BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ABA59517.1 noce0 ABA59517.1 GIB00281CH01 "ATP synthase F1,
alpha subunit"
         (515 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ATPA_NITOC RecName: Full=ATP synthase subunit alpha;         EC=...   978   0.0  
ATPA1_METCA RecName: Full=ATP synthase subunit alpha 1;         ...   840   0.0  
ATPA_THISH RecName: Full=ATP synthase subunit alpha;         EC=...   815   0.0  
ATPA_ALHEH RecName: Full=ATP synthase subunit alpha;         EC=...   795   0.0  
ATPA_SACD2 RecName: Full=ATP synthase subunit alpha;         EC=...   793   0.0  
ATPA_HALHL RecName: Full=ATP synthase subunit alpha;         EC=...   791   0.0  
ATPA2_LEGPH RecName: Full=ATP synthase subunit alpha 2;         ...   787   0.0  
ATPA2_LEGPA RecName: Full=ATP synthase subunit alpha 2;         ...   787   0.0  
ATPA_LEGPL RecName: Full=ATP synthase subunit alpha;         EC=...   787   0.0  
ATPA2_LEGPC RecName: Full=ATP synthase subunit alpha 2;         ...   786   0.0  
ATPA_TERTT RecName: Full=ATP synthase subunit alpha;         EC=...   783   0.0  
ATPA_CHRSD RecName: Full=ATP synthase subunit alpha;         EC=...   781   0.0  
ATPA1_NITMU RecName: Full=ATP synthase subunit alpha 1;         ...   780   0.0  
ATPA_METFK RecName: Full=ATP synthase subunit alpha;         EC=...   774   0.0  
ATPA_RALPJ RecName: Full=ATP synthase subunit alpha;         EC=...   773   0.0  
ATPA_RUTMC RecName: Full=ATP synthase subunit alpha;         EC=...   772   0.0  
ATPA_RALSO RecName: Full=ATP synthase subunit alpha;         EC=...   772   0.0  
ATPA_ALTMD RecName: Full=ATP synthase subunit alpha;         EC=...   771   0.0  
ATPA_MARAV RecName: Full=ATP synthase subunit alpha;         EC=...   766   0.0  
ATPA_RALEH RecName: Full=ATP synthase subunit alpha;         EC=...   765   0.0  
ATPA2_HAHCH RecName: Full=ATP synthase subunit alpha 2;         ...   764   0.0  
ATPA_IDILO RecName: Full=ATP synthase subunit alpha;         EC=...   764   0.0  
ATPA_ALCBS RecName: Full=ATP synthase subunit alpha;         EC=...   763   0.0  
ATPA_RALME RecName: Full=ATP synthase subunit alpha;         EC=...   761   0.0  
ATPA_BURM1 RecName: Full=ATP synthase subunit alpha;         EC=...   761   0.0  
ATPA_THIDA RecName: Full=ATP synthase subunit alpha;         EC=...   761   0.0  
ATPA_BURCM RecName: Full=ATP synthase subunit alpha;         EC=...   761   0.0  
ATPA_BURA4 RecName: Full=ATP synthase subunit alpha;         EC=...   761   0.0  
ATPA1_BURTA RecName: Full=ATP synthase subunit alpha 1;         ...   761   0.0  
ATPA_BURVG RecName: Full=ATP synthase subunit alpha;         EC=...   760   0.0  
ATPA1_BURPS RecName: Full=ATP synthase subunit alpha 1;         ...   760   0.0  
ATPA1_BURP6 RecName: Full=ATP synthase subunit alpha 1;         ...   760   0.0  
ATPA1_BURP1 RecName: Full=ATP synthase subunit alpha 1;         ...   760   0.0  
ATPA1_BURP0 RecName: Full=ATP synthase subunit alpha 1;         ...   760   0.0  
ATPA_RALEJ RecName: Full=ATP synthase subunit alpha;         EC=...   759   0.0  
ATPA_BURM9 RecName: Full=ATP synthase subunit alpha;         EC=...   759   0.0  
ATPA1_BURMS RecName: Full=ATP synthase subunit alpha 1;         ...   759   0.0  
ATPA1_BURMA RecName: Full=ATP synthase subunit alpha 1;         ...   759   0.0  
ATPA1_BURM7 RecName: Full=ATP synthase subunit alpha 1;         ...   759   0.0  
ATPA_BURCJ RecName: Full=ATP synthase subunit alpha;         EC=...   758   0.0  
ATPA_VESOH RecName: Full=ATP synthase subunit alpha;         EC=...   757   0.0  
ATPA_BURCH RecName: Full=ATP synthase subunit alpha;         EC=...   757   0.0  
ATPA_BURCC RecName: Full=ATP synthase subunit alpha;         EC=...   757   0.0  
ATPA_BURCA RecName: Full=ATP synthase subunit alpha;         EC=...   757   0.0  
ATPA_THICR RecName: Full=ATP synthase subunit alpha;         EC=...   757   0.0  
ATPA_BURS3 RecName: Full=ATP synthase subunit alpha;         EC=...   756   0.0  
ATPA2_BURXL RecName: Full=ATP synthase subunit alpha 2;         ...   755   0.0  
ATPA_DECAR RecName: Full=ATP synthase subunit alpha;         EC=...   754   0.0  
ATPA_AZOSE RecName: Full=ATP synthase subunit alpha;         EC=...   754   0.0  
ATPA_PSEAE RecName: Full=ATP synthase subunit alpha;         EC=...   752   0.0  
ATPA_PSEAB RecName: Full=ATP synthase subunit alpha;         EC=...   752   0.0  
ATPA_PSEA8 RecName: Full=ATP synthase subunit alpha;         EC=...   752   0.0  
ATPA_PSEA7 RecName: Full=ATP synthase subunit alpha;         EC=...   752   0.0  
ATPA_AZOSB RecName: Full=ATP synthase subunit alpha;         EC=...   752   0.0  
ATPA_PSEMY RecName: Full=ATP synthase subunit alpha;         EC=...   751   0.0  
ATPA_NEIMF RecName: Full=ATP synthase subunit alpha;         EC=...   751   0.0  
ATPA_NEIM0 RecName: Full=ATP synthase subunit alpha;         EC=...   750   0.0  
ATPA_HERAR RecName: Full=ATP synthase subunit alpha;         EC=...   750   0.0  
ATPA_CELJU RecName: Full=ATP synthase subunit alpha;         EC=...   749   0.0  
ATPA_NEIMB RecName: Full=ATP synthase subunit alpha;         EC=...   749   0.0  
ATPA_NEIMA RecName: Full=ATP synthase subunit alpha;         EC=...   748   0.0  
ATPA_CHRVO RecName: Full=ATP synthase subunit alpha;         EC=...   748   0.0  
ATPA_JANMA RecName: Full=ATP synthase subunit alpha;         EC=...   747   0.0  
ATPA_NEIG1 RecName: Full=ATP synthase subunit alpha;         EC=...   746   0.0  
ATPA_STRMK RecName: Full=ATP synthase subunit alpha;         EC=...   745   0.0  
ATPA_BORA1 RecName: Full=ATP synthase subunit alpha;         EC=...   745   0.0  
ATPA_PSEE4 RecName: Full=ATP synthase subunit alpha;         EC=...   744   0.0  
ATPA_FRAP2 RecName: Full=ATP synthase subunit alpha;         EC=...   743   0.0  
ATPA_LARHH RecName: Full=ATP synthase subunit alpha;         EC=...   743   0.0  
ATPA_SHESH RecName: Full=ATP synthase subunit alpha;         EC=...   742   0.0  
ATPA_POLNS RecName: Full=ATP synthase subunit alpha;         EC=...   742   0.0  
ATPA_BORPD RecName: Full=ATP synthase subunit alpha;         EC=...   741   0.0  
ATPA_PSEU5 RecName: Full=ATP synthase subunit alpha;         EC=...   741   0.0  
ATPA_PSEPG RecName: Full=ATP synthase subunit alpha;         EC=...   741   0.0  
ATPA_PSEF5 RecName: Full=ATP synthase subunit alpha;         EC=...   741   0.0  
ATPA_PSESM RecName: Full=ATP synthase subunit alpha;         EC=...   740   0.0  
ATPA_PSEPW RecName: Full=ATP synthase subunit alpha;         EC=...   740   0.0  
ATPA_FRATM RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_PSEPK RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_PSEP1 RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_POLSQ RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_NITEU RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_PSEU2 RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_PSEFS RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_PSE14 RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_FRATN RecName: Full=ATP synthase subunit alpha;         EC=...   739   0.0  
ATPA_DELAS RecName: Full=ATP synthase subunit alpha;         EC=...   738   0.0  
ATPA_PSEPF RecName: Full=ATP synthase subunit alpha;         EC=...   738   0.0  
ATPA1_NITEC RecName: Full=ATP synthase subunit alpha 1;         ...   737   0.0  
ATPA_XYLFM RecName: Full=ATP synthase subunit alpha;         EC=...   737   0.0  
ATPA_FRATT RecName: Full=ATP synthase subunit alpha;         EC=...   737   0.0  
ATPA_FRAT1 RecName: Full=ATP synthase subunit alpha;         EC=...   737   0.0  
ATPA_FRATW RecName: Full=ATP synthase subunit alpha;         EC=...   736   0.0  
ATPA_DIAST RecName: Full=ATP synthase subunit alpha;         EC=...   736   0.0  
ATPA_ACISJ RecName: Full=ATP synthase subunit alpha;         EC=...   736   0.0  
ATPA_XYLFA RecName: Full=ATP synthase subunit alpha;         EC=...   735   0.0  
ATPA_LEPCP RecName: Full=ATP synthase subunit alpha;         EC=...   735   0.0  
ATPA2_MARMS RecName: Full=ATP synthase subunit alpha 2;         ...   734   0.0  
ATPA1_VIBHB RecName: Full=ATP synthase subunit alpha 1;         ...   734   0.0  
ATPA_FRATO RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_FRATH RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_FRATF RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_COXBU RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_COXBR RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_COXBN RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_COXB2 RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_COXB1 RecName: Full=ATP synthase subunit alpha;         EC=...   734   0.0  
ATPA_HAEI8 RecName: Full=ATP synthase subunit alpha;         EC=...   733   0.0  
ATPA_AERS4 RecName: Full=ATP synthase subunit alpha;         EC=...   732   0.0  
ATPA_BORPA RecName: Full=ATP synthase subunit alpha;         EC=...   732   0.0  
ATPA_BORBR RecName: Full=ATP synthase subunit alpha;         EC=...   732   0.0  
ATPA_XANOR RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_XANOP RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_XANOM RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_XANC5 RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_XANAC RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_AERHH RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_XYLFT RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_XYLF2 RecName: Full=ATP synthase subunit alpha;         EC=...   731   0.0  
ATPA_POLSJ RecName: Full=ATP synthase subunit alpha;         EC=...   730   0.0  
ATPA_XANCP RecName: Full=ATP synthase subunit alpha;         EC=...   729   0.0  
ATPA_XANCB RecName: Full=ATP synthase subunit alpha;         EC=...   729   0.0  
ATPA_XANC8 RecName: Full=ATP synthase subunit alpha;         EC=...   729   0.0  
ATPA_ACIAC RecName: Full=ATP synthase subunit alpha;         EC=...   729   0.0  
ATPA_STRM5 RecName: Full=ATP synthase subunit alpha;         EC=...   729   0.0  
ATPA1_POLNA RecName: Full=ATP synthase subunit alpha 1;         ...   728   0.0  
ATPA_SHEDO RecName: Full=ATP synthase subunit alpha;         EC=...   727   0.0  
ATPA_PSEHT RecName: Full=ATP synthase subunit alpha;         EC=...   727   0.0  
ATPA_BORPE RecName: Full=ATP synthase subunit alpha;         EC=...   727   0.0  
