L     T ++  LVA  Q  +KR+LA+S++SQ                   L     +  
Sbjct: 285 L--ACLTMIVGNLVAITQTSMKRMLAYSSISQAGYLMIGIISSTNDGYASSLVYMLIY-- 340

Query: 310 ALFLSVGA------LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            +F+++GA          TGT  +R   GL  + PW               P  +G++ +
Sbjct: 341 -IFMNLGAFGCVILFGLRTGTDQIRDFSGLYLKDPWLASCLTIFLLSLGGIPPFAGFFGK 399


>NU4C2_THEEB RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 533

 Score = 48.9 bits (115), Expect = 1e-07
 Identities = 60/196 (30%), Positives = 90/196 (45%), Gaps = 5/196 (2%)

Query: 200 PLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA-VVLWVGAFTA 257
           PL  WLP+A   A  PVS ++    +   G  L+     +   A +  A V++ +G    
Sbjct: 229 PLHTWLPDAHGEASAPVSMVLAGVLLKMGGYGLIRFNLQMLPDAHIYFAPVLIALGVVNI 288

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           +  AL A  Q +LKR LA+S++S                       +  H    + LF  
Sbjct: 289 IYGALTAFGQENLKRRLAYSSISHMGFVXXXXXXXXXXXXXXXMLQMLSHGLIAAVLFFL 348

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
            G     T T  + ++ G+ + +P T              P +SG+ SE  +     +  
Sbjct: 349 AGVTYDRTHTLAMEKMSGIAQSMPKTFALFTASSMASLALPGMSGFVSELTVFLGLTNSD 408

Query: 375 TAWGVFMLVLILLAGI 390
                F + +I LA +
Sbjct: 409 AYSTTFKVGVIFLAAV 424


>NU4C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 48.5 bits (114), Expect = 1e-07
 Identities = 52/241 (21%), Positives = 96/241 (39%), Gaps = 26/241 (10%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           K   +P+  WLP+        + ++ +  +   G + ++R+   +  HA    +  ++ V
Sbjct: 224 KLPAIPVHTWLPDTHGEAHYSTCMLLAGILLKMGGYALIRINMNMLPHAHALFSPWLIGV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AAL + AQ +LKR +A+S+VS                       +  H    +
Sbjct: 284 GVVNIIYAALTSFAQRNLKRKIAYSSVSHMGFVLIGIGSLSEAGLNGAMLQMISHGLIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE------ 363
           +LF   G     T T  L ++GGL   +P T              P +SG+++E      
Sbjct: 344 SLFFLAGTTYDRTRTLVLEEMGGLATFMPKTFALFTACSLASLALPGMSGFFAELLVFLG 403

Query: 364 -------EELLRQAVSVHTAWGVFM---LVLILLAGIYIGRAAMATFGLAPQAVMPANRR 413
                      R  ++V  A G+ +    +L +L  ++ GR+        P+A++ A  R
Sbjct: 404 LVTSEAYSPTFRAIMTVFEAIGILLTPIYLLSMLRQLFYGRSIG-----RPKALIDAGPR 458

Query: 414 E 414
           E
Sbjct: 459 E 459


>NU4C2_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 2;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 2;
          Length = 561

 Score = 48.5 bits (114), Expect = 1e-07
 Identities = 48/201 (23%), Positives = 74/201 (36%), Gaps = 5/201 (2%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV- 252
           K A  PL  WLP+A   A  PVS ++    +   G  L+     +   A +  A VL + 
Sbjct: 226 KLAVFPLHTWLPDAHGEASAPVSMILAGVLLKMGGYGLIRLNLEMLSDAHVYFAPVLAIL 285

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    +   L +  Q ++KR LA+S+V+                       +  H    +
Sbjct: 286 GVVNIVYGGLNSFGQSNMKRRLAYSSVAHMGFVLLGIASFTDLGISGALLQMISHGLIAA 345

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
            LF   G       T  L ++GGLG+ +P                P +SG+ SE  +   
Sbjct: 346 VLFFLAGVTYDRLHTLALDEMGGLGQVMPKIFALFTISAMASLALPGMSGFASELMVFVG 405

Query: 370 AVSVHTAWGVFMLVLILLAGI 390
             S       F  V + LA +
Sbjct: 406 VTSSDIYSSTFCTVTVFLAAV 426


>NU4C1_SYNY3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4-1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, subunit D-1;
          Length = 525

 Score = 48.5 bits (114), Expect = 1e-07
 Identities = 41/169 (24%), Positives = 71/169 (42%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    T  + ++ +  +   G + +LR+   +   A    A VL + G    
Sbjct: 228 PLHTWLPDAHGEATAPAHMLLAGILLKMGGYALLRMNVGMLPDAHAVFAPVLVILGVVNI 287

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + AA  + AQ +LKR +A+S++S                       +  H    ++LF  
Sbjct: 288 IYAAFTSFAQRNLKRKIAYSSISHMGFVLIGLASFTDLGMSGAMLQMISHGLIGASLFFM 347

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           VGA    T T  L ++GG+G+++                 P +SG+ +E
Sbjct: 348 VGATYDRTHTLMLDEMGGIGQKMKKGFAMWTACSLASLALPGMSGFVAE 396


>NU4C1_SYNP6 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 533

 Score = 48.1 bits (113), Expect = 2e-07
 Identities = 55/202 (27%), Positives = 78/202 (38%), Gaps = 8/202 (3%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV- 252
           K +  PL  WLP+A   A  P S L+    +   G  L+     L   A +  A VL V 
Sbjct: 225 KLSIFPLHTWLPDAHGEANAPGSMLLAGILLKMGGYALIRFNVQLLPEAHIRFAPVLAVL 284

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    +  AL A AQ +LKR +A+S++S                       +  H     
Sbjct: 285 GIVNIIYGALNAFAQDNLKRKIAYSSISHMGFVLLGIAAYNSLGLNGALLQMLSHGLIXX 344

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE-EELLR 368
                 G     T T  + Q+ GL K++P T              P +SG+ SE    L 
Sbjct: 345 XXXXXXGVAYERTHTLQIPQISGLAKQMPITFALFTVTAMASLALPGMSGFVSELTVFLG 404

Query: 369 QAVSVHTAWGVFMLVLILLAGI 390
              SV+++   F  V ILLA +
Sbjct: 405 FTDSVYSSG--FRTVTILLAAV 424


>NU4C1_SYNE7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 533

 Score = 48.1 bits (113), Expect = 2e-07
 Identities = 55/202 (27%), Positives = 78/202 (38%), Gaps = 8/202 (3%)

Query: 195 KSAQLPLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV- 252
           K +  PL  WLP+A   A  P S L+    +   G  L+     L   A +  A VL V 
Sbjct: 225 KLSIFPLHTWLPDAHGEANAPGSMLLAGILLKMGGYALIRFNVQLLPEAHIRFAPVLAVL 284

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    +  AL A AQ +LKR +A+S++S                       +  H     
Sbjct: 285 GIVNIIYGALNAFAQDNLKRKIAYSSISHMGFVLLGIAAYNSLGLNGALLQMLSHGLIXX 344

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE-EELLR 368
                 G     T T  + Q+ GL K++P T              P +SG+ SE    L 
Sbjct: 345 XXXXXXGVAYERTHTLQIPQISGLAKQMPITFALFTVTAMASLALPGMSGFVSELTVFLG 404

Query: 369 QAVSVHTAWGVFMLVLILLAGI 390
              SV+++   F  V ILLA +
Sbjct: 405 FTDSVYSSG--FRTVTILLAAV 424


>NU2C_STAPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 513

 Score = 47.8 bits (112), Expect = 2e-07
 Identities = 46/178 (25%), Positives = 72/178 (40%), Gaps = 13/178 (7%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K + +P   W P+    +PTPV A + S    AAG+ L  RL    FP  E       +V
Sbjct: 238 KISAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGLALATRLLSIVFPAIEDQ---WHIV 293

Query: 250 LWVGAFTALIAA-LVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHA 305
           L + AF +++   L+A  Q  +KR+LA+S++SQ                     +L ++ 
Sbjct: 294 LEIVAFLSMVFGNLIAATQTSMKRMLAYSSISQAGYLLIAILVGNSDGYASMITYLLIYT 353

Query: 306 TFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
                 F         TGT  +R   GL  + PW               P L+G++ +
Sbjct: 354 FMNLGAFACTVIFGLRTGTDQIRDYTGLYLKDPWLAFALSICLLSLAGMPPLAGFFGK 411


>NU4C3_ANAVT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 3;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 3;
          Length = 537

 Score = 47.4 bits (111), Expect = 3e-07
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    +   ++I +  +   G + ++R    +   A +  A VL + G    
Sbjct: 230 PLHTWLPDAHGEASAPGSMILAGVLLKMGGYALIRFNIEMLPDAHVYFAPVLAILGVVNI 289

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           +  A  A AQ +LKR LA+S+++                       +  H    ++LF  
Sbjct: 290 VYGACCAFAQTNLKRRLAYSSIAHMGFVLIGLASYTEIGVSGAVLQMVSHGLVAASLFFL 349

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            G     T T  + ++GG+GK +P T              P +SG+  E
Sbjct: 350 TGVTYERTHTLLMDKMGGIGKVMPKTFALYTAGAMASLALPGMSGFVGE 398


>NU4C1_ANASP RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 538

 Score = 47.4 bits (111), Expect = 3e-07
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    +   ++I +  +   G + ++R    +   A +  A VL + G    
Sbjct: 231 PLHTWLPDAHGEASAPGSMILAGVLLKMGGYALIRFNMEMLPDAHVYFAPVLAILGVVNI 290

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           +  A  A AQ +LKR LA+S+++                       +  H    ++LF  
Sbjct: 291 VYGACCAFAQTNLKRRLAYSSIAHMGFVLIGLASYTEIGVSGAVLQMVSHGLVAASLFFL 350

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            G     T T  + ++GG+GK +P T              P +SG+  E
Sbjct: 351 TGVTYERTHTLLMDKMGGIGKIMPKTFALYTAGAMASLALPGMSGFVGE 399


>NU2C_CYAP7 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 514

 Score = 47.4 bits (111), Expect = 3e-07
 Identities = 59/179 (32%), Positives = 85/179 (47%), Gaps = 15/179 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K + +P   W P+    +PTPV A + S    AAG  L +RL         AL    W  
Sbjct: 227 KISAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAIRLLV----TAFALVSEQWHF 281

Query: 254 AFTAL------IAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVH 304
            FTAL      +  +VA AQ  +KR+LA+S++ Q                    F+L ++
Sbjct: 282 IFTALAILSMVLGNVVALAQTSMKRMLAYSSIGQAGFVMIGLTANSDAGYSSMIFYLLIY 341

