BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABA58208.1 noce0 ABA58208.1 GIB00281CH01 "conserved
hypothetical protein"
         (728 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

CAT2_CLOK5 RecName: Full=4-hydroxybutyrate coenzyme A transferas...    62   1e-11
CAT1_CLOK5 RecName: Full=Succinyl-CoA:coenzyme A transferase;   ...    49   2e-07

>CAT2_CLOK5 RecName: Full=4-hydroxybutyrate coenzyme A transferase; 
                  EC=2.8.3.-;
          Length = 429

 Score = 62.4 bits (150), Expect = 1e-11
 Identities = 50/171 (29%), Positives = 84/171 (49%), Gaps = 12/171 (7%)

Query: 440 SFFLGPQRFYNFLRGLKKEEREQFCMKRVAYVNQLYGSEELKRLQRKDARFLNSALMVTL 499
           +F +G ++ Y+F+      E        V YVN       L  ++  +   +NS + V L
Sbjct: 268 TFLMGTKKLYDFVNNNPMVETYS-----VDYVNN-----PLVIMKNDNMVSINSCVQVDL 317

Query: 500 NGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLRSVREKHGEIHSNIIWNYGH 559
            G + S+ +   + +SGVGGQ +F+  A+     ++II + S   K        + + G 
Sbjct: 318 MGQVCSESI-GLKQISGVGGQVDFIRGANLSKGGKAIIAIPSTAGKGKVSRITPLLDTGA 376

Query: 560 T-TIPCHLRDMVVTEYGIANLRGKNDREIIIALLNITDSRFQDFLLREAQK 609
             T   +  D VVTEYG+A+L+GK  R    AL+NI   +F++ L+ E +K
Sbjct: 377 AVTTSRNEVDYVVTEYGVAHLKGKTLRNRARALINIAHPKFRESLMNEFKK 427



 Score = 50.8 bits (120), Expect = 4e-08
 Identities = 38/145 (26%), Positives = 64/145 (44%), Gaps = 41/145 (28%)

Query: 196 ILGQINPELPFMYGDAQVPSENFDAIVD--HPQYAFKLFGPPNMAINPSDYMIGLHASAL 253
           ++ ++N  +P   GD+ +   + D IV+  HP    +   PP +     +  IG + ++L
Sbjct: 151 VIAEVNKNMPRTLGDSFIHVSDIDYIVEASHPLLELQ---PPKLG--DVEKAIGENCASL 205

Query: 254 IKDGGTIQLGIGSLSDAVTYLIKMRHQYNAVYCALLSEANVLGKFEKMIHNVGGNEPFKE 313
           I+DG T+QLGIG++ DAV   +K                                   K+
Sbjct: 206 IEDGATLQLGIGAIPDAVLLFLKN----------------------------------KK 231

Query: 314 GLYATSEMFVDGFMQLYRSGILKRK 338
            L   SEM  DG M+L ++G++  K
Sbjct: 232 NLGIHSEMISDGVMELVKAGVINNK 256


>CAT1_CLOK5 RecName: Full=Succinyl-CoA:coenzyme A transferase;      
             EC=2.8.3.-;
          Length = 538

 Score = 48.5 bits (114), Expect = 2e-07
 Identities = 37/125 (29%), Positives = 67/125 (53%), Gaps = 8/125 (6%)

Query: 491 LNSALMVTLNGAIISDKLEDGRTVSGVGGQYNFVAMAHALVDARSIIMLRSVREKHGEIH 550
           +N+AL V + G + S  +   + ++G+GG  +F   A+      +I    S+ +K G+I 
Sbjct: 396 INTALEVDIYGNVNSTHVMGSKMMNGIGGSGDFARNAYL-----TIFTTESIAKK-GDI- 448

Query: 551 SNIIWNYGHTTIPCHLRDMVVTEYGIANLRGKNDREIIIALL-NITDSRFQDFLLREAQK 609
           S+I+    H     H   ++VTE G+A+LRG + RE  +A++ N     ++D L+   ++
Sbjct: 449 SSIVPMVSHVDHTEHDVMVIVTEQGVADLRGLSPREKAVAIIENCVHPDYKDMLMEYFEE 508

Query: 610 AGKIS 614
           A K S
Sbjct: 509 ACKSS 513


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.322    0.138    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 13,540,332,075
Number of extensions: 552695986
Number of successful extensions: 1329500
Number of sequences better than 1.0e-03: 19116
Number of HSP's gapped: 1294874
Number of HSP's successfully gapped: 26817
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.4 bits)