ATPA_METPP RecName: Full=ATP synthase subunit alpha;         EC=...   726   0.0  
ATPA2_PSEA6 RecName: Full=ATP synthase subunit alpha 2;         ...   725   0.0  
ATPA_HAEDU RecName: Full=ATP synthase subunit alpha;         EC=...   724   0.0  
ATPA2_PSYIN RecName: Full=ATP synthase subunit alpha 2;         ...   721   0.0  
ATPA1_PHOPR RecName: Full=ATP synthase subunit alpha 1;         ...   721   0.0  
ATPA_VIBVY RecName: Full=ATP synthase subunit alpha;         EC=...   718   0.0  
ATPA_VIBVU RecName: Full=ATP synthase subunit alpha;         EC=...   718   0.0  
ATPA_VIBPA RecName: Full=ATP synthase subunit alpha;         EC=...   717   0.0  
ATPA_VIBAL RecName: Full=ATP synthase subunit alpha;         EC=...   717   0.0  
ATPA_PSYA2 RecName: Full=ATP synthase subunit alpha;         EC=...   717   0.0  
ATPA_PSYCK RecName: Full=ATP synthase subunit alpha;         EC=...   716   0.0  
ATPA_VIBCH RecName: Full=ATP synthase subunit alpha;         EC=...   716   0.0  
ATPA_VIBC3 RecName: Full=ATP synthase subunit alpha;         EC=...   716   0.0  
ATPA_ALISL RecName: Full=ATP synthase subunit alpha;         EC=...   716   0.0  
ATPA1_RHOFD RecName: Full=ATP synthase subunit alpha 1;         ...   715   0.0  
ATPA_PHOLL RecName: Full=ATP synthase subunit alpha;         EC=...   714   0.0  
ATPA_ACIBY RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ACIBT RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ACIBC RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ACIB5 RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ACIB3 RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_SHEWM RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ENTS8 RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ACIF5 RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_ACIF2 RecName: Full=ATP synthase subunit alpha;         EC=...   713   0.0  
ATPA_SHEPW RecName: Full=ATP synthase subunit alpha;         EC=...   712   0.0  
ATPA2_VIBHB RecName: Full=ATP synthase subunit alpha 2;         ...   712   0.0  
ATPA_DICNV RecName: Full=ATP synthase subunit alpha;         EC=...   712   0.0  
ATPA_VIBFM RecName: Full=ATP synthase subunit alpha;         EC=...   711   0.0  
ATPA_VIBF1 RecName: Full=ATP synthase subunit alpha;         EC=...   711   0.0  
ATPA_SHEHH RecName: Full=ATP synthase subunit alpha;         EC=...   711   0.0  
ATPA_ENT38 RecName: Full=ATP synthase subunit alpha;         EC=...   711   0.0  
ATPA_SHEPA RecName: Full=ATP synthase subunit alpha;         EC=...   710   0.0  
ATPA_THIFE RecName: Full=ATP synthase subunit alpha;         EC=...   709   0.0  
ATPA_SERP5 RecName: Full=ATP synthase subunit alpha;         EC=...   709   0.0  
ATPA_VARPS RecName: Full=ATP synthase subunit alpha;         EC=...   709   0.0  
ATPA_SHISS RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_SHIFL RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_SHIF8 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_SHIDS RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_SHIBS RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_SHESW RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_SHEPC RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ESCF3 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOUT RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOSM RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOSE RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOLU RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOLI RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOLC RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOL6 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOL5 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOHS RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECODH RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECOBW RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO8A RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO81 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO7I RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO5E RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO57 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO55 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO45 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO27 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_ECO24 RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_PSYWF RecName: Full=ATP synthase subunit alpha;         EC=...   708   0.0  
ATPA_TOLAT RecName: Full=ATP synthase subunit alpha;         EC=...   707   0.0  
ATPA_PROMH RecName: Full=ATP synthase subunit alpha;         EC=...   707   0.0  
ATPA_ACIAD RecName: Full=ATP synthase subunit alpha;         EC=...   707   0.0  
ATPA_SHIB3 RecName: Full=ATP synthase subunit alpha;         EC=...   706   0.0  
ATPA_CITK8 RecName: Full=ATP synthase subunit alpha;         EC=...   706   0.0  
ATPA_SHEB9 RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_SHEB8 RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_SHEB5 RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_SHEB2 RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_PECCP RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_KLEP3 RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_KLEP7 RecName: Full=ATP synthase subunit alpha;         EC=...   705   0.0  
ATPA_YERE8 RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_ERWCT RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_EDWI9 RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALTY RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALTI RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALSV RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALPK RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALPB RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALPA RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALNS RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALHS RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALG2 RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALEP RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALDC RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALA4 RecName: Full=ATP synthase subunit alpha;         EC=...   704   0.0  
ATPA_SALAR RecName: Full=ATP synthase subunit alpha;         EC=...   703   0.0  
ATPA_SHEON RecName: Full=ATP synthase subunit alpha;         EC=...   703   0.0  
ATPA_SALPC RecName: Full=ATP synthase subunit alpha;         EC=...   702   0.0  
ATPA_SALCH RecName: Full=ATP synthase subunit alpha;         EC=...   702   0.0  
ATPA_SHESR RecName: Full=ATP synthase subunit alpha;         EC=...   702   0.0  
ATPA_SHESM RecName: Full=ATP synthase subunit alpha;         EC=...   702   0.0  
ATPA_VEREI RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_SODGM RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_SHESA RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPY RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPS RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPP RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPN RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPG RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPE RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPB RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERPA RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_YERP3 RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_HAEIN RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_HAEIE RecName: Full=ATP synthase subunit alpha;         EC=...   701   0.0  
ATPA_HAEIG RecName: Full=ATP synthase subunit alpha;         EC=...   699   0.0  
ATPA_SHELP RecName: Full=ATP synthase subunit alpha;         EC=...   698   0.0  
ATPA_ACTSZ RecName: Full=ATP synthase subunit alpha;         EC=...   697   0.0  
ATPA_MANSM RecName: Full=ATP synthase subunit alpha;         EC=...   696   0.0  
ATPA_ACTP2 RecName: Full=ATP synthase subunit alpha;         EC=...   695   0.0  
ATPA_HAES2 RecName: Full=ATP synthase subunit alpha;         EC=...   694   0.0  
ATPA_HAES1 RecName: Full=ATP synthase subunit alpha;         EC=...   694   0.0  
ATPA_ACTP7 RecName: Full=ATP synthase subunit alpha;         EC=...   694   0.0  
ATPA_ACTPJ RecName: Full=ATP synthase subunit alpha;         EC=...   694   0.0  
ATPA_ERWT9 RecName: Full=ATP synthase subunit alpha;         EC=...   691   0.0  
ATPA_PASMU RecName: Full=ATP synthase subunit alpha;         EC=...   690   0.0  
ATPA2_SHEFN RecName: Full=ATP synthase subunit alpha 2;         ...   689   0.0  
ATPA2_PHOPR RecName: Full=ATP synthase subunit alpha 2;         ...   689   0.0  
ATPA_HAEPS RecName: Full=ATP synthase subunit alpha;         EC=...   684   0.0  
ATPA_SHEAM RecName: Full=ATP synthase subunit alpha;         EC=...   684   0.0  
ATPA_COLP3 RecName: Full=ATP synthase subunit alpha;         EC=...   679   0.0  
ATPA_BLOPB RecName: Full=ATP synthase subunit alpha;         EC=...   670   0.0  
ATPA_BUCAP RecName: Full=ATP synthase subunit alpha;         EC=...   664   0.0  
ATPA_BAUCH RecName: Full=ATP synthase subunit alpha;         EC=...   651   0.0  
ATPA_BLOFL RecName: Full=ATP synthase subunit alpha;         EC=...   648   0.0  
ATPA_BUCAI RecName: Full=ATP synthase subunit alpha;         EC=...   628   0.0  
ATPA_BUCA5 RecName: Full=ATP synthase subunit alpha;         EC=...   628   0.0  
ATPA_BUCAT RecName: Full=ATP synthase subunit alpha;         EC=...   626   0.0  
ATPA_DESRM RecName: Full=ATP synthase subunit alpha;         EC=...   620   e-179
ATPA_HELMI RecName: Full=ATP synthase subunit alpha;         EC=...   615   e-178
ATPA_CARHZ RecName: Full=ATP synthase subunit alpha;         EC=...   615   e-178
ATPA_SYMTH RecName: Full=ATP synthase subunit alpha;         EC=...   603   e-174
ATPA_BUCBP RecName: Full=ATP synthase subunit alpha;         EC=...   603   e-174
ATPA_ZYMMO RecName: Full=ATP synthase subunit alpha;         EC=...   599   e-173
ATPA_WIGBR RecName: Full=ATP synthase subunit alpha;         EC=...   599   e-173
ATPA_MOOTA RecName: Full=ATP synthase subunit alpha;         EC=...   599   e-173
ATPA_CLOPH RecName: Full=ATP synthase subunit alpha;         EC=...   598   e-173
ATPA_SULDN RecName: Full=ATP synthase subunit alpha;         EC=...   595   e-172
ATPA_GEOLS RecName: Full=ATP synthase subunit alpha;         EC=...   594   e-172