Query: 305 ATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
                  F+ +      TGT  + +  GL ++ P                P L+G++ +
Sbjct: 342 LFMNLGAFICIILFALRTGTDQISEYSGLYQKDPXXXXXXXXXXXXXXXXPPLAGFFGK 400


>NUOM_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 553

 Score = 47.0 bits (110), Expect = 4e-07
 Identities = 45/205 (21%), Positives = 80/205 (39%), Gaps = 9/205 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVL 250
           K+   P   WLP+A    TP +A++  A M   G F +LR    LFP  + +     +++
Sbjct: 262 KAPLWPFHRWLPDAAVESTPATAVLMMAVMDKVGTFGMLRYCLQLFP--DPSTYFRPLIV 319

Query: 251 WVGAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATF 307
            +              Q D+ RL+A++++S                      ++  H   
Sbjct: 320 TLXXXXXXXXXXXXXXQTDMMRLIAYTSISHFGFIIAGIFVMTTQGQSGSTLYMLNHGLS 379

Query: 308 KSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
            +A+FL  G L    G+R +   GG+ K  P                P L+ + SE  +L
Sbjct: 380 TAAVFLIAGFLIARRGSRSIADYGGVQKVAPILAGTFMVSAMATVSLPGLAPFISEFLVL 439

Query: 368 RQAVSVHTAWGVFMLVLILLAGIYI 392
               S +     F +  ++L+ +Y+
Sbjct: 440 LGTFSRYWLAAAFGVTALVLSAVYM 464


>NU2C_ACAM1 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 521

 Score = 47.0 bits (110), Expect = 4e-07
 Identities = 85/329 (25%), Positives = 122/329 (37%), Gaps = 20/329 (6%)

Query: 18  LAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADE 77
           LA+  L+     +   W    P     S  AD L      ++A   L   + SV Y+   
Sbjct: 46  LAIASLAACLYLLYTQWDQANPIGFLGSFNADNLSIVFRAIIALSTLVTILMSVRYIEQS 105

Query: 78  AGRQRFF--AWLSFFVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAF 135
                 F    L+  VG M            FI+ E + +AS+++ G     +++ +AA 
Sbjct: 106 GSSIGEFMTVLLTATVGAMFLCGAEELVMI-FISLETLSIASYLMTGYMKRDSRSNEAAL 164

Query: 136 KALLM-TRXXXXXXXXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIG 194
           K LL+                      T L      + D                     
Sbjct: 165 KYLLIGAASSAVFXXXXXXXXXXXXXKTHLDDIALALTDTSKSLALVISLVFVIASVSF- 223

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K A +P   W P+    +PTPV A + S    AAG  L +RL            V  W  
Sbjct: 224 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAIRLLT----QAFPNLVEQWQF 278

Query: 254 AFTAL------IAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVH 304
            FTAL      +  +VA AQ  +KR+LA+S++ Q                    F+L ++
Sbjct: 279 IFTALAILSMVLGNVVAIAQTSMKRMLAYSSIGQAGFVMIGLVIGTEAGYASMVFYLLIY 338

Query: 305 ATFKSALFLSVGALERATGTRDLRQLGGL 333
                  F  V      TGT ++    GL
Sbjct: 339 LFMNLGAFTCVILFSLRTGTDEIGDYAGL 367


>NUON_MYCTU RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 531

 Score = 46.6 bits (109), Expect = 5e-07
 Identities = 42/170 (24%), Positives = 67/170 (39%), Gaps = 10/170 (5%)

Query: 200 PLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW-VGAFTA 257
           P  +W+P+    APTP++  + +AT  AA   L+  ++            VLW +   T 
Sbjct: 269 PFHSWIPDVYQGAPTPITGFMAAATKVAAFGALLRVVYVALPPLHDQWRPVLWAIAILTM 328

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            +  + A  Q ++KR+LA+S+V+                     F+L  ++      F  
Sbjct: 329 TVGTVTAVNQTNVKRMLAYSSVAHVGFILTGVIADNPAGLSATLFYLVAYSFSTMGAFAI 388

Query: 315 VGALERATGT-----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSG 359
           VG +  A G+      DL    GLG+R P                PL SG
Sbjct: 389 VGLVRGADGSAGSEDADLSHWAGLGQRSPIVGVMLSMFLLAFAGIPLTSG 438


>NUON_MYCBO RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 531

 Score = 46.6 bits (109), Expect = 5e-07
 Identities = 42/170 (24%), Positives = 67/170 (39%), Gaps = 10/170 (5%)

Query: 200 PLTAWLPEA-MAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW-VGAFTA 257
           P  +W+P+    APTP++  + +AT  AA   L+  ++            VLW +   T 
Sbjct: 269 PFHSWIPDVYQGAPTPITGFMAAATKVAAFGALLRVVYVALPPLHDQWRPVLWAIAILTM 328

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
            +  + A  Q ++KR+LA+S+V+                     F+L  ++      F  
Sbjct: 329 TVGTVTAVNQTNVKRMLAYSSVAHVGFILTGVIADNPAGLSATLFYLVAYSFSTMGAFAI 388

Query: 315 VGALERATGT-----RDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSG 359
           VG +  A G+      DL    GLG+R P                PL SG
Sbjct: 389 VGLVRGADGSAGSEDADLSHWAGLGQRSPIVGVMLSMFLLAFAGIPLTSG 438


>NU4C1_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 534

 Score = 46.6 bits (109), Expect = 5e-07
 Identities = 63/225 (28%), Positives = 98/225 (43%), Gaps = 21/225 (9%)

Query: 200 PLTAWLPEAMA-APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A + A  PVS ++    +   G  L+     +   A +  A +L V G    
Sbjct: 230 PLHTWLPDAHSEASAPVSMILAGVLLKMGGYGLIRLNMEMLPDAHIRFAPLLIVLGIVNI 289

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           +  AL A  Q +LKR LA S++S                       +  H    +ALF  
Sbjct: 290 VYGALTAFGQTNLKRRLASSSISHMGFVLVGIASFTDLGMNGAVLQMLSHGFIAAALFFL 349

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR------ 368
            G     T T  + ++ G+ + +P                P +SG+ SE  +        
Sbjct: 350 SGVTYERTHTLMMDEMSGIARLMPKXXXXXXXXXXXSLALPGMSGFVSELTVFLGLSNSD 409

Query: 369 ------QAVSVH-TAWGVFM---LVLILLAGIYIGRAAMATFGLA 403
                 +A+++  TA GV +    +L +L  ++ G+ + A   LA
Sbjct: 410 AYSYGFKAIAIFLTAVGVILTPIYLLSMLREVFYGKGSQAPLSLA 454


>NU2C_NEPOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 506

 Score = 46.6 bits (109), Expect = 5e-07
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 10/182 (5%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGT-TQLP 165
           F++ E +GLAS++L G      ++ +A+ K LL+                 I+G   +L 
Sbjct: 141 FVSLETLGLASYLLTGYMKRDVRSNEASLKYLLVGAASSGLFLYGISWMYGISGGHMELN 200

Query: 166 PFFQQVEDXXXXXXXXXXXXXXXXXXXIG-KSAQLPLTAWLPEA-MAAPTPVSALIHSAT 223
                +                     +G K A  P   W P+    +PTPV A + S  
Sbjct: 201 SIAHAIVSLDETKTTTCALALVLMTVGVGFKVAAAPFHQWTPDVYQGSPTPVVAFL-SVG 259

Query: 224 MAAAGVFLVLR----LFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTV 279
             AAG  L +R    LFP F      +  +L +   + ++   +A  Q  LKR+L +S+V
Sbjct: 260 SKAAGFILAVRMCTTLFPSFNTEWHLIFTILSI--LSMIVGNFIAVTQTSLKRMLGYSSV 317

Query: 280 SQ 281
            Q
Sbjct: 318 GQ 319


>NU4M_ASTPE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 460

 Score = 46.2 bits (108), Expect = 7e-07
 Identities = 39/133 (29%), Positives = 55/133 (41%), Gaps = 13/133 (9%)

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEH------APLALAVVLWVGAFTA 257
           WLP+A        ++I +A +   G + +LR  PLF        +P A A  +W     A
Sbjct: 217 WLPKAHVEAPIAGSMILAAILLKLGGYGLLRTIPLFYTPSSLLLSPPATAFCIW----GA 272

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTV---HATFKSALFLS 314
           LI +++   Q DLK L+A+S+V                     LT+   H    SALF  
Sbjct: 273 LITSIICLRQTDLKALIAYSSVGHMSIVASGIFSLSLWGINGALTLMIAHGLISSALFCL 332

Query: 315 VGALERATGTRDL 327
              L    GTR L
Sbjct: 333 ANLLYERNGTRTL 345


>NU4C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 512

 Score = 45.8 bits (107), Expect = 9e-07
 Identities = 58/174 (33%), Positives = 86/174 (49%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           K    PL  WLP+        + ++ +  +   G +  +R+   L  HA    A  ++ +
Sbjct: 224 KLPAFPLHTWLPDTHGEAHYSTCMLLAGILLKMGGYGFIRVNMELLPHAHTVFAPWLVAL 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           GA+  + AALV+ AQ +LKR +A+S+VS                       +  H    +
Sbjct: 284 GAYQIVYAALVSFAQRNLKRRIAYSSVSHMGFXXXXXXXXXXXXXXXXMLQMISHGLIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           +LF   G     T T  LR++G    ++P                P +SG+ SE
Sbjct: 344 SLFFLAGTSYDRTRTLMLREMGAWASQMPKMFAMFTTCAMASLALPGMSGFVSE 397


>NU4C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 499

 Score = 45.8 bits (107), Expect = 9e-07
 Identities = 40/170 (23%), Positives = 69/170 (40%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFT 256
           +P   WLP+        + ++ +  +   G + ++R+   L  HA    A  ++ VGA  
Sbjct: 228 IPFHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSFFAPWLVIVGAIQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL + +Q +LKR +A+S+VS                       +  H    ++LF 
Sbjct: 288 IVYAALTSLSQRNLKRRIAYSSVSHMGFVLIGIGSITNLGLNGAILQMISHGLIGASLFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             G     T T  L Q+GG+G  +P                P +SG+ +E
Sbjct: 348 LAGISYDRTRTLVLDQMGGIGNSMPKIFTLFTSCSMASLALPGMSGFIAE 397