ATPA_DEHE1 RecName: Full=ATP synthase subunit alpha;         EC=...   594   e-172
ATPA_ERYLH RecName: Full=ATP synthase subunit alpha;         EC=...   593   e-172
ATPA_PELPD RecName: Full=ATP synthase subunit alpha;         EC=...   591   e-171
ATPA_DEHSC RecName: Full=ATP synthase subunit alpha;         EC=...   591   e-171
ATPA_DEHSB RecName: Full=ATP synthase subunit alpha;         EC=...   591   e-171
ATPA_DESHD RecName: Full=ATP synthase subunit alpha;         EC=...   590   e-171
ATPA_NITSB RecName: Full=ATP synthase subunit alpha;         EC=...   589   e-170
ATPA_DESHY RecName: Full=ATP synthase subunit alpha;         EC=...   589   e-170
ATPA_SOLUE RecName: Full=ATP synthase subunit alpha;         EC=...   588   e-170
ATPA_GEOBB RecName: Full=ATP synthase subunit alpha;         EC=...   587   e-170
ATPA_SYNWW RecName: Full=ATP synthase subunit alpha;         EC=...   587   e-170
ATPA_GEOSM RecName: Full=ATP synthase subunit alpha;         EC=...   586   e-169
ATPA1_SYNAS RecName: Full=ATP synthase subunit alpha 1;         ...   586   e-169
ATPA_ALKOO RecName: Full=ATP synthase subunit alpha;         EC=...   581   e-168
ATPA1_PELCD RecName: Full=ATP synthase subunit alpha 1;         ...   581   e-168
ATPA_CAMFF RecName: Full=ATP synthase subunit alpha;         EC=...   580   e-168
ATPA_BACHD RecName: Full=ATP synthase subunit alpha;         EC=...   580   e-168
ATPA_CAMC5 RecName: Full=ATP synthase subunit alpha;         EC=...   580   e-167
ATPA_NOVAD RecName: Full=ATP synthase subunit alpha;         EC=...   578   e-167
ATPA_CHLPD RecName: Full=ATP synthase subunit alpha;         EC=...   577   e-167
ATPA_CLOK1 RecName: Full=ATP synthase subunit alpha;         EC=...   577   e-166
ATPA_SULNB RecName: Full=ATP synthase subunit alpha;         EC=...   576   e-166
ATPA_CAMC1 RecName: Full=ATP synthase subunit alpha;         EC=...   576   e-166
ATPA_CAMJJ RecName: Full=ATP synthase subunit alpha;         EC=...   576   e-166
ATPA_WOLSU RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA_CAMJR RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA_CAMJE RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA_CAMJ8 RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA2_PELLD RecName: Full=ATP synthase subunit alpha 2;         ...   575   e-166
ATPA_CAMJD RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA_BACLD RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA_KOSOT RecName: Full=ATP synthase subunit alpha;         EC=...   575   e-166
ATPA_BREBN RecName: Full=ATP synthase subunit alpha;         EC=...   574   e-166
ATPA_CLOK5 RecName: Full=ATP synthase subunit alpha;         EC=...   573   e-166
ATPA_CHLPB RecName: Full=ATP synthase subunit alpha;         EC=...   573   e-165
ATPA_SYNFM RecName: Full=ATP synthase subunit alpha;         EC=...   572   e-165
ATPA_THEM4 RecName: Full=ATP synthase subunit alpha;         EC=...   572   e-165
ATPA_PETMO RecName: Full=ATP synthase subunit alpha;         EC=...   572   e-165
ATPA_CLONN RecName: Full=ATP synthase subunit alpha;         EC=...   572   e-165
ATPA_CHLTE RecName: Full=ATP synthase subunit alpha;         EC=...   572   e-165
ATPA_ANOFW RecName: Full=ATP synthase subunit alpha;         EC=...   572   e-165
ATPA_OCEIH RecName: Full=ATP synthase subunit alpha;         EC=...   571   e-165
ATPA_GEOMG RecName: Full=ATP synthase subunit alpha;         EC=...   571   e-165
ATPA_ARCB4 RecName: Full=ATP synthase subunit alpha;         EC=...   571   e-165
ATPA_THEAB RecName: Full=ATP synthase subunit alpha;         EC=...   571   e-165
ATPA_DESOH RecName: Full=ATP synthase subunit alpha;         EC=...   570   e-165
ATPA_CLOBJ RecName: Full=ATP synthase subunit alpha;         EC=...   570   e-165
ATPA_CLOBH RecName: Full=ATP synthase subunit alpha;         EC=...   570   e-165
ATPA_CLOB6 RecName: Full=ATP synthase subunit alpha;         EC=...   570   e-165
ATPA_CLOB1 RecName: Full=ATP synthase subunit alpha;         EC=...   570   e-165
ATPA_PELTS RecName: Full=ATP synthase subunit alpha;         EC=...   570   e-164
ATPA_GEOTN RecName: Full=ATP synthase subunit alpha;         EC=...   569   e-164
ATPA_CHLL2 RecName: Full=ATP synthase subunit alpha;         EC=...   569   e-164
ATPA_RUBXD RecName: Full=ATP synthase subunit alpha;         EC=...   569   e-164
ATPA_FERNB RecName: Full=ATP synthase subunit alpha;         EC=...   569   e-164
ATPA_CLOBM RecName: Full=ATP synthase subunit alpha;         EC=...   569   e-164
ATPA_CLOBK RecName: Full=ATP synthase subunit alpha;         EC=...   569   e-164
ATPA_PELPB RecName: Full=ATP synthase subunit alpha;         EC=...   568   e-164
ATPA_BACSK RecName: Full=ATP synthase subunit alpha;         EC=...   568   e-164
ATPA_SULSY RecName: Full=ATP synthase subunit alpha;         EC=...   568   e-164
ATPA_RHOPS RecName: Full=ATP synthase subunit alpha;         EC=...   568   e-164
ATPA_GEOSF RecName: Full=ATP synthase subunit alpha;         EC=...   568   e-164
ATPA_BACA2 RecName: Full=ATP synthase subunit alpha;         EC=...   568   e-164
ATPA_GEOKA RecName: Full=ATP synthase subunit alpha;         EC=...   567   e-164
ATPA_BACSU RecName: Full=ATP synthase subunit alpha;         EC=...   567   e-164
ATPA_SPHAL RecName: Full=ATP synthase subunit alpha;         EC=...   567   e-164
ATPA_CLOBL RecName: Full=ATP synthase subunit alpha;         EC=...   567   e-164
ATPA_MAGSA RecName: Full=ATP synthase subunit alpha;         EC=...   566   e-163
ATPA_ROSS1 RecName: Full=ATP synthase subunit alpha;         EC=...   565   e-163
ATPA_GEOUR RecName: Full=ATP synthase subunit alpha;         EC=...   565   e-163
ATPA_DESDA RecName: Full=ATP synthase subunit alpha;         EC=...   565   e-163
ATPA_BRASO RecName: Full=ATP synthase subunit alpha;         EC=...   565   e-163
ATPA_BACP2 RecName: Full=ATP synthase subunit alpha;         EC=...   565   e-163
ATPA_SYNJA RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_CLOAB RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_RHOPB RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_PARL1 RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_NITHX RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_GEOSW RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_DESMR RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_BACME RecName: Full=ATP synthase subunit alpha;         EC=...   564   e-163
ATPA_CAMHC RecName: Full=ATP synthase subunit alpha;         EC=...   563   e-163
ATPA2_RHOBA RecName: Full=ATP synthase subunit alpha 2;         ...   563   e-163
ATPA_RHOP2 RecName: Full=ATP synthase subunit alpha;         EC=...   563   e-162
ATPA_BRASB RecName: Full=ATP synthase subunit alpha;         EC=...   563   e-162
ATPA_RHISN RecName: Full=ATP synthase subunit alpha;         EC=...   562   e-162
ATPA_GEOSL RecName: Full=ATP synthase subunit alpha;         EC=...   562   e-162
ATPA_CHLCH RecName: Full=ATP synthase subunit alpha;         EC=...   562   e-162
ATPA_SINMW RecName: Full=ATP synthase subunit alpha;         EC=...   561   e-162
ATPA_RHOCA RecName: Full=ATP synthase subunit alpha;         EC=...   561   e-162
ATPA_METNO RecName: Full=ATP synthase subunit alpha;         EC=...   561   e-162
ATPA2_DINSH RecName: Full=ATP synthase subunit alpha 2;         ...   561   e-162
ATPA_SYNJB RecName: Full=ATP synthase subunit alpha;         EC=...   561   e-162
ATPA_STAES RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-162
ATPA_STAEQ RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-162
ATPA_FUSNN RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-162
ATPA_EXISA RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-162
ATPA_NATTJ RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-161
ATPA_METPB RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-161
ATPA_DESDG RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-161
ATPA_BACST RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-161
ATPA_METRJ RecName: Full=ATP synthase subunit alpha;         EC=...   560   e-161
ATPA_METS4 RecName: Full=ATP synthase subunit alpha;         EC=...   559   e-161
ATPA_ACIBL RecName: Full=ATP synthase subunit alpha;         EC=...   559   e-161
ATPA_THESQ RecName: Full=ATP synthase subunit alpha;         EC=...   559   e-161
ATPA_THEP1 RecName: Full=ATP synthase subunit alpha;         EC=...   559   e-161
ATPA_THEMA RecName: Full=ATP synthase subunit alpha;         EC=...   559   e-161
ATPA_RHIME RecName: Full=ATP synthase subunit alpha;         EC=...   559   e-161
ATPA_RHOPA RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_RHOP5 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_ROSCS RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_RHIEC RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_HELPY RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_HELPH RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_HELP2 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_DESAA RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAW RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAT RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAS RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAR RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAN RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAM RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAAB RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAA9 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAA8 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAA3 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAA2 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_STAA1 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_JANSC RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_HELPS RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_HELPG RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_AGRVS RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_AGRT5 RecName: Full=ATP synthase subunit alpha;         EC=...   558   e-161
ATPA_ROSDO RecName: Full=ATP synthase subunit alpha;         EC=...   557   e-161
ATPA_BACP3 RecName: Full=ATP synthase subunit alpha;         EC=...   557   e-161
ATPA_PROMO RecName: Full=ATP synthase subunit alpha, sodium ion ...   557   e-161
ATPA_OLICO RecName: Full=ATP synthase subunit alpha;         EC=...   557   e-161
ATPA_SILPO RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_RICFE RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_RHILW RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_RHIE6 RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_HELPJ RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_BRAJA RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_CHLT3 RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_ALKMQ RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_STAAE RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_STAAC RecName: Full=ATP synthase subunit alpha;         EC=...   556   e-160
ATPA_THENN RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_PELUB RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_HALOH RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_RHIL3 RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_TRIEI RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_NITWN RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_LACSS RecName: Full=ATP synthase subunit alpha;         EC=...   555   e-160
ATPA_STAHJ RecName: Full=ATP synthase subunit alpha;         EC=...   554   e-160
ATPA_PROVI RecName: Full=ATP synthase subunit alpha;         EC=...   554   e-160
ATPA_BOVIN RecName: Full=ATP synthase subunit alpha, mitochondri...   554   e-160
ATPA_RICM5 RecName: Full=ATP synthase subunit alpha;         EC=...   554   e-160
ATPA_RICCN RecName: Full=ATP synthase subunit alpha;         EC=...   554   e-160
ATPA_RICAH RecName: Full=ATP synthase subunit alpha;         EC=...   554   e-160
ATPA_DESVM RecName: Full=ATP synthase subunit alpha;         EC=...   554   e-160
ATPA_RHOSK RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-160
ATPA_RHOS4 RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-160
ATPA_EXIS2 RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-160
ATPA1_RHOS1 RecName: Full=ATP synthase subunit alpha 1;         ...   553   e-160
ATPA_RICRS RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-159
ATPA_RICRO RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-159
ATPA_RHOS5 RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-159
ATPA_METEP RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-159
ATPA_METC4 RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-159
ATPA_HELAH RecName: Full=ATP synthase subunit alpha;         EC=...   553   e-159
ATPA_SPHWW RecName: Full=ATP synthase subunit alpha;         EC=...   552   e-159
ATPA_ENTFA RecName: Full=ATP synthase subunit alpha;         EC=...   551   e-159
ATPA_STAS1 RecName: Full=ATP synthase subunit alpha;         EC=...   551   e-159
ATPA_RHORU RecName: Full=ATP synthase subunit alpha;         EC=...   551   e-159
ATPA_RHORT RecName: Full=ATP synthase subunit alpha;         EC=...   551   e-159
ATPA_GLOVI RecName: Full=ATP synthase subunit alpha;         EC=...   551   e-159
ATPA_RICPU RecName: Full=ATP synthase subunit alpha;         EC=...   551   e-159
ATPA_GRATL RecName: Full=ATP synthase subunit alpha, chloroplast...   550   e-159
ATPA_CLOBB RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-159
ATPA_CLOBA RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-159
ATPA_CLOB8 RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-159
ATPA_STRA5 RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-158
ATPA_STRA1 RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-158
ATPA_LACGA RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-158
ATPA_JASNU RecName: Full=ATP synthase subunit alpha, chloroplast...   550   e-158
ATPA_BACPF RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-158
ATPA_ANASP RecName: Full=ATP synthase subunit alpha;         EC=...   550   e-158
ATPA_MOUSE RecName: Full=ATP synthase subunit alpha, mitochondri...   550   e-158
ATPA_STRA3 RecName: Full=ATP synthase subunit alpha;         EC=...   549   e-158
ATPA_RAT RecName: Full=ATP synthase subunit alpha, mitochondrial...   549   e-158
ATPA_NEUCR RecName: Full=ATP synthase subunit alpha, mitochondri...   549   e-158
ATPA_LAWIP RecName: Full=ATP synthase subunit alpha;         EC=...   549   e-158
ATPA_DESVV RecName: Full=ATP synthase subunit alpha;         EC=...   549   e-158
ATPA_DESVH RecName: Full=ATP synthase subunit alpha;         EC=...   549   e-158
ATPA_DESPS RecName: Full=ATP synthase subunit alpha;         EC=...   548   e-158
ATPA_PARDP RecName: Full=ATP synthase subunit alpha;         EC=...   548   e-158
ATPA_BACCN RecName: Full=ATP synthase subunit alpha;         EC=...   548   e-158
ATPA_SILST RecName: Full=ATP synthase subunit alpha;         EC=...   548   e-158
ATPA_PONAB RecName: Full=ATP synthase subunit alpha, mitochondri...   547   e-158
ATPA_LYSSC RecName: Full=ATP synthase subunit alpha;         EC=...   547   e-158
ATPA_LACRJ RecName: Full=ATP synthase subunit alpha;         EC=...   547   e-158
ATPA_LACRD RecName: Full=ATP synthase subunit alpha;         EC=...   547   e-158
ATPA_LACJO RecName: Full=ATP synthase subunit alpha;         EC=...   547   e-158
ATPA_HYPNA RecName: Full=ATP synthase subunit alpha;         EC=...   547   e-158
ATPA_GUITH RecName: Full=ATP synthase subunit alpha, chloroplast...   547   e-158
ATPA_EMIHU RecName: Full=ATP synthase subunit alpha, chloroplast...   547   e-158
ATPA_THELT RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_RHDSA RecName: Full=ATP synthase subunit alpha, chloroplast...   546   e-157
ATPA_PANTR RecName: Full=ATP synthase subunit alpha, mitochondri...   546   e-157
ATPA_HUMAN RecName: Full=ATP synthase subunit alpha, mitochondri...   546   e-157
ATPA_BARBK RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACHK RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACCZ RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACCR RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACCQ RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACC7 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACC3 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACC1 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACC0 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACAN RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACAH RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACAC RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_BACAA RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_XANP2 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_OSTTA RecName: Full=ATP synthase subunit alpha, chloroplast...   546   e-157
ATPA_HERA2 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_CLOD6 RecName: Full=ATP synthase subunit alpha;         EC=...   546   e-157
ATPA_MANES RecName: Full=ATP synthase subunit alpha, chloroplast...   545   e-157
ATPA_ENTHR RecName: Full=ATP synthase subunit alpha;         EC=...   545   e-157
ATPA_BART1 RecName: Full=ATP synthase subunit alpha;         EC=...   545   e-157
ATPA_BACC4 RecName: Full=ATP synthase subunit alpha;         EC=...   545   e-157
ATPA_BACC2 RecName: Full=ATP synthase subunit alpha;         EC=...   545   e-157
ATPA_CHLAT RecName: Full=ATP synthase subunit alpha, chloroplast...   545   e-157
ATPA_BARQU RecName: Full=ATP synthase subunit alpha;         EC=...   545   e-157
ATPA_BARHE RecName: Full=ATP synthase subunit alpha;         EC=...   545   e-157
ATPA_THEYD RecName: Full=ATP synthase subunit alpha;         EC=...   544   e-157
ATPA_BRAHW RecName: Full=ATP synthase subunit alpha;         EC=...   544   e-157
ATPA_MACCJ RecName: Full=ATP synthase subunit alpha;         EC=...   544   e-157
ATPA_HELHP RecName: Full=ATP synthase subunit alpha;         EC=...   544   e-157
ATPA_SYNP6 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_SYNE7 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BACWK RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_SYNS9 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUSI RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUME RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUMB RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUC2 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUAB RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUA2 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_BRUA1 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_RICB8 RecName: Full=ATP synthase subunit alpha;         EC=...   543   e-156
ATPA_PHATR RecName: Full=ATP synthase subunit alpha, chloroplast...   543   e-156
ATPA_CYAP4 RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_CLOPS RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_CHLAA RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_ZYGCR RecName: Full=ATP synthase subunit alpha, chloroplast...   542   e-156
ATPA_LACAC RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_DESAP RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_CLOPE RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_CLOP1 RecName: Full=ATP synthase subunit alpha;         EC=...   542   e-156
ATPA_CHLAD RecName: Full=ATP synthase subunit alpha;         EC=...   541   e-156
ATPA_BRUSU RecName: Full=ATP synthase subunit alpha;         EC=...   541   e-156
ATPA_ELUMP RecName: Full=ATP synthase subunit alpha;         EC=...   541   e-156
ATPA_BRUO2 RecName: Full=ATP synthase subunit alpha;         EC=...   541   e-156
ATPA_ANADF RecName: Full=ATP synthase subunit alpha;         EC=...   541   e-156
ATPA2_LISMF RecName: Full=ATP synthase subunit alpha 2;         ...   541   e-156
ATPA2_LISIN RecName: Full=ATP synthase subunit alpha 2;         ...   540   e-156
ATPA_ANTSP RecName: Full=ATP synthase subunit alpha, chloroplast...   540   e-155
ATPA_ANAVT RecName: Full=ATP synthase subunit alpha;         EC=...   540   e-155
ATPA2_LISMO RecName: Full=ATP synthase subunit alpha 2;         ...   540   e-155
ATPA_MYXXD RecName: Full=ATP synthase subunit alpha;         EC=...   540   e-155
ATPA_MYXXA RecName: Full=ATP synthase subunit alpha;         EC=...   540   e-155
ATPA_NOSP7 RecName: Full=ATP synthase subunit alpha;         EC=...   539   e-155
ATPA_BDEBA RecName: Full=ATP synthase subunit alpha;         EC=...   539   e-155
ATPA_STAPU RecName: Full=ATP synthase subunit alpha, chloroplast...   539   e-155
ATPA_PHEZH RecName: Full=ATP synthase subunit alpha;         EC=...   538   e-155
ATPA_KLULA RecName: Full=ATP synthase subunit alpha, mitochondri...   538   e-155