>NU2C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 501

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 4/90 (4%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPL-FEHAPLALAVVLWV 252
           K + +P   W P+    +PTPV A + S     AG+ L++RLF + F   P     +L +
Sbjct: 226 KLSLVPFHQWTPDVYEGSPTPVVAFL-SVASKIAGLALLVRLFNIVFPFLPNQWHSLLEI 284

Query: 253 GAFTALIAA-LVATAQYDLKRLLAWSTVSQ 281
            A  ++I   LVA  Q  +KR+LA+S++SQ
Sbjct: 285 SAICSMILGNLVAITQTSMKRMLAYSSISQ 314


>HYFF_ECOLI RecName: Full=Hydrogenase-4 component F;       
           EC=1.-.-.-;
          Length = 526

 Score = 45.1 bits (105), Expect = 2e-06
 Identities = 62/315 (19%), Positives = 108/315 (34%), Gaps = 21/315 (6%)

Query: 46  LAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQR--------FFAWLSFFVGMMXXX 97
           L  D LG     ++  I     +YS+ YM  E             ++ +   F+  M   
Sbjct: 70  LHIDGLGGLFLAILGVIGFLTGIYSIGYMRHEVAHGELSPVTLCDYYGFFHLFLFTMLLV 129

Query: 98  XXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLM----TRXXXXXXXXXXX 153
                    + A E   L+S  L+G + GQ  + +AA+K +++                 
Sbjct: 130 VTSNNLIVMWAAIEATTLSSAFLVGIY-GQRSSLEAAWKYIIICTVGVAFGLFGTVLVYA 188

Query: 154 XXXXITGTTQLPPFFQQV--EDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAA 211
               +    ++  F+ +V  +                      K+   P+ AWLP+A + 
Sbjct: 189 NAASVMPQAEMAIFWSEVLKQSSLLDPTLMLLAFVFLLIGFGTKTGLFPMHAWLPDAHSE 248

Query: 212 PTPVSALIHSATMAAAGVFLVLRLFPLFEHA---PLALAVVLWVGAFTALIAALVATAQY 268
                                +R + +   A        ++L  G  +  +AA     Q 
Sbjct: 249 APXXXXXXXXXXXXXXXXXXXIRYYIIICQAIGSDFPNRLLLIFGMLSVAVAAFFILVQR 308

Query: 269 DLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLSVGALERATGTR 325
           D+KRLLA+S+V                       H+  H+  K+ LF   G +    GTR
Sbjct: 309 DIKRLLAYSSVENMGLVAVELGIGGPLGIFAALLHILNHSLAKTLLFCGSGNVLLKYGTR 368

Query: 326 DLRQLGGLGKRLPWT 340
           DL  + G+ K +P+T
Sbjct: 369 DLNVVCGMLKIMPFT 383


>NU4M_METSE RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 491

 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 50/237 (21%), Positives = 87/237 (36%), Gaps = 9/237 (3%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP 166
           +I +EG+ +  F+LIG    + +  +A++     T                  GTT    
Sbjct: 143 YILFEGILIPMFLLIGVWGSREEKVRASYYFFFYTFVGSVFMLLGIFQLYSSVGTTD--- 199

Query: 167 FFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEA-MAAPTPVSALIHSATMA 225
            +Q + +                     K  Q+P   WLP+A + AP   S ++    + 
Sbjct: 200 -YQALLNIELPISTQKWIFAGFFLSLAVKIPQVPFHIWLPQAHVEAPVSGSVILAGILLK 258

Query: 226 AAGVFLVLRLFPLFEHAPLALA-VVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ--- 281
             G   +   +P+   A    A  V+ +     +  +L    Q DLKRL+A+S+V+    
Sbjct: 259 LGGYGFLRFTWPILPAATEYFAPFVIMLSVIAIIYGSLTTCRQVDLKRLIAYSSVAHMGL 318

Query: 282 XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLP 338
                            F +  H    SALF++V  L     TR ++   G+   +P
Sbjct: 319 VTLGLFTHTIEGLVAAVFMMLAHGLVSSALFIAVTYLYERHHTRLIKYYRGITFSMP 375


>NU2C_PROMT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 520

 Score = 44.7 bits (104), Expect = 2e-06
 Identities = 57/180 (31%), Positives = 85/180 (47%), Gaps = 10/180 (5%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP 166
           F++ E + +AS++L G     +++ +AA K LL+                 I+G+T L  
Sbjct: 148 FVSLETLSVASYLLSGYLKRDSRSSEAALKYLLVGSAAAAVFLYGASLLYGISGSTNLKE 207

Query: 167 FFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAM-AAPTPVSALIHSATMA 225
                                       K A +P   W P+    +PTPV A + S    
Sbjct: 208 IGXXXXXXXXXXXXXXXVFVLSTVAF--KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSK 264

Query: 226 AAGVFLVLRL----FPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           AAG  L +R+    F  F+     L  VL V   +  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 265 AAGFALAIRILVGCFSAFDTQWKLLFTVLAV--LSMSLGNVVALAQKSMKRMLAYSSIGQ 322


>NU2C_SYNP2 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 526

 Score = 44.3 bits (103), Expect = 3e-06
 Identities = 60/184 (32%), Positives = 85/184 (46%), Gaps = 25/184 (13%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLF-----PLFEHAPLALAV 248
           K + +P   W P+    +PTPV A + S    AAG  L +RL      P+ E        
Sbjct: 227 KISAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAIRLLVTVFNPVSEE------- 278

Query: 249 VLWVGAFTAL------IAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXF 299
             W   FTAL      +  +VA AQ  +KR+LA+S+++Q                    F
Sbjct: 279 --WHFIFTALAILSMVLGNVVALAQTSMKRMLAYSSIAQAGFVMIGLVAGTDAGYSSVIF 336

Query: 300 HLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSG 359
           +L V+       F  V      TGT  + +  GL ++ P                P L+G
Sbjct: 337 YLLVYLFMNLGAFTCVILFSLRTGTDQIAEYAGLYQKDPXXXXXXXXXXXXXXXIPPLAG 396

Query: 360 YWSE 363
           ++ +
Sbjct: 397 FFGK 400


>NU2C_MARPO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 501

 Score = 44.3 bits (103), Expect = 3e-06
 Identities = 32/90 (35%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFP-LFEHAPLALAVVLWV 252
           K + +P   W P+    +PTPV A + S T   AG+ L  R+   LF  +P    + L +
Sbjct: 226 KLSLVPFHQWTPDIYEGSPTPVVAFL-SVTSKIAGLALATRILNILFSFSPNEWKIFLEI 284

Query: 253 GAFTALIAA-LVATAQYDLKRLLAWSTVSQ 281
            A  ++I   LVA  Q  +KR+LA+S++SQ
Sbjct: 285 LAILSMILGNLVAITQTSMKRMLAYSSISQ 314


>NU4C_PHYPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 501

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 40/169 (23%), Positives = 68/169 (40%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFTA 257
           PL  WLP+        + ++ +  +   G + ++R+   L  HA    A  ++ VGA   
Sbjct: 229 PLHTWLPDTHGEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHSIFAPWIVAVGAIQI 288

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           + AAL++ +Q +LKR +A+S++S                       +  H    +ALF  
Sbjct: 289 VYAALISFSQRNLKRRIAYSSISHMGFVLIGIGSMTDVGLNGAILQMVSHGLIGAALFFL 348

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            G     T T  L Q+GG    +P                P +SG+ +E
Sbjct: 349 AGITYDRTRTLFLDQMGGTAIYMPKIFTMFSSFSMASLALPGMSGFVAE 397


>NU4C_IPOPU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 503

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 41/174 (23%), Positives = 69/174 (39%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWV 252
           KS  LPL  WLP+        + ++ +  +   G + ++R+   LF HA  L    ++ V
Sbjct: 224 KSPILPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELFPHAHSLFSPYLVIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AAL +  Q +LKR +A+S+VS                       +  H    +
Sbjct: 284 GTIQMIYAALTSLGQRNLKRRIAYSSVSHMGFIIIGIGSMTDTGLNGALLQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+  ++P                P +SG+ +E
Sbjct: 344 ALFFLAGTTYDRIRLVYLDEMGGIAIQMPKIFTMFSSFSMASLALPGMSGFVAE 397


>NU2C_PROMM RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 523

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L LRL    F  F++    L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALALRLLVGCFGAFDNQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L V + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAVLSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_PROM3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 523

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L LRL    F  F++    L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALALRLLVGCFGAFDNQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L V + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAVLSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_CYAP8 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 517

 Score = 43.9 bits (102), Expect = 3e-06
 Identities = 59/179 (32%), Positives = 83/179 (46%), Gaps = 15/179 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K + +P   W P+    +PTPV A + S    AAG  L +RL         A     W  
Sbjct: 227 KISAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAIRLLV----TAFASVGEEWHF 281

Query: 254 AFTAL------IAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVH 304
            FTAL      +  +VA AQ  +KR+LA+S++ Q                    F+L V+
Sbjct: 282 VFTALAILSMVLGNVVALAQTSMKRMLAYSSIGQAGFVMIGLVAGTDAGYSSMVFYLLVY 341

Query: 305 ATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
                  F  +      TGT  + +  GL ++ P                P L+G++ +
Sbjct: 342 LFMNLGAFACIILFSLRTGTDKISEYAGLYQKDPXXXXXXXXXXXXXXXXPPLAGFFGK 400


>NUON_PSEAE RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 486

 Score = 43.5 bits (101), Expect = 4e-06
 Identities = 55/226 (24%), Positives = 83/226 (36%), Gaps = 17/226 (7%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW-- 251
           K + +P   W P+    AP PVSA +  AT +   VF V  L  LF+ AP AL   L   
Sbjct: 217 KLSLVPFHLWTPDVYEGAPAPVSAFL--ATASKVAVFAV--LLRLFQIAPAALDNQLLNI 272

Query: 252 ----VGAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVH 304
               +   + L   L+A  Q ++KRLL +S+++                      +L  +
Sbjct: 273 SLSVIAVASILFGNLLALTQSNIKRLLGYSSIAHLGYLLVALIASKGMAVEAVGVYLATY 332

Query: 305 ATFKSALFLSVGALERATGTRD---LRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYW 361
                  F  +  +      RD   L +  GL  R P                PL +G+ 
Sbjct: 333 VLTSLGAFGVITLMSTPYSGRDADALFEYRGLFWRRPVLTAVMTVMMLSLAGIPLTAGFI 392

Query: 362 SEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATFGLAPQAV 407
            +  ++   V  H  W +  LVL    G+Y     M T  L    +
Sbjct: 393 GKFYVIAVGVESHLWWLIGALVLGSAIGLYYYLRVMVTLFLVEPGI 438


>NU4M_ACACA RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 497

 Score = 43.5 bits (101), Expect = 4e-06
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 5/144 (3%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR-LFPLFEHAPLALAVVLWVGAFTAL 258
           P   WLPEA      V ++I +  +   G + +LR + P+F  A      +++      +
Sbjct: 237 PFHIWLPEAHVEAPTVGSVILAGVLLKLGTYGLLRFVIPIFCDATYFFLPLVYTLCLLGI 296

Query: 259 IAALVAT-AQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           I    +T  Q DLK+++A+++VS                     F +  H    S LF  
Sbjct: 297 IYTCCSTIRQVDLKKVIAYASVSHMSFVILGLFTSNIQGIGGSVFLMLSHGIVSSGLFFC 356

Query: 315 VGALERATGTRDLRQLGGLGKRLP 338
           +G +     TR LR   GL   +P
Sbjct: 357 IGCVYDRYKTRILRYYSGLVSTMP 380


>NU2C_TRIEI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 526

 Score = 43.5 bits (101), Expect = 4e-06
 Identities = 45/153 (29%), Positives = 61/153 (39%), Gaps = 23/153 (15%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K + +P   W P+    +PTPV A + S    AAG  L +RL    FPL           
Sbjct: 228 KISAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAIRLLVTAFPLVSEQ------- 279

Query: 250 LWVGAFTAL------IAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFH 300
            W   FTAL      +  +VA AQ  +KRLLA+S++ Q                    F+
Sbjct: 280 -WHFVFTALAILSMVLGNVVALAQTSMKRLLAYSSIGQAGFVMIGLLANTEAGYASMIFY 338

Query: 301 LTVHATFKSALFLSVGALERATGTRDLRQLGGL 333
           L V+       F  V      TGT  + +  GL
Sbjct: 339 LLVYLFMNLGGFTCVILFSLRTGTDQISEYAGL 371


>NU2C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 496

 Score = 43.5 bits (101), Expect = 4e-06
 Identities = 54/180 (30%), Positives = 89/180 (49%), Gaps = 17/180 (9%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K + +P   W P+    +PTPV A +   + A A + L +R+    FP+ E    ++  +
Sbjct: 226 KLSLVPFHRWSPDVYEGSPTPVVAFLSIISKAGA-LALTIRISDIIFPILEQDSNSILQI 284

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           L +   + ++  L+A  +  +KR+L +S+++Q                   L V+  F  
Sbjct: 285 LAI--LSMIVGNLLAMVETSMKRILTYSSIAQAGYLLIGIVAGRNNGYA-SLLVYMIFY- 340

Query: 310 ALFLSVGALE------RATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            LF+++GA          TGT  +R   GL  + PW               P L+G++ +
Sbjct: 341 -LFMNIGAFSCIILFGLRTGTDQIRDYTGLYTKDPWXXXXXXXXXXXXXGIPPLTGFFGK 399


>NU2C_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 513

 Score = 42.7 bits (99), Expect = 7e-06
 Identities = 108/344 (31%), Positives = 160/344 (46%), Gaps = 18/344 (5%)

Query: 33  TWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYSVPYMADEAGRQ--RFFA-WLSF 89
           TW    P     +   D L      ++A       + S+ Y+ ++AG     F A  L+ 
Sbjct: 62  TWDNPKPVAFLGAFEGDNLSIVFRAIIALSTASTVLMSIRYV-EQAGTSLAEFLAIMLTA 120

Query: 90  FVGMMXXXXXXXXXXXXFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLM-TRXXXXXX 148
            +G M            FI+ E + ++S+++ G      ++ +AA K LL+         
Sbjct: 121 TLGGMFLSGASELVMI-FISLEMLSISSYLMTGYMKRDPRSNEAALKYLLIGASSSAIFX 179

Query: 149 XXXXXXXXXITGTTQLPPFFQQVEDXXXXXXXXXXXXXXXXXXXIG-KSAQLPLTAWLPE 207
                        T L    Q++ D                      K + +P   W P+
Sbjct: 180 XXXXXXXXXXXXETSLSAIAQKLTDVNGGQSXXXXXXXXXXXXXXXXKISAVPFHQWTPD 239

Query: 208 AM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVVLWVGAFTALIAAL 262
               +PTPV A + S    AAG  L +RL    F L       + + L +   + ++  +
Sbjct: 240 VYEGSPTPVVAFL-SVGSKAAGFALAIRLLVTVFGLVSEQWRFIFIALAI--LSMILGNV 296

Query: 263 VATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALE 319
           VA AQ  +KR+LA+S++ Q                    F+L ++       F  V    
Sbjct: 297 VALAQTSMKRMLAYSSIGQAGFVMIGLTAGTDAGYSSMIFYLLIYLFMNLGAFACVILFA 356

Query: 320 RATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             TGT  + +  GL ++ P                P L+G++ +
Sbjct: 357 LRTGTDQIAEYSGLYQKDPXXXXXXXXXXXXXXXXPPLAGFFGK 400


>NU4M_STRPU RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 463

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 35/130 (26%), Positives = 58/130 (44%), Gaps = 7/130 (5%)

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAP---LALAVVLWVGAFTALIA 260
           WLP+A        ++I +A +   G + ++RL  LF       L+LA++++   + ALI 
Sbjct: 217 WLPKAHVEAPVAGSMILAAILLKIGGYGLMRLIALFSTISMNALSLALIVFC-TWGALIT 275

Query: 261 ALVATAQYDLKRLLAWSTV---SQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA 317
           +++   Q DLK L+A+S+V   S                    +  H    SALF     
Sbjct: 276 SVICVRQTDLKALIAYSSVGHMSIVAAAIFSETSWGMNGALMLMVAHGLVSSALFSLANT 335

Query: 318 LERATGTRDL 327
           +   +GTR L
Sbjct: 336 VYERSGTRTL 345


>NU4C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 497

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 43/196 (21%), Positives = 75/196 (38%), Gaps = 5/196 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFTA 257
           P   WLP+        + ++ +  +   G + ++R+   L  HA   L   ++  GA   
Sbjct: 230 PFHTWLPDTHGEAHYSTCMLLAGVLLKMGGYGLIRINLELLTHAHFLLGSWMMLFGAIQI 289

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + A+L++ +Q + KR +A+S++S                       +  H    +ALF  
Sbjct: 290 IYASLISMSQRNFKRRIAYSSISHMGFVTIGIGSFTETGINGAILQMISHGLIGAALFFL 349

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
            G     T T  L QLGG    +P                P +SG+ SE  +    V+ +
Sbjct: 350 AGTCYDRTRTYLLDQLGGAAISMPKLFTMFSTLSLASLALPGMSGFVSELLVFLGVVTSN 409

Query: 375 TAWGVFMLVLILLAGI 390
                F   + +L GI
Sbjct: 410 QYSFAFKAGITVLEGI 425


>NU2C_SYNS9 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 523

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L LR+    F  F+     L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALALRILVGCFGAFDDQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L V + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAVLSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_SYNPW RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 523

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L LRL    F  F+     L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALALRLLVGCFGSFDTQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L V + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAVLSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_PAUCH RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           organellar chromatophore;         EC=1.6.5.-;AltName:
           Full=NAD(P)H dehydrogenase, chain 2;
          Length = 512

 Score = 42.4 bits (98), Expect = 1e-05
 Identities = 59/179 (32%), Positives = 91/179 (50%), Gaps = 7/179 (3%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITG-TTQLP 165
           F++ E + ++S++L G     A++ +AA K LL+                 +TG +T L 
Sbjct: 137 FVSLETLSVSSYLLAGYMKQDARSSEAALKYLLVGSATAAVFLYGASLLYGLTGGSTNLD 196

Query: 166 PFFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAM-AAPTPVSALIHSATM 224
                ++                      K A +P   W P+    APTP+ A + S   
Sbjct: 197 AVALALQSSDTPXXXXXXXXXXXXXXX--KIAAVPFHQWTPDVYEGAPTPIVAFL-SVGS 253

Query: 225 AAAGVFLVLRLF-PLFEHAPLALAVVLWVGAFTALIAA-LVATAQYDLKRLLAWSTVSQ 281
             AG  L LRL    FE   +    +  + A  +++   +VA +Q  +KR+LA+S++ Q
Sbjct: 254 KTAGFALALRLLVGCFESFDIQWKFLFSLLAILSMVLGNIVALSQTSMKRMLAYSSIGQ 312


>NU4C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 512

 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 39/174 (22%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWVG 253
           K    PL  WLP+        + ++ +  +   G + ++R+   +  +A L  A  L   
Sbjct: 223 KLPAFPLHTWLPDTHGEAHYSTCMLLAGILLKMGGYALIRINMDMLPNAHLIFAPFLXXX 282

Query: 254 AFTALI-AALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKS 309
                  AAL + AQ ++KR +A+S+VS                       +  H    +
Sbjct: 283 XXXXXXYAALTSFAQRNMKRKIAYSSVSHMGFVLIGIGSLTNLGLSGAVLQMISHGLIGA 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           +LF   G     T T  L  +GG+ K++P T              P +SG+ +E
Sbjct: 343 SLFFLAGTTYDRTRTLILEDMGGVAKKMPKTFAMFTTCSLASLALPGMSGFVAE 396


>NU2C_SYNS3 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 523

 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L LRL    F  F+     L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALALRLLVGCFGSFDTQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L + + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAILSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_SYNPX RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 523

 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 34/92 (36%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L LR+    F  F+     L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALALRILVGCFGAFDGQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L V + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAVLSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_CYAA5 RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 521

 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 42/149 (28%), Positives = 60/149 (40%), Gaps = 15/149 (10%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K + +P   W P+    +PTPV A + S    AAG  L +RL         +  V  W  
Sbjct: 227 KISAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAIRLLV----TAFSSIVDEWHL 281

Query: 254 AFTAL------IAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVH 304
            FTAL      +  +VA AQ  +KR+LA+S++ Q                    F+L V+
Sbjct: 282 IFTALAILSMVLGNVVALAQTSMKRMLAYSSIGQAGFVMIGLTAGTDAGYSSMVFYLLVY 341

Query: 305 ATFKSALFLSVGALERATGTRDLRQLGGL 333
                  F  V      TGT  + +  GL
Sbjct: 342 LFMNLGAFSGVILFSLRTGTDQISEYAGL 370