ATPA_DRANE RecName: Full=ATP synthase subunit alpha, chloroplast...   538   e-155
ATPA_CHAGL RecName: Full=ATP synthase subunit alpha, chloroplast...   538   e-155
ATPA_ANADE RecName: Full=ATP synthase subunit alpha;         EC=...   538   e-155
ATPA_HYDS0 RecName: Full=ATP synthase subunit alpha;         EC=...   538   e-155
ATPA_ARATH RecName: Full=ATP synthase subunit alpha, chloroplast...   538   e-155
ATPA_ACIC5 RecName: Full=ATP synthase subunit alpha;         EC=...   538   e-155
ATPA_SCEOB RecName: Full=ATP synthase subunit alpha, chloroplast...   538   e-155
ATPA_PORYE RecName: Full=ATP synthase subunit alpha, chloroplast...   537   e-155
ATPA_THETN RecName: Full=ATP synthase subunit alpha;         EC=...   537   e-155
ATPA_RICPR RecName: Full=ATP synthase subunit alpha;         EC=...   537   e-155
ATPAM_MARPO RecName: Full=ATP synthase subunit alpha, mitochondr...   537   e-155
ATPA2_LISW6 RecName: Full=ATP synthase subunit alpha 2;         ...   537   e-155
ATPA_SYNS3 RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_STRTD RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_STRT2 RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_STRT1 RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_SCHPO RecName: Full=ATP synthase subunit alpha, mitochondri...   536   e-154
ATPA_RICCK RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_LACLM RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_LACF3 RecName: Full=ATP synthase subunit alpha;         EC=...   536   e-154
ATPA_LACH4 RecName: Full=ATP synthase subunit alpha;         EC=...   535   e-154
ATPA_MARMM RecName: Full=ATP synthase subunit alpha;         EC=...   535   e-154
ATPA_EHRRW RecName: Full=ATP synthase subunit alpha;         EC=...   535   e-154
ATPA_EHRRG RecName: Full=ATP synthase subunit alpha;         EC=...   535   e-154
ATPA_AZOC5 RecName: Full=ATP synthase subunit alpha;         EC=...   535   e-154
ATPA_ANAD2 RecName: Full=ATP synthase subunit alpha;         EC=...   535   e-154
ATPA_SYNP1 RecName: Full=ATP synthase subunit alpha;         EC=...   534   e-154
ATPA_PELHO RecName: Full=ATP synthase subunit alpha, chloroplast...   534   e-154
ATPA_RHOBL RecName: Full=ATP synthase subunit alpha;         EC=...   534   e-154
ATPA_PORPU RecName: Full=ATP synthase subunit alpha, chloroplast...   534   e-154
ATPA_PARUW RecName: Full=ATP synthase subunit alpha;         EC=...   534   e-154
ATPA_LACCB RecName: Full=ATP synthase subunit alpha;         EC=...   534   e-154
ATPA_LACC3 RecName: Full=ATP synthase subunit alpha;         EC=...   534   e-154
ATPA_EUGGR RecName: Full=ATP synthase subunit alpha, chloroplast...   533   e-153
ATPA_PEDPA RecName: Full=ATP synthase subunit alpha;         EC=...   533   e-153
ATPA_ANASK RecName: Full=ATP synthase subunit alpha;         EC=...   533   e-153
ATPA_STRS7 RecName: Full=ATP synthase subunit alpha;         EC=...   533   e-153
ATPA_STREM RecName: Full=ATP synthase subunit alpha;         EC=...   533   e-153
ATPA_DROME RecName: Full=ATP synthase subunit alpha, mitochondri...   533   e-153
ATPA_CYAP8 RecName: Full=ATP synthase subunit alpha;         EC=...   533   e-153
ATPA_AMOA5 RecName: Full=ATP synthase subunit alpha;         EC=...   533   e-153
ATPA_CYAP7 RecName: Full=ATP synthase subunit alpha;         EC=...   532   e-153
ATPA_CHLRE RecName: Full=ATP synthase subunit alpha, chloroplast...   532   e-153
ATPA_OLTVI RecName: Full=ATP synthase subunit alpha, chloroplast...   531   e-153
ATPA_CAUSK RecName: Full=ATP synthase subunit alpha;         EC=...   531   e-153
ATPA_CAEEL RecName: Full=ATP synthase subunit alpha, mitochondri...   531   e-153
ATPA_MESSB RecName: Full=ATP synthase subunit alpha;         EC=...   531   e-153
ATPAM_ORYSJ RecName: Full=ATP synthase subunit alpha, mitochondr...   531   e-153
ATPAM_ORYSI RecName: Full=ATP synthase subunit alpha, mitochondr...   531   e-153
ATPAM_ORYSA RecName: Full=ATP synthase subunit alpha, mitochondr...   531   e-153
ATPA_GALSU RecName: Full=ATP synthase subunit alpha, chloroplast...   531   e-153
ATPA_FLAJ1 RecName: Full=ATP synthase subunit alpha;         EC=...   531   e-153
ATPA_STRPZ RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRPM RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRPG RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRPF RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRPD RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRPC RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRPB RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRP8 RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRP6 RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRP3 RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_STRP1 RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-153
ATPA_RHILO RecName: Full=ATP synthase subunit alpha;         EC=...   530   e-152
ATPA_XENLA RecName: Full=ATP synthase subunit alpha, mitochondri...   530   e-152
ATPA_THAPS RecName: Full=ATP synthase subunit alpha, chloroplast...   529   e-152
ATPA_NEPOL RecName: Full=ATP synthase subunit alpha, chloroplast...   529   e-152
ATPA_EHRCJ RecName: Full=ATP synthase subunit alpha;         EC=...   529   e-152
ATPA_ACICJ RecName: Full=ATP synthase subunit alpha;         EC=...   529   e-152
ATPA_PSEAK RecName: Full=ATP synthase subunit alpha, chloroplast...   528   e-152
ATPA_METSB RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_GRAFK RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_CAUCR RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_CAUCN RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_STRE4 RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_RICTY RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_PROMA RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPA_EHRCR RecName: Full=ATP synthase subunit alpha;         EC=...   528   e-152
ATPAM_OENBI RecName: Full=ATP synthase subunit alpha, mitochondr...   528   e-152
ATPA_LEPBL RecName: Full=ATP synthase subunit alpha;         EC=...   527   e-152
ATPA_LEPBJ RecName: Full=ATP synthase subunit alpha;         EC=...   527   e-152
ATPA1_ACAM1 RecName: Full=ATP synthase subunit alpha 1;         ...   527   e-152
ATPA_STRMU RecName: Full=ATP synthase subunit alpha;         EC=...   526   e-151
ATPA_PROM4 RecName: Full=ATP synthase subunit alpha;         EC=...   526   e-151
ATPA_LEPIN RecName: Full=ATP synthase subunit alpha;         EC=...   526   e-151
ATPA_LEPIC RecName: Full=ATP synthase subunit alpha;         EC=...   526   e-151
ATPA_OCHA4 RecName: Full=ATP synthase subunit alpha;         EC=...   526   e-151
ATPAM_SOYBN RecName: Full=ATP synthase subunit alpha, mitochondr...   526   e-151
ATPA_PARD8 RecName: Full=ATP synthase subunit alpha;         EC=...   525   e-151
ATPA_FLAPJ RecName: Full=ATP synthase subunit alpha;         EC=...   525   e-151
ATPA_LEPBP RecName: Full=ATP synthase subunit alpha;         EC=...   525   e-151
ATPA_LEPBA RecName: Full=ATP synthase subunit alpha;         EC=...   525   e-151
ATPA_BACTN RecName: Full=ATP synthase subunit alpha;         EC=...   525   e-151
ATPAM_PEA RecName: Full=ATP synthase subunit alpha, mitochondrial;    525   e-151
ATPA_THEEB RecName: Full=ATP synthase subunit alpha;         EC=...   525   e-151
ATPA_SPIOL RecName: Full=ATP synthase subunit alpha, chloroplast...   524   e-151
ATPA_MICAN RecName: Full=ATP synthase subunit alpha;         EC=...   524   e-151
ATPA_GNEPA RecName: Full=ATP synthase subunit alpha, chloroplast...   524   e-151
ATPA_GRABC RecName: Full=ATP synthase subunit alpha;         EC=...   524   e-151
ATPA_ACIC1 RecName: Full=ATP synthase subunit alpha;         EC=...   524   e-151
ATPAM_BETVU RecName: Full=ATP synthase subunit alpha, mitochondr...   524   e-151
ATPA_SYNSC RecName: Full=ATP synthase subunit alpha;         EC=...   523   e-150
ATPA_STRU0 RecName: Full=ATP synthase subunit alpha;         EC=...   523   e-150
ATPAM_MAIZE RecName: Full=ATP synthase subunit alpha, mitochondr...   523   e-150
ATPA_WELMI RecName: Full=ATP synthase subunit alpha, chloroplast...   523   e-150
ATPAM_PHAVU RecName: Full=ATP synthase subunit alpha, mitochondr...   523   e-150
ATPA_THEFY RecName: Full=ATP synthase subunit alpha;         EC=...   522   e-150
ATPA_LACLA RecName: Full=ATP synthase subunit alpha;         EC=...   522   e-150
ATPA_FRASN RecName: Full=ATP synthase subunit alpha;         EC=...   522   e-150
ATPAM_NICPL RecName: Full=ATP synthase subunit alpha, mitochondr...   522   e-150
ATPA_CYACA RecName: Full=ATP synthase subunit alpha, chloroplast...   522   e-150
ATPAM_WHEAT RecName: Full=ATP synthase subunit alpha, mitochondr...   522   e-150
ATPA_STIHE RecName: Full=ATP synthase subunit alpha, chloroplast...   521   e-150
ATPA_PROMM RecName: Full=ATP synthase subunit alpha;         EC=...   521   e-150
ATPA_BIGNA RecName: Full=ATP synthase subunit alpha, chloroplast...   521   e-150
ATPA_ANAMM RecName: Full=ATP synthase subunit alpha;         EC=...   521   e-150
ATPA_ANAMF RecName: Full=ATP synthase subunit alpha;         EC=...   521   e-150
ATPAM_HELAN RecName: Full=ATP synthase subunit alpha, mitochondr...   521   e-150
ATPA_CAMLR RecName: Full=ATP synthase subunit alpha;         EC=...   521   e-150
ATPA_SYNR3 RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPA_STRZT RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPA_STRR6 RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPA_STRPN RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPA_PROM9 RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPAM_ARATH RecName: Full=ATP synthase subunit alpha, mitochondr...   520   e-149
ATPA_SORC5 RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPA_SOLTU RecName: Full=ATP synthase subunit alpha, chloroplast...   520   e-149
ATPA_SOLLC RecName: Full=ATP synthase subunit alpha, chloroplast...   520   e-149
ATPA_SOLBU RecName: Full=ATP synthase subunit alpha, chloroplast...   520   e-149
ATPA_MAGSM RecName: Full=ATP synthase subunit alpha;         EC=...   520   e-149
ATPA_PROM2 RecName: Full=ATP synthase subunit alpha;         EC=...   519   e-149
ATPA_STRSY RecName: Full=ATP synthase subunit alpha;         EC=...   519   e-149
ATPA_STRS2 RecName: Full=ATP synthase subunit alpha;         EC=...   519   e-149
ATPA_OCHNE RecName: Full=ATP synthase subunit alpha, chloroplast...   519   e-149
ATPA_MESVI RecName: Full=ATP synthase subunit alpha, chloroplast...   519   e-149
ATPA_MESFL RecName: Full=ATP synthase subunit alpha;         EC=...   519   e-149
ATPA_BACV8 RecName: Full=ATP synthase subunit alpha;         EC=...   519   e-149
ATPA_STRZJ RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_STRPS RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_STRPJ RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_STRPI RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_STRP7 RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_PROMS RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_PROM0 RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_ODOSI RecName: Full=ATP synthase subunit alpha, chloroplast...   518   e-149
ATPA_ATRBE RecName: Full=ATP synthase subunit alpha, chloroplast...   518   e-149
ATPA_AQUAE RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_SALAI RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_PROM3 RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPAM_RAPSA RecName: Full=ATP synthase subunit alpha, mitochondr...   518   e-149
ATPAM_BRANA RecName: Full=ATP synthase subunit alpha, mitochondr...   518   e-149
ATPAM_BRACM RecName: Full=ATP synthase subunit alpha, mitochondr...   518   e-149
ATPA_STRZP RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_STRP4 RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_RANMC RecName: Full=ATP synthase subunit alpha, chloroplast...   518   e-149
ATPA_LACLS RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_CLOTH RecName: Full=ATP synthase subunit alpha;         EC=...   518   e-149
ATPA_CALFG RecName: Full=ATP synthase subunit alpha, chloroplast...   518   e-149
ATPA_WOLPP RecName: Full=ATP synthase subunit alpha;         EC=...   517   e-149
ATPA_EUCGG RecName: Full=ATP synthase subunit alpha, chloroplast...   517   e-149
ATPA_OENOB RecName: Full=ATP synthase subunit alpha;         EC=...   517   e-148
ATPA_NICTO RecName: Full=ATP synthase subunit alpha, chloroplast...   517   e-148
ATPA_BACFR RecName: Full=ATP synthase subunit alpha;         EC=...   517   e-148
ATPA_BACFN RecName: Full=ATP synthase subunit alpha;         EC=...   517   e-148
ATPA_POPTR RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_POPAL RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_NICSY RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_AETGR RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_SOYBN RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_LEUMM RecName: Full=ATP synthase subunit alpha;         EC=...   516   e-148
ATPA_GLUDA RecName: Full=ATP synthase subunit alpha;         EC=...   516   e-148
ATPA_CYTH3 RecName: Full=ATP synthase subunit alpha;         EC=...   516   e-148
ATPA_COREF RecName: Full=ATP synthase subunit alpha;         EC=...   516   e-148
ATPA_ACOCL RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_ACOAM RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_PHYPA RecName: Full=ATP synthase subunit alpha, chloroplast...   516   e-148
ATPA_TOBAC RecName: Full=ATP synthase subunit alpha, chloroplast...   515   e-148
ATPA_STRGC RecName: Full=ATP synthase subunit alpha;         EC=...   515   e-148
ATPA_LACBA RecName: Full=ATP synthase subunit alpha;         EC=...   515   e-148
ATPA_SILLA RecName: Full=ATP synthase subunit alpha, chloroplast...   515   e-148
ATPA_NANDO RecName: Full=ATP synthase subunit alpha, chloroplast...   515   e-148
ATPA_DIOEL RecName: Full=ATP synthase subunit alpha, chloroplast...   515   e-148
ATPA_SYNPW RecName: Full=ATP synthase subunit alpha;         EC=...   514   e-148
ATPA_PHAVU RecName: Full=ATP synthase subunit alpha, chloroplast...   514   e-148
ATPA_LACPL RecName: Full=ATP synthase subunit alpha;         EC=...   514   e-148
ATPA_GOSHI RecName: Full=ATP synthase subunit alpha, chloroplast...   514   e-148
ATPA_AETCO RecName: Full=ATP synthase subunit alpha, chloroplast...   514   e-148
ATPA_IPOPU RecName: Full=ATP synthase subunit alpha, chloroplast...   514   e-148
ATPA_VITVI RecName: Full=ATP synthase subunit alpha, chloroplast...   514   e-148
ATPA_COFAR RecName: Full=ATP synthase subunit alpha, chloroplast...   514   e-148
ATPA_PLAOC RecName: Full=ATP synthase subunit alpha, chloroplast...   513   e-147
ATPA_GOSBA RecName: Full=ATP synthase subunit alpha, chloroplast...   513   e-147
ATPA_BUXMI RecName: Full=ATP synthase subunit alpha, chloroplast...   513   e-147
ATPA_SALTO RecName: Full=ATP synthase subunit alpha;         EC=...   513   e-147
ATPA_PIPCE RecName: Full=ATP synthase subunit alpha, chloroplast...   513   e-147
ATPA_NASOF RecName: Full=ATP synthase subunit alpha, chloroplast...   513   e-147
ATPA_LEUCK RecName: Full=ATP synthase subunit alpha;         EC=...   513   e-147
ATPA_HELAN RecName: Full=ATP synthase subunit alpha, chloroplast...   513   e-147
ATPA_THERP RecName: Full=ATP synthase subunit alpha;         EC=...   512   e-147
ATPA_PSINU RecName: Full=ATP synthase subunit alpha, chloroplast...   512   e-147
ATPA_PROM1 RecName: Full=ATP synthase subunit alpha;         EC=...   512   e-147
ATPA_PROMT RecName: Full=ATP synthase subunit alpha;         EC=...   512   e-147
ATPA_LOBMA RecName: Full=ATP synthase subunit alpha, chloroplast...   512   e-147
ATPA_CYAPA RecName: Full=ATP synthase subunit alpha, cyanelle;  ...   512   e-147
ATPA_LEPVR RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_LACS1 RecName: Full=ATP synthase subunit alpha;         EC=...   511   e-147
ATPA_BARVE RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_ARAHI RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_WOLWR RecName: Full=ATP synthase subunit alpha;         EC=...   511   e-147
ATPA_PEA RecName: Full=ATP synthase subunit alpha, chloroplastic...   511   e-147
ATPA_PANGI RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_LIRTU RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_CRUWA RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_CAPBU RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_ANTFO RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA1_GLUOX RecName: Full=ATP synthase subunit alpha 1;         ...   511   e-147
ATPA_SALRD RecName: Full=ATP synthase subunit alpha;         EC=...   511   e-147
ATPA_MARPO RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_CORJK RecName: Full=ATP synthase subunit alpha;         EC=...   511   e-147
ATPA_CARPA RecName: Full=ATP synthase subunit alpha, chloroplast...   511   e-147
ATPA_OENBI RecName: Full=ATP synthase subunit alpha, chloroplast...   510   e-146
ATPA_NEOSM RecName: Full=ATP synthase subunit alpha;         EC=...   510   e-146
ATPA_FRAAA RecName: Full=ATP synthase subunit alpha;         EC=...   510   e-146
ATPA_LACDB RecName: Full=ATP synthase subunit alpha;         EC=...   509   e-146
ATPA_LEPTE RecName: Full=ATP synthase subunit alpha, chloroplast...   509   e-146
ATPA_LACDA RecName: Full=ATP synthase subunit alpha;         EC=...   509   e-146
ATPA_PROM5 RecName: Full=ATP synthase subunit alpha;         EC=...   509   e-146
ATPA_OLIPU RecName: Full=ATP synthase subunit alpha, chloroplast...   509   e-146
ATPA_ANGEV RecName: Full=ATP synthase subunit alpha, chloroplast...   509   e-146
ATPA_ADICA RecName: Full=ATP synthase subunit alpha, chloroplast...   509   e-146
ATPA_WOLPM RecName: Full=ATP synthase subunit alpha;         EC=...   508   e-146
ATPA_CYAME RecName: Full=ATP synthase subunit alpha, chloroplast...   508   e-146
ATPA_CHLSC RecName: Full=ATP synthase subunit alpha, chloroplast...   508   e-146
ATPA_CERDE RecName: Full=ATP synthase subunit alpha, chloroplast...   508   e-146
ATPA_PROMP RecName: Full=ATP synthase subunit alpha;         EC=...   508   e-146
ATPA_KINRD RecName: Full=ATP synthase subunit alpha;         EC=...   508   e-146
ATPA_SACEN RecName: Full=ATP synthase subunit alpha;         EC=...   508   e-146
ATPA_DRIGR RecName: Full=ATP synthase subunit alpha, chloroplast...   508   e-146
ATPA_CYCTA RecName: Full=ATP synthase subunit alpha, chloroplast...   508   e-146
ATPA_KOCRD RecName: Full=ATP synthase subunit alpha;         EC=...   507   e-146
ATPA_CUCSA RecName: Full=ATP synthase subunit alpha, chloroplast...   507   e-145
ATPA_CHAVU RecName: Full=ATP synthase subunit alpha, chloroplast...   506   e-145
ATPA_MYCPA RecName: Full=ATP synthase subunit alpha;         EC=...   505   e-145
ATPA_MYCA1 RecName: Full=ATP synthase subunit alpha;         EC=...   505   e-145
ATPA_PROWI RecName: Full=ATP synthase subunit alpha, plastid;   ...   505   e-145
ATPA_MYCMS RecName: Full=ATP synthase subunit alpha;         EC=...   505   e-145
ATPA_MYCCT RecName: Full=ATP synthase subunit alpha;         EC=...   504   e-145
ATPA_RENSM RecName: Full=ATP synthase subunit alpha;         EC=...   504   e-145
ATPA_ILLOL RecName: Full=ATP synthase subunit alpha, chloroplast...   504   e-145
ATPA_SYNY3 RecName: Full=ATP synthase subunit alpha;         EC=...   503   e-144
ATPA_CITSI RecName: Full=ATP synthase subunit alpha, chloroplast...   503   e-144
ATPA_CHLVU RecName: Full=ATP synthase subunit alpha, chloroplast...   503   e-144
ATPA_BEUC1 RecName: Full=ATP synthase subunit alpha;         EC=...   503   e-144
ATPA_CORDI RecName: Full=ATP synthase subunit alpha;         EC=...   502   e-144
ATPA_LACSA RecName: Full=ATP synthase subunit alpha, chloroplast...   502   e-144
ATPA_CORA7 RecName: Full=ATP synthase subunit alpha;         EC=...   502   e-144
ATPA_FRASC RecName: Full=ATP synthase subunit alpha;         EC=...   501   e-144
ATPA_AZOPC RecName: Full=ATP synthase subunit alpha;         EC=...   501   e-144
ATPA_NYMAL RecName: Full=ATP synthase subunit alpha, chloroplast...   501   e-144
ATPA_LOTJA RecName: Full=ATP synthase subunit alpha, chloroplast...   501   e-144
ATPA_UREPA RecName: Full=ATP synthase subunit alpha;         EC=...   499   e-143
ATPA_UREP2 RecName: Full=ATP synthase subunit alpha;         EC=...   499   e-143
ATPA_CUSOB RecName: Full=ATP synthase subunit alpha, plastid;   ...   498   e-143
ATPA_OENPA RecName: Full=ATP synthase subunit alpha, chloroplast...   498   e-143
ATPA_OENAR RecName: Full=ATP synthase subunit alpha, chloroplast...   498   e-143
ATPA_CUSGR RecName: Full=ATP synthase subunit alpha, plastid;   ...   498   e-143
ATPA_OENGL RecName: Full=ATP synthase subunit alpha, chloroplast...   498   e-143
ATPA_OENEH RecName: Full=ATP synthase subunit alpha, chloroplast...   498   e-143