>NU2C_CHLAT RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 511

 Score = 42.0 bits (97), Expect = 1e-05
 Identities = 45/180 (25%), Positives = 73/180 (40%), Gaps = 17/180 (9%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVV 249
           K A  P   W P+    +PTPV A + S    AAG+ L  R    LFP   +    L  V
Sbjct: 226 KVAAAPFHQWAPDVYEGSPTPVVAFL-SVGSKAAGLALATRILTTLFPYLTNEWHLLFQV 284

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           L   + + ++  L+A +Q  +KR+L +S+VSQ                   L     +  
Sbjct: 285 L--ASLSMILGNLIAISQTSMKRMLGYSSVSQAGFLMIGLIAGNPNGYSSMLVYMLLY-- 340

Query: 310 ALFLSVGALE------RATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            +F+++GA           GT  +R   GL ++ P+               P L+G++ +
Sbjct: 341 -IFMNLGAFACIILFGLKAGTDQIRDYAGLYRKDPFLVFCFSISLLSLGGIPPLAGFFGK 399


>NU4M_MYXGL RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 458

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 23/78 (29%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPL-FEHAPLALAVVLWVGAFTALIAAL 262
           WLP+A    T   ++  +A M   G + ++RL  + F H+P    +++ +  + A++ + 
Sbjct: 215 WLPKAHVEATIAGSMTLAALMLKLGGYGMIRLSLMPFLHSPKLSLILISIALWGAVMTSF 274

Query: 263 VATAQYDLKRLLAWSTVS 280
           +   Q DLK L+A+S+VS
Sbjct: 275 ICLRQTDLKALIAYSSVS 292


>NU4C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 507

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 36/174 (20%), Positives = 68/174 (39%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV- 252
           K    P+  WLP+        + ++ +  +   G + ++R+   +  +A +  A  L + 
Sbjct: 223 KLPAFPVHTWLPDTHGEAHYSTCMLLAGILLKMGGYALIRINMNMLPNAHIYFAPYLAII 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AAL + AQ ++KR +A+S++S                       +  H    +
Sbjct: 283 GVINIIYAALTSFAQRNIKRKIAYSSISHMGFVLIGISSFTDIGLSGAMLQMVSHGLIGA 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           +LF   G     T T  L  +GG+ K +P                P +SG+ +E
Sbjct: 343 SLFFLAGTTYDRTRTLILEDMGGIAKYMPKIFAMFTTCSLASLALPGMSGFVAE 396


>MNHD1_STAHJ RecName: Full=Na+/H+-antiporter, MnhD subunit;
          Length = 499

 Score = 41.6 bits (96), Expect = 2e-05
 Identities = 36/174 (20%), Positives = 64/174 (36%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA--VVLWV 252
           K+   P+  WLP +             A +   GV+ +LR   LF H  ++ +       
Sbjct: 223 KAGAFPMYVWLPGSXXXXXXXXXXXXGALLTKVGVYAILRTLSLFFHNTMSFSHYXXXXX 282

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ--XXXXXXXXXXXXXXXXXFHLTVH-ATFKS 309
                   ++ A A  D K+++ ++ +                      + T+H    K+
Sbjct: 283 XXXXXXXGSVGAIAYDDTKKIIIYNIMIAVGVILVGVAMMNEAGIIGAIYYTIHDMLVKT 342

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALFL +G + + T +  L+  GGL K  P                P LSG++ +
Sbjct: 343 ALFLLIGVMYQITKSTSLKDFGGLIKHYPVLGWTFFIAALSLAGIPPLSGFYGK 396


>NU4C_CRYJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 499

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 39/180 (21%), Positives = 71/180 (39%), Gaps = 5/180 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWVGAFTA 257
           PL  WLP+        + ++ +  +   G + ++R+   L  HA  L    ++ +GA   
Sbjct: 229 PLHTWLPDTHGEAHYSTCMLLAGVLLKMGGYGLIRINMELLPHAHSLFSPWLIIIGAVQI 288

Query: 258 LIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
           + AAL +  Q +LKR +A+S++S                       +  H    +ALF  
Sbjct: 289 IYAALTSMGQRNLKRRIAYSSISHMGFVIIGIGSMTYTGLNGAILQMISHGLIGAALFFL 348

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVH 374
           VG       T  L ++GG+   +P                P +SG+ +E  +    ++ H
Sbjct: 349 VGTSYDRIRTLFLDEMGGIAIPIPKIFTMFSSFSMASLALPGMSGFVAEFMIFLGVITNH 408


>NU2C_PROMA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2;   
                EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase I,
           chain 2;
          Length = 524

 Score = 41.2 bits (95), Expect = 2e-05
 Identities = 33/92 (35%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRL----FPLFEHAPLALAVV 249
           K A +P   W P+    +PTPV A + S    AAG  L +R+    F  F+     L  V
Sbjct: 237 KIAAVPFHQWTPDVYEGSPTPVVAFL-SVGSKAAGFALAVRILVGCFNAFDDQWKLLFTV 295

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L V + T  +  +VA AQ  +KR+LA+S++ Q
Sbjct: 296 LAVLSMT--LGNVVALAQTSMKRMLAYSSIGQ 325


>NU2C_ADICA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 498

 Score = 40.8 bits (94), Expect = 3e-05
 Identities = 32/92 (34%), Positives = 48/92 (52%), Gaps = 8/92 (8%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLF----PLFEHAPLALAVV 249
           K +  P   W P+    +PTPV A   S T   A + L  RLF    P F +    +AV 
Sbjct: 226 KLSLFPFHQWTPDVYEGSPTPVVAFF-SVTSKVAALALFTRLFGLIFPYFSNE-WHVAVG 283

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQ 281
           L +  F+ ++  L+A  Q  +KR+LA+S++SQ
Sbjct: 284 L-LATFSMILGNLIAVTQRSVKRMLAFSSISQ 314


>NU4C_NYMAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 40.4 bits (93), Expect = 4e-05
 Identities = 39/174 (22%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLW-V 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  L  V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRVNMELLPHAHSIFSPWLMIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AAL +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAALTSPGQRNLKKRIAYSSVSHMGFIIIGISSITDAGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G        R L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTSYDRIRLRYLNEMGGIAILMPRIFTMFSSFSMASLALPGMSGFVAE 397


>NU2M_ARATH RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           2;
          Length = 499

 Score = 40.4 bits (93), Expect = 4e-05
 Identities = 49/204 (24%), Positives = 79/204 (38%), Gaps = 12/204 (5%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFL-VLRLFPLFEHAPLALAVVLWV 252
           K   +P   W P+    +PTPV+A +  A   +  +F  +LR+F    +      +  + 
Sbjct: 240 KITAVPFHMWAPDIYEGSPTPVTAFLSIAPKIS--IFANILRVFIYGSYGATLQQIFFFC 297

Query: 253 GAFTALIAALVATAQYDLKRLLAWST---VSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
              + ++ AL A AQ  +KRLLA+S+   V                     + ++A    
Sbjct: 298 SIASMILGALAAMAQTKVKRLLAYSSIGHVGYICIGFSCGTIEGIQSLLIGIFIYALMTM 357

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
             F  V AL R T  + +  LG L K  P                P L+G+ S+  L   
Sbjct: 358 DAFAIVLAL-RQTRVKYIADLGALAKTNPILAITFSITMFSYAGIPPLAGFCSKFYLFFA 416

Query: 370 AVSVHTAWGVFMLVLILLAGIYIG 393
           A+      G + L L+ +    IG
Sbjct: 417 ALGC----GAYFLALVGVVTSVIG 436


>NQO14_PARDE RecName: Full=NADH-quinone oxidoreductase chain 14;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I,
           chain 14;AltName: Full=NDH-1, chain 14;
          Length = 499

 Score = 40.4 bits (93), Expect = 4e-05
 Identities = 39/203 (19%), Positives = 77/203 (37%), Gaps = 6/203 (2%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALA-VVLWV 252
           K + +P   W P+    +PTPV+A   +A   AA   +   +F  F H     + +V  +
Sbjct: 217 KVSAVPFHMWTPDVYEGSPTPVTAFFATAPKVAAMALIARLVFDAFGHVIGDWSQIVAAL 276

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
              +  + ++    Q ++KRL+A+S+++                      ++T++A    
Sbjct: 277 AVMSMFLGSIAGIGQTNIKRLMAYSSIAHMGFALVGLAAGTAIGVQNMLLYMTIYAVMNI 336

Query: 310 ALFLSVGALER-ATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLR 368
             F  + ++ER      DL  L       P                P   G++++  +L 
Sbjct: 337 GTFAFILSMERDGVPVTDLAALNRFAWTDPVKALAMLVLMFSLAGVPPTLGFFAKFGVLT 396

Query: 369 QAVSVHTAWGVFMLVLILLAGIY 391
            AV     W   + V+  + G +
Sbjct: 397 AAVDAGMGWLAVLGVIASVIGAF 419


>NUON_RHOCA RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 478

 Score = 40.0 bits (92), Expect = 5e-05
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K + +P   W P+    +PTPV+A   +A   AA   +   +   F   P     +L   
Sbjct: 216 KVSAVPFHMWTPDVYEGSPTPVTAFFATAPKLAAMALIARVVHDAFGQVPGEWGQILAAL 275

Query: 254 AFTAL-IAALVATAQYDLKRLLAWSTVS 280
           A  ++ + A+    Q D+KRL+A+S++S
Sbjct: 276 ALASMYLGAIAGIGQRDIKRLMAYSSIS 303


>NU4C_ANGEV RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 497

 Score = 40.0 bits (92), Expect = 5e-05
 Identities = 39/169 (23%), Positives = 66/169 (39%), Gaps = 5/169 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFTA 257
           P   WLP+        + ++ +  +   G + ++R+   L  HA    A  ++  GA   
Sbjct: 229 PFHTWLPDTHGEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHAIFAPWMVMFGAVQI 288

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + A+L++  Q +LKR +A+S+VS                       +  H    +ALF  
Sbjct: 289 VYASLISLNQRNLKRRIAYSSVSHMGFVMIGIGSLTNIGLNGAILQMISHGLTGAALFFL 348

Query: 315 VGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
            G     T T  L QLGG+   +P                P +SG+ +E
Sbjct: 349 AGTSYDRTRTLFLDQLGGIAISMPKLFTMFSIFSLASLALPGMSGFVAE 397


>NU4C1_MICAN RecName: Full=NAD(P)H-quinone oxidoreductase chain 4 1;
                   EC=1.6.5.-;AltName: Full=NAD(P)H dehydrogenase
           I, chain 4 1;
          Length = 527

 Score = 40.0 bits (92), Expect = 5e-05
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV-GAFTA 257
           PL  WLP+A    T  + ++ +  +   G + +LR+   +   A    A VL + G    
Sbjct: 230 PLHTWLPDAHGEATAPAHMLLAGILLKMGGYALLRMNMGMLPDAHAVFAPVLVILGVVNI 289

Query: 258 LIAALVATAQYDLKRLLAWSTVS 280
           + AAL + AQ +LKR +A+S++S
Sbjct: 290 IYAALTSFAQRNLKRKIAYSSIS 312


>NU2C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 496

 Score = 40.0 bits (92), Expect = 5e-05
 Identities = 73/271 (26%), Positives = 114/271 (42%), Gaps = 20/271 (7%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITG-TTQLP 165
           F+A E + L+S++L G      ++ +A  K LLM                 ++G   QL 
Sbjct: 137 FVASECLALSSYLLSGYTKRDVRSNEAMMKYLLMGGASSSILVYGFSLPYGLSGGEIQLR 196

Query: 166 PFFQQVEDXXXXXXXXXXXXXXXXXXXIG-KSAQLPLTAWLPEAM-AAPTPVSALIHSAT 223
                + +                   IG K + +P   W P+    +PTPV A   S T
Sbjct: 197 GMVNGLINMQMYNSAGVSIAMIFILVGIGFKLSLVPFHQWTPDVYEGSPTPVVAFF-SVT 255

Query: 224 MAAAGVFLVLRLFPLF-------EHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAW 276
              A + L  RLF +         H PL +  +L     + ++  L+A  Q  +KR+LA+
Sbjct: 256 SKVAALALATRLFHILFSSLSNEWHLPLEILAIL-----SMILGNLIAVTQTSMKRMLAY 310

Query: 277 ----STVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALERATGTRDLRQLGG 332
                                      ++ ++       F  + +    TGT ++R   G
Sbjct: 311 XXXXXXXXXXXXXXXXDSDNGYASMITYMLIYIFMNLGTFACITSFGLRTGTDNIRDYAG 370

Query: 333 LGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           L ++ P                P L+G++ +
Sbjct: 371 LYRKDPIXXXXXXXXXXXXGGIPPLAGFFGK 401


>NU2C_MESVI RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 502

 Score = 40.0 bits (92), Expect = 5e-05
 Identities = 40/150 (26%), Positives = 65/150 (43%), Gaps = 17/150 (11%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVV 249
           K A  P   W P+    APTPV A + S +  AAG+ L  R    LFP   +    +  +
Sbjct: 226 KIAAAPFHQWAPDVYEGAPTPVVAFL-SVSSKAAGLMLATRIMTILFPYIINEWHNIFQI 284

Query: 250 LWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           L +   +  I  ++A +Q ++KR+L +S+++Q                   L     +  
Sbjct: 285 LAI--LSMAIGNIIAISQTNIKRMLGYSSIAQAGFLLVGLLAGNINGYSSMLVYMLIY-- 340

Query: 310 ALFLSVGA------LERATGTRDLRQLGGL 333
            LF+++GA          TG+  +R  GGL
Sbjct: 341 -LFMNLGAFACVILFSLKTGSDQIRDYGGL 369


>NU4C_POPTR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 39.7 bits (91), Expect = 6e-05
 Identities = 43/198 (21%), Positives = 80/198 (40%), Gaps = 8/198 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA  +  + ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLSHAHSIFSSWLIIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           GA   + AA  ++ Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GAIQIIYAASTSSGQKNLKKRIAYSSVSHMGFTIIGICSISDMGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           ALF   G          L ++GG+   +P                P +SG+++E   L  
Sbjct: 344 ALFFLSGTSYDRIRLVYLDEMGGMATLMPKIFMMFSILSLASLALPGMSGFFAE---LVV 400

Query: 370 AVSVHTAWGVFMLVLILL 387
              + TA   F++  IL+
Sbjct: 401 FFGIITAKKYFLMPKILI 418


>NU4C_POPAL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 39.7 bits (91), Expect = 6e-05
 Identities = 43/198 (21%), Positives = 80/198 (40%), Gaps = 8/198 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA  +  + ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLSHAHSIFSSWLIIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           GA   + AA  ++ Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GAIQIIYAASTSSGQKNLKKRIAYSSVSHMGFTIIGIYSISDMGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           ALF   G          L ++GG+   +P                P +SG+++E   L  
Sbjct: 344 ALFFLSGTSYDRIRLVYLDEMGGMATLMPKIFMMFSILSLASLALPGMSGFFAE---LVV 400

Query: 370 AVSVHTAWGVFMLVLILL 387
              + TA   F++  IL+
Sbjct: 401 FFGIITAKKFFLMPKILI 418


>NU4M_PARLI RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 464

 Score = 39.3 bits (90), Expect = 8e-05
 Identities = 36/141 (25%), Positives = 61/141 (43%), Gaps = 7/141 (4%)

Query: 204 WLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPL---ALAVVLWVGAFTALIA 260
           WLP+A        ++I +A +   G + ++RL  LF    L   +LA++ +  ++ AL+ 
Sbjct: 218 WLPKAHVEAPVAGSMILAAILLKLGGYGLIRLINLFATISLNSLSLALITFC-SWGALVT 276

Query: 261 ALVATAQYDLKRLLAWSTV---SQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGA 317
           +++   Q DLK L+A+S+V   S                    +  +    S LF     
Sbjct: 277 SIICVRQTDLKALIAYSSVGHMSIVAAAIFSSTNWGTNGALILMIAYGLVSSDLFSLANT 336

Query: 318 LERATGTRDLRQLGGLGKRLP 338
           +   +GTR L    GL   LP
Sbjct: 337 VYERSGTRTLAITRGLKTILP 357


>NU4C_HUPLU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 502

 Score = 38.9 bits (89), Expect = 1e-04
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 5/140 (3%)

Query: 200 PLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFTA 257
           PL  WLP+        + ++ +  +   G + ++R+   L  HA    A  ++ VGAF  
Sbjct: 231 PLHTWLPDTHGEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHSIFAPWLVIVGAFQI 290

Query: 258 LIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFLS 314
           + AA ++++Q + KR +A+S++S                       +  H    +A F  
Sbjct: 291 VYAASISSSQRNSKRRIAYSSISHMGFVLIGIGSATNIGLNGAILQMISHGLIGAAPFSL 350

Query: 315 VGALERATGTRDLRQLGGLG 334
            G     T T  L Q+GG+G
Sbjct: 351 AGTSYDRTRTPFLDQMGGIG 370


>NU4C_NUPAD RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 37/174 (21%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLMIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAASTSLGQRNLKKRIAYSSVSHMGFIIIGISSITDAGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G        R L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTSYDRIRLRYLNEMGGIAILMPRIFTMFSSFSMASLALPGMSGFVAE 397


>NU4C_LOTJA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 497

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 37/174 (21%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV- 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   LF HA       L + 
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELFSHAHSIFCPWLMIL 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G+   + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GSIQIIYAASASLGQRNLKKRIAYSSVSHMGFLIIGIGSISDTGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+++E
Sbjct: 344 ALFFLSGTSYDRLRLLYLDEMGGMALPMPKIFTVFTILSMASLALPGMSGFFAE 397


>NU4C_EUCGG RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 501

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 45/170 (26%), Positives = 74/170 (43%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFT 256
           +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ VGA  
Sbjct: 229 IPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLIIVGAIQ 288

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL +  Q +LK+ +A+S+VS                       +  H    +ALF 
Sbjct: 289 IIYAALTSPGQRNLKKRIAYSSVSHMXXXXXXXXXXTDTGLNGAILQIISHGFIGAALFF 348

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             G          L ++GG+   LP                P +SG+ +E
Sbjct: 349 LAGTSYDRIRLVYLDEMGGMAIHLPKIFTIFSILSMASLALPGMSGFLAE 398


>NU2C_ZYGCR RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 497

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 47/203 (23%), Positives = 76/203 (37%), Gaps = 19/203 (9%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVG 253
           K +  P   W P+    +PTPV A     + AAA       L  +F        V     
Sbjct: 222 KLSAFPFHQWTPDVYEGSPTPVVAFFSVGSKAAALALATRMLSIVFPSIESEWHVXXXXX 281

Query: 254 AFTALIAA-LVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALF 312
              ++I   L+A  Q  +KR+LA+S++SQ                   +T   T+   +F
Sbjct: 282 XXXSMIFGNLIAATQTSMKRMLAYSSISQAGYLIIGIVCGNIYGYTGMITYMVTY---IF 338

Query: 313 LSVGA------LERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEEL 366
           +++GA          TGT  +R   GL  + P                P L+G++ +  L
Sbjct: 339 MNLGAFGCVILFGLRTGTDQIRDYTGLYLKDPLLAFCLSVCLLSLAGIPPLAGFFGKLYL 398

Query: 367 LRQAVSVHTAW--GVFMLVLILL 387
                     W  G+++LV + L
Sbjct: 399 F------WCGWKSGLYLLVYVAL 415


>NU2C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 494

 Score = 38.5 bits (88), Expect = 1e-04
 Identities = 79/268 (29%), Positives = 121/268 (45%), Gaps = 14/268 (5%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITG-TTQLP 165
           F+A E   L S++L G      ++ +A  K LLM                 ++G   +L 
Sbjct: 135 FVALECFSLCSYLLSGYTKRDVRSNEATMKYLLMGGASSSILVYGFSWLYGLSGGEIELQ 194

Query: 166 PFFQQVEDXXXXXXXXXXXXXXXXXXXIG-KSAQLPLTAWLPEAM-AAPTPVSALIHSAT 223
                + +                   IG K + +P   W P+    +PTPV A + S T
Sbjct: 195 EVVNGLINTQMYNSPGILIALISIAVGIGFKLSLVPFHQWTPDVYEGSPTPVVAFL-SVT 253

Query: 224 MAAAGVFLVLRLFPL-FEHAPLALAVVLWVGAFTALIAA-LVATAQYDLKRLLAWSTVSQ 281
              A   L  R+F L F  +     ++L + A  ++I   L+A  Q  +KR+LA+S++  
Sbjct: 254 SKVAASALATRIFDLIFYFSSNEWHLLLEILAILSMILGNLIAITQTSMKRMLAYSSMXX 313

Query: 282 XXXXXXXXXXXXXXXXXFHLTVHATFKSALFLSVGALE------RATGTRDLRQLGGLGK 335
                              +  +  F   +F+++G           TGT ++R   GL  
Sbjct: 314 XXXXXXXXXXXDSKNGYASMITYMLF--YIFMNLGTFACIVLFGLRTGTDNIRDYAGLYT 371

Query: 336 RLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           + P                P L+G++ +
Sbjct: 372 KDPXXXXXXXXXXXXXGGIPPLAGFFGK 399