ATPA_MYCSS RecName: Full=ATP synthase subunit alpha;         EC=...   498   e-143
ATPA_MYCSK RecName: Full=ATP synthase subunit alpha;         EC=...   498   e-143
ATPA_MYCSJ RecName: Full=ATP synthase subunit alpha;         EC=...   498   e-143
ATPA_CORU7 RecName: Full=ATP synthase subunit alpha;         EC=...   498   e-143
ATPA_AMBTC RecName: Full=ATP synthase subunit alpha, chloroplast...   498   e-143
ATPA_NUPAD RecName: Full=ATP synthase subunit alpha, chloroplast...   497   e-143
ATPA_CORGL RecName: Full=ATP synthase subunit alpha;         EC=...   497   e-143
ATPA_YEAST RecName: Full=ATP synthase subunit alpha, mitochondri...   497   e-142
ATPA_PINKO RecName: Full=ATP synthase subunit alpha, chloroplast...   497   e-142
ATPA_MYCLE RecName: Full=ATP synthase subunit alpha;         EC=...   497   e-142
ATPA_MYCLB RecName: Full=ATP synthase subunit alpha;         EC=...   497   e-142
ATPA_LEMMI RecName: Full=ATP synthase subunit alpha, chloroplast...   497   e-142
ATPA_DAUCA RecName: Full=ATP synthase subunit alpha, chloroplast...   497   e-142
ATPA_CLAM3 RecName: Full=ATP synthase subunit alpha;         EC=...   497   e-142
ATPA_CORGB RecName: Full=ATP synthase subunit alpha;         EC=...   496   e-142
ATPA_STRCO RecName: Full=ATP synthase subunit alpha;         EC=...   496   e-142
ATPA_MYCMM RecName: Full=ATP synthase subunit alpha;         EC=...   496   e-142
ATPA_MORIN RecName: Full=ATP synthase subunit alpha, chloroplast...   496   e-142
ATPA_ANEMR RecName: Full=ATP synthase subunit alpha, plastid;   ...   496   e-142
ATPA_CLAMS RecName: Full=ATP synthase subunit alpha;         EC=...   495   e-142
ATPA_HUPLU RecName: Full=ATP synthase subunit alpha, chloroplast...   495   e-142
ATPA_MYCS2 RecName: Full=ATP synthase subunit alpha;         EC=...   494   e-142
ATPA_PHAAO RecName: Full=ATP synthase subunit alpha, chloroplast...   494   e-142
ATPA_LEIXX RecName: Full=ATP synthase subunit alpha;         EC=...   494   e-142
ATPA_STRLI RecName: Full=ATP synthase subunit alpha;         EC=...   494   e-142
ATPA_MYCUA RecName: Full=ATP synthase subunit alpha;         EC=...   494   e-142
ATPA_SACHY RecName: Full=ATP synthase subunit alpha, chloroplast...   493   e-141
ATPA_WOLTR RecName: Full=ATP synthase subunit alpha;         EC=...   493   e-141
ATPA_SORBI RecName: Full=ATP synthase subunit alpha, chloroplast...   493   e-141
ATPA_SACOF RecName: Full=ATP synthase subunit alpha, chloroplast...   493   e-141
ATPA_MYCA9 RecName: Full=ATP synthase subunit alpha;         EC=...   493   e-141
ATPA_PINTH RecName: Full=ATP synthase subunit alpha, chloroplast...   492   e-141
ATPA_CUSEX RecName: Full=ATP synthase subunit alpha, plastid;   ...   492   e-141
ATPA_BIFA0 RecName: Full=ATP synthase subunit alpha;         EC=...   491   e-141
ATPA_WHEAT RecName: Full=ATP synthase subunit alpha, chloroplast...   491   e-141
ATPA_ORYSJ RecName: Full=ATP synthase subunit alpha, chloroplast...   491   e-141
ATPA_ORYSI RecName: Full=ATP synthase subunit alpha, chloroplast...   491   e-141
ATPA_ORYSA RecName: Full=ATP synthase subunit alpha, chloroplast...   491   e-141
ATPA_ORYNI RecName: Full=ATP synthase subunit alpha, chloroplast...   491   e-141
ATPA_CUSRE RecName: Full=ATP synthase subunit alpha, plastid;   ...   490   e-140
ATPA_STRP2 RecName: Full=ATP synthase subunit alpha;         EC=...   490   e-140
ATPA_MYCS5 RecName: Full=ATP synthase subunit alpha;         EC=...   490   e-140
ATPA_HORVU RecName: Full=ATP synthase subunit alpha, chloroplast...   490   e-140
ATPA_PROAC RecName: Full=ATP synthase subunit alpha;         EC=...   489   e-140
ATPA_AGRST RecName: Full=ATP synthase subunit alpha, chloroplast...   489   e-140
ATPA_MAIZE RecName: Full=ATP synthase subunit alpha, chloroplast...   489   e-140
ATPA_MYCGA RecName: Full=ATP synthase subunit alpha;         EC=...   488   e-140
ATPA_LOLPR RecName: Full=ATP synthase subunit alpha, chloroplast...   488   e-140
ATPA_ANAPZ RecName: Full=ATP synthase subunit alpha;         EC=...   488   e-140
ATPA_SYNPX RecName: Full=ATP synthase subunit alpha;         EC=...   486   e-139
ATPA_BIFAA RecName: Full=ATP synthase subunit alpha;         EC=...   485   e-139
ATPA_STRAW RecName: Full=ATP synthase subunit alpha;         EC=...   484   e-139
ATPA_RHOSR RecName: Full=ATP synthase subunit alpha;         EC=...   484   e-139
ATPA_STRGG RecName: Full=ATP synthase subunit alpha;         EC=...   483   e-138
ATPA_RHOE4 RecName: Full=ATP synthase subunit alpha;         EC=...   483   e-138
ATPA_ARTAT RecName: Full=ATP synthase subunit alpha;         EC=...   483   e-138
ATPA_RHOOB RecName: Full=ATP synthase subunit alpha;         EC=...   482   e-138
ATPA_MYCPN RecName: Full=ATP synthase subunit alpha;         EC=...   481   e-138
ATPA_ACEWO RecName: Full=ATP synthase subunit alpha, sodium ion ...   480   e-137
ATPA_TROWT RecName: Full=ATP synthase subunit alpha;         EC=...   479   e-137
ATPA_TROW8 RecName: Full=ATP synthase subunit alpha;         EC=...   479   e-137
ATPAM_ACACA RecName: Full=ATP synthase subunit alpha, mitochondr...   479   e-137
ATPA_ARTCA RecName: Full=ATP synthase subunit alpha;         EC=...   478   e-137
ATPA_SULMW RecName: Full=ATP synthase subunit alpha;         EC=...   478   e-137
ATPA_ORITI RecName: Full=ATP synthase subunit alpha;         EC=...   476   e-136
ATPA_MYCGE RecName: Full=ATP synthase subunit alpha;         EC=...   476   e-136
ATPA_NOCFA RecName: Full=ATP synthase subunit alpha;         EC=...   475   e-136
ATPA1_MYCPU RecName: Full=ATP synthase subunit alpha 1;         ...   475   e-136
ATPA_ACHLI RecName: Full=ATP synthase subunit alpha;         EC=...   474   e-136
ATPA_MYCVP RecName: Full=ATP synthase subunit alpha;         EC=...   474   e-136
ATPA_MYCGI RecName: Full=ATP synthase subunit alpha;         EC=...   473   e-135
ATPA_DICT6 RecName: Full=ATP synthase subunit alpha;         EC=...   473   e-135
ATPA_ARTS2 RecName: Full=ATP synthase subunit alpha;         EC=...   471   e-135
ATPA_DICTD RecName: Full=ATP synthase subunit alpha;         EC=...   469   e-134
ATPA_ORITB RecName: Full=ATP synthase subunit alpha;         EC=...   468   e-134
ATPA_MYCPE RecName: Full=ATP synthase subunit alpha;         EC=...   466   e-133
ATPA_MYCTU RecName: Full=ATP synthase subunit alpha;         EC=...   464   e-133
ATPA_MYCTA RecName: Full=ATP synthase subunit alpha;         EC=...   464   e-133
ATPA_MYCBT RecName: Full=ATP synthase subunit alpha;         EC=...   464   e-133
ATPA_MYCBP RecName: Full=ATP synthase subunit alpha;         EC=...   464   e-133
ATPA_MYCBO RecName: Full=ATP synthase subunit alpha;         EC=...   464   e-133
ATPA_NOCSJ RecName: Full=ATP synthase subunit alpha;         EC=...   459   e-131
ATPA_MYCA5 RecName: Full=ATP synthase subunit alpha;         EC=...   459   e-131
ATPA_BIFLI RecName: Full=ATP synthase subunit alpha;         EC=...   456   e-130
ATPA_BIFLO RecName: Full=ATP synthase subunit alpha;         EC=...   455   e-130
ATPA_BIFLD RecName: Full=ATP synthase subunit alpha;         EC=...   455   e-130
ATPA_CARRP RecName: Full=ATP synthase subunit alpha;         EC=...   451   e-129
ATPA_MYCH7 RecName: Full=ATP synthase subunit alpha;         EC=...   451   e-129
ATPA1_MARMS RecName: Full=ATP synthase subunit alpha 1;         ...   451   e-129
ATPA_MYCHJ RecName: Full=ATP synthase subunit alpha;         EC=...   451   e-129
ATPA_MYCH2 RecName: Full=ATP synthase subunit alpha;         EC=...   449   e-128
ATPAM_DICDI RecName: Full=ATP synthase subunit alpha, mitochondr...   449   e-128
ATPAM_DICCI RecName: Full=ATP synthase subunit alpha, mitochondr...   449   e-128
ATPA1_PELLD RecName: Full=ATP synthase subunit alpha 1;         ...   447   e-128
ATPA_MYCMO RecName: Full=ATP synthase subunit alpha;         EC=...   447   e-128
ATPA_MYCAP RecName: Full=ATP synthase subunit alpha;         EC=...   445   e-127
ATPA2_RHOFD RecName: Full=ATP synthase subunit alpha 2;         ...   444   e-127
ATPA_SELUN RecName: Full=ATP synthase subunit alpha, chloroplast...   435   e-124
ATPA2_ACAM1 RecName: Full=ATP synthase subunit alpha 2;         ...   431   e-123
ATPA1_SHEFN RecName: Full=ATP synthase subunit alpha 1;         ...   431   e-123
ATPA2_PELCD RecName: Full=ATP synthase subunit alpha 2;         ...   427   e-122
ATPA1_RHOBA RecName: Full=ATP synthase subunit alpha 1;         ...   426   e-121
ATPA2_POLNA RecName: Full=ATP synthase subunit alpha 2;         ...   425   e-121
ATPA1_PSYIN RecName: Full=ATP synthase subunit alpha 1;         ...   415   e-118
ATPA2_NITMU RecName: Full=ATP synthase subunit alpha 2;         ...   414   e-117
ATPA1_PSEA6 RecName: Full=ATP synthase subunit alpha 1;         ...   410   e-116
ATPA2_SYNAS RecName: Full=ATP synthase subunit alpha 2;         ...   402   e-114
ATPA1_DINSH RecName: Full=ATP synthase subunit alpha 1;         ...   396   e-112
ATPA3_BURXL RecName: Full=ATP synthase subunit alpha 3;         ...   390   e-110
ATPA2_BURTA RecName: Full=ATP synthase subunit alpha 2;         ...   388   e-110
ATPA1_BURXL RecName: Full=ATP synthase subunit alpha 1;         ...   387   e-110
ATPA2_METCA RecName: Full=ATP synthase subunit alpha 2;         ...   378   e-107
ATPA2_BURMS RecName: Full=ATP synthase subunit alpha 2;         ...   378   e-107
ATPA2_BURMA RecName: Full=ATP synthase subunit alpha 2;         ...   378   e-107
ATPA2_BURM7 RecName: Full=ATP synthase subunit alpha 2;         ...   378   e-107
ATPA1_LISMO RecName: Full=ATP synthase subunit alpha 1;         ...   372   e-105
ATPA1_LISMF RecName: Full=ATP synthase subunit alpha 1;         ...   372   e-105
ATPA1_LEGPH RecName: Full=ATP synthase subunit alpha 1;         ...   371   e-105
ATPA1_LEGPA RecName: Full=ATP synthase subunit alpha 1;         ...   371   e-105
ATPA1_LISIN RecName: Full=ATP synthase subunit alpha 1;         ...   370   e-104
ATPA2_BURPS RecName: Full=ATP synthase subunit alpha 2;         ...   370   e-104
ATPA2_BURP6 RecName: Full=ATP synthase subunit alpha 2;         ...   370   e-104
ATPA2_BURP1 RecName: Full=ATP synthase subunit alpha 2;         ...   370   e-104
ATPA2_BURP0 RecName: Full=ATP synthase subunit alpha 2;         ...   370   e-104
ATPA2_RHOS4 RecName: Full=ATP synthase subunit alpha 2;         ...   367   e-104
ATPA2_RHOS1 RecName: Full=ATP synthase subunit alpha 2;         ...   367   e-104