>NUON_RICTY RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 458

 Score = 38.1 bits (87), Expect = 2e-04
 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVL---RLFPLFEHAPLALAVVLW 251
           K A  PL  W+P+     +P+S++ +  + A  G+ +VL       +  + P+   ++  
Sbjct: 210 KLASSPLHFWIPDVYEG-SPISSITYFTSAAKIGMVIVLFNISKLIIGNYYPINYNLIKI 268

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTV 279
           +   + L  A  A  Q  LKRL+A+ST+
Sbjct: 269 IAILSMLFGAFGAIQQTSLKRLMAYSTI 296


>NU4M_USTMA RecName: Full=NADH-ubiquinone oxidoreductase chain 4;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           4;
          Length = 484

 Score = 38.1 bits (87), Expect = 2e-04
 Identities = 61/293 (20%), Positives = 99/293 (33%), Gaps = 14/293 (4%)

Query: 107 FIAWEGVGLASFVLIGQHHGQAKARQAAFKALLMTRXXXXXXXXXXXXXXXITGTTQLPP 166
           ++ +E V +  F+++G   G A   +AAF   L T                  G+T    
Sbjct: 134 YVFFESVLIPLFLIVGIWGGSATRVRAAFLLFLYTLFGSLFMLLAFLVIYYNVGSTD--- 190

Query: 167 FFQQVEDXXXXXXXXXXXXXXXXXXXIGKSAQLPLTAWLPEAMAAPTPVSALIHSATMAA 226
            FQ V                       K+  LP   WLP A A      ++I +  +  
Sbjct: 191 -FQVVSLSEINLESQKLLWLAVFISMAIKTPLLPFHVWLPRAHAEAPLAGSVILAGLILK 249

Query: 227 AGVFLVLRLFPLFEHAPLALA----VVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQX 282
              +  +R+  L +  P A +    +V  +   T + A+L    Q D K L+A+S++   
Sbjct: 250 LATYGYMRI--LIQFLPDATSYFSPLVQTIAVITLIYASLATLRQTDFKALVAYSSIGHM 307

Query: 283 XXXXXXXXXXXXXXXXFHLTV---HATFKSALFLSV-GALERATGTRDLRQLGGLGKRLP 338
                             L +   H     ALF+ V G L     TR +R   G+   +P
Sbjct: 308 AVVVLGLFSNTIQGIDGALLLSIAHGVVSPALFILVGGVLYDRYHTRTIRYYRGMTAYMP 367

Query: 339 WTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIY 391
                           PL + +  E   L  A   +  + V     I+L+  Y
Sbjct: 368 LFSIMFFVFTIFNAAVPLSANWAGEFLCLAGAFQRNPVFAVLGSTGIVLSAAY 420


>NU4C_PSINU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 498

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 46/145 (31%), Positives = 72/145 (49%), Gaps = 5/145 (3%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVL-WVGAFT 256
           LP   WLP+        + ++ +  +   G + ++R+   L  HA    + +L  +GA  
Sbjct: 228 LPFHTWLPDTHGEAHYSTCMLLAGILLKMGGYGLIRINMELLPHAHFLFSPLLVTMGAVQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
              A+L++ +  ++KR +A+S+VS                       +  H    +ALF 
Sbjct: 288 IAYASLISFSLPNIKRRIAYSSVSHMGFVXXXXXXXXXXXXNGAILQMISHGLIGAALFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLP 338
             G     T T  L QLGG+   +P
Sbjct: 348 LAGISYDRTQTLYLDQLGGIAVPMP 372


>NU2M_OENBE RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           2;
          Length = 488

 Score = 37.7 bits (86), Expect = 2e-04
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFL-VLRLFPLFEHAPLALAVVLWV 252
           K   +P   W P+    +PTPV+A +  A   +  +F  +LR+F    +      +  + 
Sbjct: 229 KITAVPFHMWAPDIYEGSPTPVTAFLSIAPKIS--IFANILRVFIYGSYGATLQQIFFFC 286

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTV 279
              + ++ AL A AQ  +KRLLA+S++
Sbjct: 287 SIASMILGALAAMAQTKVKRLLAYSSI 313


>NUOM_BUCBP RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 508

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 30/146 (20%), Positives = 59/146 (40%), Gaps = 5/146 (3%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAP-LALAVVLWVGAFT 256
           +P  +WLP+       +  +  S  +    ++ ++R   PLF H+               
Sbjct: 241 VPFHSWLPDFHCYSPVIGVVDISGILLKTSIYALMRFNIPLFPHSTEXXXXXXXXXXXXX 300

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
               A+V+  Q ++KR +A+ ++S                       L  ++   +ALFL
Sbjct: 301 XXYGAIVSLFQNNIKRFIAYVSISHMGFILIAIYSINQVAYQGAIIQLISYSLSTAALFL 360

Query: 314 SVGALERATGTRDLRQLGGLGKRLPW 339
             G + ++  T D+ ++GGL  +L W
Sbjct: 361 LSGHVFKSISTFDIDKMGGLWSKLRW 386


>NUOM_BUCAP RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 501

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 4/106 (3%)

Query: 238 LFEHAPLALA-VVLWVGAFTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXX 296
           LF +A    A + +++G  +    A VA +Q ++KRL+A+S++S                
Sbjct: 278 LFPNATEQFAPIAIFLGFLSMFYGAWVAFSQVNIKRLIAYSSISHMGLMLIAIYGGNEIS 337

Query: 297 XX---FHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPW 339
                  +  ++   SALF+  G + +   T+D+ ++GGL   + W
Sbjct: 338 FQGLIIQILSNSISTSALFILSGQIYKYLKTQDISEMGGLWTNIYW 383


>NU4C_TOBAC RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 49/174 (28%), Positives = 78/174 (44%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV- 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  L + 
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLMII 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AAL +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAALTSLGQRNLKKRIAYSSVSHMGFIIIGISSLTDTGLNGALLQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTTYDRIRLVYLDEMGGIAIPMPKMFTXXXXXXXXXXXXPGMSGFVAE 397


>NU4C_NICSY RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 49/174 (28%), Positives = 78/174 (44%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV- 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  L + 
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLMII 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AAL +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAALTSLGQRNLKKRIAYSSVSHMGFIIIGISSLTDTGLNGALLQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTTYDRIRLVYLDEMGGIAIPMPKMFTXXXXXXXXXXXXPGMSGFVAE 397


>NU4C_DRIGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 503

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 36/174 (20%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLMIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q + K+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAASTSPGQPNFKKRIAYSSVSHMGFTIIGIASITDMGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G      G   L ++GG+   +P                P +SG+++E
Sbjct: 344 ALFFLAGTSYDRIGLVYLDEMGGIAIPMPKIFTMFSSFSMASLALPGMSGFFAE 397


>NU2C_ANTFO RecName: Full=NAD(P)H-quinone oxidoreductase chain 2,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 2;
          Length = 500

 Score = 37.4 bits (85), Expect = 3e-04
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 7/148 (4%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLF-PLFEHAPLALAVVLWV 252
           K + +P   W P+    APT V A   S T   AG+ L  R+F  +F  +     ++L +
Sbjct: 225 KLSLVPFHQWTPDVYEGAPTSVIAFF-SVTSKIAGLALATRIFNTVFFSSLNEWHLILEI 283

Query: 253 GAFTALIAA-LVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLT---VHATFK 308
            A  ++I    +A  Q  +KR+LA+S++SQ                   +T    +    
Sbjct: 284 IAILSMILGNFIAITQTSMKRMLAYSSISQIGYFMIGVIAGDSNGYASMITYMLFYIFMN 343

Query: 309 SALFLSVGALERATGTRDLRQLGGLGKR 336
              F  +      TGT ++R   GL K+
Sbjct: 344 LGTFACITLFGLRTGTDNIRDYAGLYKK 371


>NU4C_PELHO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 37.0 bits (84), Expect = 4e-04
 Identities = 25/88 (28%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALA-VVLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    A  ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFAPYLIIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVS 280
           GA   + AA  +  Q +LK+ +A+S+VS
Sbjct: 284 GAIQIVYAASTSLGQRNLKKRIAYSSVS 311


>NU4C_AETCO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 37.0 bits (84), Expect = 4e-04
 Identities = 37/174 (21%), Positives = 66/174 (37%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA  L    ++ V
Sbjct: 224 KSPLIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSLFSPWLMVV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGIASITDPGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTSYDRIRLVSLDEMGGMAISIPKIFTMFTILSMASLALPGMSGFVAE 397


>NU4C_OENPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 48/170 (28%), Positives = 77/170 (45%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFT 256
           +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ VGA  
Sbjct: 228 IPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHCLFSPGLIIVGAIQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AA  +  Q +LK+ +A+S++S                       +  H    +ALF 
Sbjct: 288 IIYAASTSPGQLNLKKRIAYSSISHMGFIIIGIGSLSDTGLNGAILQIISHGFIGAALFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             G          L ++GG+   LP                P LSG+ +E
Sbjct: 348 LAGTSYDRIRLLYLDEMGGMAIPLPKLFTXXXXXXXXXXXXPGLSGFVAE 397


>NU4C_OENAR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 516

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 48/170 (28%), Positives = 77/170 (45%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFT 256
           +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ VGA  
Sbjct: 228 IPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHCLFSPGLIIVGAIQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AA  +  Q +LK+ +A+S++S                       +  H    +ALF 
Sbjct: 288 IIYAASTSPGQLNLKKRIAYSSISHMGFIIIGIGSLSDTGLNGAILQIISHGFIGAALFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             G          L ++GG+   LP                P LSG+ +E
Sbjct: 348 LAGTSYDRIRLLYLDEMGGMAIPLPKLFTXXXXXXXXXXXXPGLSGFVAE 397


>NU4C_MANES RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 36/174 (20%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLIIV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GVMQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGICSISDMGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+++E
Sbjct: 344 ALFFLAGTGYDRIRRVYLDEMGGMATSMPKIFTTFSILSLASLALPGMSGFFAE 397


>NU4C_ILLOL RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 67/198 (33%), Positives = 103/198 (52%), Gaps = 8/198 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV- 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  L + 
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSIFSPWLMII 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           GA   + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GAIQIIYAASTSPGQRNLKKRIAYSSVSHMXXXXXXXXXXXXXXLNGSILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           ALF   G          L ++GG+   +P                P +SG+ +E  +   
Sbjct: 344 ALFFLAGTTYDRIRLVYLDEMGGIAILMPKXXXXXXXXXXXXXXXPGMSGFVAESVVF-- 401

Query: 370 AVSVHTAWGVFMLVLILL 387
            + + T+   F++  IL+
Sbjct: 402 -LGIITSPKYFLMPKILI 418


>NU4C_CARPA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 42/198 (21%), Positives = 77/198 (38%), Gaps = 8/198 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA  L    ++ V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSLFSPWLVVV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  ++ Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTMQIIYAASTSSGQRNLKKRIAYSSVSHMGFIIIGIGSITDPGLNGAILQIVSHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQ 369
           ALF   G          L ++GG+   +P                P +SG+ +E   L  
Sbjct: 344 ALFFLAGTSYDRIRLVYLDEMGGMAISMPKIFTMFSILSMASLALPGMSGFVAE---LIV 400

Query: 370 AVSVHTAWGVFMLVLILL 387
              + T+   F++  IL+
Sbjct: 401 FFGIITSQKYFLMAKILI 418


>NU4C_AETGR RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 36/174 (20%), Positives = 66/174 (37%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ V
Sbjct: 224 KSPLIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSMFSPWLMVV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGIASITDPGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTSYDRIRLVSLDEMGGMAISIPKIFTMFTILSMASLALPGMSGFVAE 397


>NU2M_LUMTE RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           2;
          Length = 335

 Score = 36.6 bits (83), Expect = 5e-04
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 5/124 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGA 254
           K   +P   W P  MA+ + VS LI S+    A + ++  L P        +  +L + A
Sbjct: 102 KLGSVPCHFWYPSVMASISWVSCLILSSWQKLAPLSILAFLLP-----QKNMNFMLSMAA 156

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXXFHLTVHATFKSALFLS 314
             AL+  ++   Q  L+ ++A+S++                    +  V+    + LF++
Sbjct: 157 MNALLGGVIGMNQTQLRTIMAYSSIGHIGWMMSLAAVYKPSSCIMYFVVYCILITPLFMT 216

Query: 315 VGAL 318
           +G L
Sbjct: 217 MGYL 220


>NUON_RICPR RecName: Full=NADH-quinone oxidoreductase subunit N;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit N;AltName: Full=NDH-1 subunit N;
          Length = 458

 Score = 36.2 bits (82), Expect = 7e-04
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRLFP---LFEHAPLALAVVLW 251
           K A  PL  W+P+     +P+S++ +    +  G+ +VL       +  + P+   ++  
Sbjct: 210 KLASSPLHFWIPDVYEG-SPISSVTYFTAASKIGMVIVLLNISKLIIGNYYPINYNLIKI 268

Query: 252 VGAFTALIAALVATAQYDLKRLLAWSTV 279
           +   + L  A  A  Q  LKRL+A+ST+
Sbjct: 269 IAILSMLFGAFGAIRQTSLKRLMAYSTI 296


>NUOM_BUCAI RecName: Full=NADH-quinone oxidoreductase subunit M;    
               EC=1.6.99.5;AltName: Full=NADH dehydrogenase I
           subunit M;AltName: Full=NDH-1 subunit M;
          Length = 505

 Score = 36.2 bits (82), Expect = 7e-04
 Identities = 39/200 (19%), Positives = 75/200 (37%), Gaps = 9/200 (4%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLR----LFPLFEHAPLALAVVLWVGA 254
           +P   WLP+  +      ++     +     + +LR    LFP    +  +L  V W G 
Sbjct: 237 VPFHGWLPDIHSRSLSCGSVEIIGVLLKTAPYALLRYNLVLFPDSTKS-FSLIAVFW-GI 294

Query: 255 FTALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSAL 311
            +    A +A +Q ++KRL+A+S+VS                       +  ++   +AL
Sbjct: 295 ISIFYGAWIAFSQTNIKRLIAYSSVSHMGLILIGIYSNNERALQGVVIQMLSNSLTVAAL 354

Query: 312 FLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELLRQAV 371
            +  G + +   T+D+ ++GGL   + W               P    +  E  +L    
Sbjct: 355 CILSGQIYKRFKTQDMSKMGGLWSCIYWIPGFSLFFSLANLGVPGTGNFIGEFLILSGVF 414

Query: 372 SVHTAWGVFMLVLILLAGIY 391
            V     +   + I+ + IY
Sbjct: 415 EVFPLVSILATIGIVFSSIY 434


>NU4C_NICTO RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.2 bits (82), Expect = 7e-04
 Identities = 47/174 (27%), Positives = 78/174 (44%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ +
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLMII 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAASTSLGQRNLKKRIAYSSVSHMGFIIIGISSLTDTGLNGALLQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTTYDRIRLVYLDEMGGIASPMPKMFTXXXXXXXXXXXXPGMSGFVAE 397


>NU4C_HORVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.2 bits (82), Expect = 7e-04
 Identities = 49/170 (28%), Positives = 79/170 (46%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWVGAFT 256
           +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ +GA  
Sbjct: 228 IPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHYLFSPWLVIIGAIQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL +  Q + K+ +A+S+VS                       +  H    + LF 
Sbjct: 288 IIYAALTSLGQRNFKKRIAYSSVSHMXXXXXXXXXXXXXXXXXAILQILSHGFIGATLFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             G          L +LGG+   +P                P +SG+ +E
Sbjct: 348 LAGTASDRMRLVYLEELGGISIPMPKIFTMFSSFSMASLALPGMSGFVAE 397


>NU4C_CYCTA RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 36.2 bits (82), Expect = 7e-04
 Identities = 40/174 (22%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHA-PLALAVVLWVGAFT 256
           LPL  WLP+        + ++ +      G + ++R+   L  HA  L    ++ VGA  
Sbjct: 228 LPLHTWLPDTHGEAHYSTCMLLAGIPLKMGGYGLIRINMELLPHAHSLFSPWLVIVGAVQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKSALFL 313
            + AAL + +Q +LKR +A+S+VS                       +  H    +ALF 
Sbjct: 288 IIYAALTSLSQRNLKRRIAYSSVSHMGFVIVGIGSMADTSLNGAILQMISHGLIGAALFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSEEELL 367
             G       T  L  +GG+   +                 P +SG+ +E  +L
Sbjct: 348 LAGTSYDGIRTLFLDGIGGMAIPMSKISTMFSSFSMASLALPGMSGFVAESMVL 401


>NU4C_CHAVU RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 493

 Score = 36.2 bits (82), Expect = 7e-04
 Identities = 35/170 (20%), Positives = 65/170 (38%), Gaps = 5/170 (2%)

Query: 199 LPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAVVLWV-GAFT 256
           +P   WLP+        + ++ +  +   G +  +R+   LF +A    A  L + G   
Sbjct: 228 IPFHTWLPDTHGEAHYSTCMLLAGILLKMGGYGWIRINMTLFPNAHAYFAPWLVILGTVQ 287

Query: 257 ALIAALVATAQYDLKRLLAWSTVSQXXXXXXXXXXXXXXXXX---FHLTVHATFKSALFL 313
            + AA V  +Q +LKR +A+S++S                       +  H    ++LF 
Sbjct: 288 IIYAASVCLSQKNLKRRIAYSSISHMGFVLIGICSFTNIGLSGAICQMISHGLIGASLFF 347

Query: 314 SVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
             G       T  L ++GG+  ++P                P +SG+ +E
Sbjct: 348 LAGTTYDRIRTVSLSEMGGIALKMPKMFSMFTGFSLASLALPTMSGFVAE 397


>NU4C_BUXMI RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 501

 Score = 35.8 bits (81), Expect = 0.001
 Identities = 36/174 (20%), Positives = 67/174 (38%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  ++ V
Sbjct: 225 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLVIV 284

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 285 GTMQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGIGSITDAGLNGAILQIISHGFIGA 344

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+  ++P                P +SG+ +E
Sbjct: 345 ALFFLAGTSYDRIRLIYLDEMGGIAIQMPKIFTMFSSFSMASLALPGMSGFVAE 398


>NU4C_ARATH RecName: Full=NAD(P)H-quinone oxidoreductase chain 4,
           chloroplastic;         EC=1.6.5.-;AltName: Full=NAD(P)H
           dehydrogenase, chain 4;
          Length = 500

 Score = 35.8 bits (81), Expect = 0.001
 Identities = 37/174 (21%), Positives = 66/174 (37%), Gaps = 5/174 (2%)

Query: 195 KSAQLPLTAWLPEAMAAPTPVSALIHSATMAAAGVFLVLRL-FPLFEHAPLALAV-VLWV 252
           KS  +PL  WLP+        + ++ +  +   G + ++R+   L  HA    +  +L V
Sbjct: 224 KSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLVRINMELLPHAHSMFSPWLLVV 283

Query: 253 GAFTALIAALVATAQYDLKRLLAWSTVSQ---XXXXXXXXXXXXXXXXXFHLTVHATFKS 309
           G    + AA  +  Q +LK+ +A+S+VS                       +  H    +
Sbjct: 284 GTIQIIYAASTSPGQRNLKKRIAYSSVSHMGFIIIGISSITDPGLNGAILQIISHGFIGA 343

Query: 310 ALFLSVGALERATGTRDLRQLGGLGKRLPWTXXXXXXXXXXXXXXPLLSGYWSE 363
           ALF   G          L ++GG+   +P                P +SG+ +E
Sbjct: 344 ALFFLAGTSYDRIRLVYLDEMGGMAISIPKIFTMFTILSMASLALPGMSGFIAE 397


>NU2M_NEUCR RecName: Full=NADH-ubiquinone oxidoreductase chain 2;   
                EC=1.6.5.3;AltName: Full=NADH dehydrogenase subunit
           2;
          Length = 583

 Score = 35.8 bits (81), Expect = 0.001
 Identities = 30/93 (32%), Positives = 46/93 (49%), Gaps = 11/93 (11%)

Query: 195 KSAQLPLTAWLPEAM-AAPTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLW-- 251
           K +  P   W P+   A PT V+  +  A +A   +F++L    L  H    L+   W  
Sbjct: 259 KVSAAPFHFWSPDVYDAIPTIVTTFV--AIIAKISIFILL--LELVYHTNNYLSEFSWIY 314

Query: 252 ---VGAFTALI-AALVATAQYDLKRLLAWSTVS 280
              V +F +LI   +V   Q+ +KRLLA+ST+S
Sbjct: 315 GLLVSSFLSLIIGTVVGLTQFRIKRLLAYSTIS 347


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.321    0.135    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,150,645,674
Number of extensions: 363314628
Number of successful extensions: 866520
Number of sequences better than 1.0e-03: 14921
Number of HSP's gapped: 848999
Number of HSP's successfully gapped: 17484
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)