ATPA1_LEGPC RecName: Full=ATP synthase subunit alpha 1;         ...   362   e-102
ATPA1_LISW6 RecName: Full=ATP synthase subunit alpha 1;         ...   360   e-101
ATPA2_NITEC RecName: Full=ATP synthase subunit alpha 2;         ...   348   8e-98
ATPA2_GLUOX RecName: Full=ATP synthase subunit alpha 2;         ...   338   8e-95
ATPA1_HAHCH RecName: Full=ATP synthase subunit alpha 1;         ...   327   2e-91
ATPA2_MYCPU RecName: Full=ATP synthase subunit alpha 2;         ...   214   1e-57
HRPB6_XANEU RecName: Full=Probable ATP synthase hrpB6;         E...   149   4e-38
VATB_IGNH4 RecName: Full=V-type ATP synthase beta chain;AltName:...   139   4e-35
FLII_BACSU RecName: Full=Flagellum-specific ATP synthase;       ...   136   4e-34
YSCN_YERPS RecName: Full=Probable ATP synthase yscN;         EC=...   136   5e-34
YSCN_YEREN RecName: Full=Probable ATP synthase yscN;         EC=...   136   5e-34
VATB_STRSV RecName: Full=V-type ATP synthase beta chain;AltName:...   130   3e-32
VATB_STRGC RecName: Full=V-type ATP synthase beta chain;AltName:...   130   3e-32
VATB_CENSY RecName: Full=V-type ATP synthase beta chain;AltName:...   128   1e-31
ATPB_ROSS1 RecName: Full=ATP synthase subunit beta;         EC=3...   127   2e-31
ATPB_SYNAS RecName: Full=ATP synthase subunit beta;         EC=3...   127   2e-31
VATB_THENN RecName: Full=V-type ATP synthase beta chain;AltName:...   126   4e-31
ATPB_DESAP RecName: Full=ATP synthase subunit beta;         EC=3...   126   5e-31
VATB_SULTO RecName: Full=V-type ATP synthase beta chain;AltName:...   125   6e-31
VATB_NITMS RecName: Full=V-type ATP synthase beta chain;AltName:...   125   6e-31
ATPB_CLOBB RecName: Full=ATP synthase subunit beta;         EC=3...   125   6e-31
ATPB_CLOBA RecName: Full=ATP synthase subunit beta;         EC=3...   125   6e-31
ATPB_ROSCS RecName: Full=ATP synthase subunit beta;         EC=3...   124   2e-30
VATB_TRYCO RecName: Full=V-type proton ATPase subunit B;        ...   124   2e-30
ATPB_CLOB8 RecName: Full=ATP synthase subunit beta;         EC=3...   124   2e-30
ATPB1_DINSH RecName: Full=ATP synthase subunit beta 1;         E...   123   3e-30
VATB_METJA RecName: Full=V-type ATP synthase beta chain;AltName:...   123   4e-30
FLII_BORBU RecName: Full=Flagellum-specific ATP synthase;       ...   123   4e-30
VATB3_METHJ RecName: Full=V-type ATP synthase beta chain 3;AltNa...   122   7e-30
VATB_UNCMA RecName: Full=V-type ATP synthase beta chain;AltName:...   122   9e-30
VATB_THEON RecName: Full=V-type ATP synthase beta chain;AltName:...   122   9e-30
VATB1_CLOTE RecName: Full=V-type ATP synthase beta chain 1;AltNa...   122   9e-30
ATPB_CLOPS RecName: Full=ATP synthase subunit beta;         EC=3...   121   1e-29
ATPB_CLOPE RecName: Full=ATP synthase subunit beta;         EC=3...   121   1e-29
ATPB_CLOP1 RecName: Full=ATP synthase subunit beta;         EC=3...   121   1e-29
ATPB_SCHPO RecName: Full=ATP synthase subunit beta, mitochondria...   120   3e-29
ATPB_COPPD RecName: Full=ATP synthase subunit beta;         EC=3...   120   3e-29
VATB_THESI RecName: Full=V-type ATP synthase beta chain;AltName:...   120   3e-29
VATB_PYRKO RecName: Full=V-type ATP synthase beta chain;AltName:...   120   3e-29
ATPB_SHEAM RecName: Full=ATP synthase subunit beta;         EC=3...   119   5e-29
ATPB2_NITEC RecName: Full=ATP synthase subunit beta 2;         E...   119   5e-29
VATB_STRPZ RecName: Full=V-type ATP synthase beta chain;AltName:...   119   6e-29
VATB_ARCFU RecName: Full=V-type ATP synthase beta chain;AltName:...   119   6e-29
VATB_STRPM RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRPG RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRPF RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRPD RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRPC RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRPB RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRP8 RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRP6 RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRP3 RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
VATB_STRP1 RecName: Full=V-type ATP synthase beta chain;AltName:...   119   8e-29
ATPB_LARHH RecName: Full=ATP synthase subunit beta;         EC=3...   119   8e-29
VATB_PYRFU RecName: Full=V-type ATP synthase beta chain;AltName:...   118   1e-28
VATB_METB6 RecName: Full=V-type ATP synthase beta chain;AltName:...   118   1e-28
ATPB_THIDA RecName: Full=ATP synthase subunit beta;         EC=3...   118   1e-28
VATB_THEGJ RecName: Full=V-type ATP synthase beta chain;AltName:...   118   1e-28
ATPB_CARHZ RecName: Full=ATP synthase subunit beta;         EC=3...   118   1e-28
VATB_CLOBB RecName: Full=V-type ATP synthase beta chain;AltName:...   117   2e-28
VATB_CLOBA RecName: Full=V-type ATP synthase beta chain;AltName:...   117   2e-28
FLII_PSEAE RecName: Full=Flagellum-specific ATP synthase;       ...   117   2e-28
ATPB_DESRM RecName: Full=ATP synthase subunit beta;         EC=3...   117   2e-28
VATB_SULAC RecName: Full=V-type ATP synthase beta chain;AltName:...   117   2e-28
VATB_STRPS RecName: Full=V-type ATP synthase beta chain;AltName:...   117   2e-28
VATB_METTH RecName: Full=V-type ATP synthase beta chain;AltName:...   117   2e-28
VATB_FUSNN RecName: Full=V-type ATP synthase beta chain;AltName:...   117   2e-28
VATB1_ACEAT RecName: Full=V-type proton ATPase subunit B 1;     ...   117   2e-28
ATPB_HAHCH RecName: Full=ATP synthase subunit beta;         EC=3...   117   2e-28
ATPB_DESOH RecName: Full=ATP synthase subunit beta;         EC=3...   117   2e-28
VATB_STRZJ RecName: Full=V-type ATP synthase beta chain;AltName:...   117   3e-28
VATB_STRPN RecName: Full=V-type ATP synthase beta chain;AltName:...   117   3e-28
VATB_STRPJ RecName: Full=V-type ATP synthase beta chain;AltName:...   117   3e-28
VATB_STRPI RecName: Full=V-type ATP synthase beta chain;AltName:...   117   3e-28
VATB_STRP4 RecName: Full=V-type ATP synthase beta chain;AltName:...   117   3e-28
FLII_TREPA RecName: Full=Flagellum-specific ATP synthase;       ...   117   3e-28
ATPB_PELTS RecName: Full=ATP synthase subunit beta;         EC=3...   117   3e-28
VATB_THEPD RecName: Full=V-type ATP synthase beta chain;AltName:...   116   4e-28
VATB_META3 RecName: Full=V-type ATP synthase beta chain;AltName:...   116   5e-28
VATB_HALVO RecName: Full=V-type ATP synthase beta chain;AltName:...   116   5e-28
FLII_AGRT5 RecName: Full=Flagellum-specific ATP synthase;       ...   116   5e-28
VATB_CLOPS RecName: Full=V-type ATP synthase beta chain;AltName:...   115   7e-28
VATB_CLOPE RecName: Full=V-type ATP synthase beta chain;AltName:...   115   7e-28
VATB_CLOP1 RecName: Full=V-type ATP synthase beta chain;AltName:...   115   7e-28
ATPB_SYMTH RecName: Full=ATP synthase subunit beta;         EC=3...   115   7e-28
ATPB2_BURXL RecName: Full=ATP synthase subunit beta 2;         E...   115   7e-28
VATB_MANSE RecName: Full=V-type proton ATPase subunit B;        ...   115   8e-28
VATB_HELVI RecName: Full=V-type proton ATPase subunit B;        ...   115   8e-28
VATB_DICTD RecName: Full=V-type ATP synthase beta chain;AltName:...   115   8e-28
VATB_DESSY RecName: Full=V-type ATP synthase beta chain;AltName:...   115   8e-28
VATB_CLONN RecName: Full=V-type ATP synthase beta chain;AltName:...   115   8e-28
VATB_CLOBJ RecName: Full=V-type ATP synthase beta chain;AltName:...   115   8e-28
VATB_AERPE RecName: Full=V-type ATP synthase beta chain;AltName:...   115   8e-28
ATPB_SHELP RecName: Full=ATP synthase subunit beta;         EC=3...   115   8e-28
VATB_METM5 RecName: Full=V-type ATP synthase beta chain;AltName:...   115   1e-27
VATB_DICT6 RecName: Full=V-type ATP synthase beta chain;AltName:...   115   1e-27
ATPB_THEYD RecName: Full=ATP synthase subunit beta;         EC=3...   115   1e-27
VATB_DROME RecName: Full=V-type proton ATPase subunit B;        ...   114   1e-27
ATPB_MYCGE RecName: Full=ATP synthase subunit beta;         EC=3...   114   1e-27
ATPB2_PSEA6 RecName: Full=ATP synthase subunit beta 2;         E...   114   1e-27
ATPB_DICT6 RecName: Full=ATP synthase subunit beta;         EC=3...   114   2e-27
ATPB_CLOTH RecName: Full=ATP synthase subunit beta;         EC=3...   114   2e-27
VATB_PYRAB RecName: Full=V-type ATP synthase beta chain;AltName:...   114   2e-27
VATB_METPE RecName: Full=V-type ATP synthase beta chain;AltName:...   114   2e-27
VATB_METMP RecName: Full=V-type ATP synthase beta chain;AltName:...   114   2e-27
VATB_METM6 RecName: Full=V-type ATP synthase beta chain;AltName:...   114   2e-27
FLII_HELPY RecName: Full=Flagellum-specific ATP synthase;       ...   114   2e-27
FLII_HELPJ RecName: Full=Flagellum-specific ATP synthase;       ...   114   2e-27
ATPB_BURS3 RecName: Full=ATP synthase subunit beta;         EC=3...   114   2e-27
ATPB1_PELCD RecName: Full=ATP synthase subunit beta 1;         E...   114   2e-27
VATB_YEAST RecName: Full=V-type proton ATPase subunit B;        ...   113   3e-27
VATB_METVS RecName: Full=V-type ATP synthase beta chain;AltName:...   113   3e-27
VATB_METM7 RecName: Full=V-type ATP synthase beta chain;AltName:...   113   3e-27
VATB_HALMA RecName: Full=V-type ATP synthase beta chain;AltName:...   113   3e-27
VATB_DICDI RecName: Full=V-type proton ATPase subunit B;        ...   113   3e-27
VATB_CANTR RecName: Full=V-type proton ATPase subunit B;        ...   113   3e-27
VATB1_METHJ RecName: Full=V-type ATP synthase beta chain 1;AltNa...   113   3e-27
ATPB_HELHP RecName: Full=ATP synthase subunit beta;         EC=3...   113   3e-27
ATPB_BURM1 RecName: Full=ATP synthase subunit beta;         EC=3...   113   3e-27
VATB_CYACA RecName: Full=V-type proton ATPase subunit B;        ...   113   4e-27
VATB_CLOBM RecName: Full=V-type ATP synthase beta chain;AltName:...   113   4e-27
VATB_CLOBL RecName: Full=V-type ATP synthase beta chain;AltName:...   113   4e-27
VATB_CLOBK RecName: Full=V-type ATP synthase beta chain;AltName:...   113   4e-27
VATB_CLOBH RecName: Full=V-type ATP synthase beta chain;AltName:...   113   4e-27
VATB_CLOB6 RecName: Full=V-type ATP synthase beta chain;AltName:...   113   4e-27
VATB_CLOB1 RecName: Full=V-type ATP synthase beta chain;AltName:...   113   4e-27
SPAL_SHISO RecName: Full=Probable ATP synthase spaL/mxiB;       ...   113   4e-27
SPAL_SHIFL RecName: Full=Probable ATP synthase spaL/mxiB;       ...   113   4e-27
ATPB_OENOB RecName: Full=ATP synthase subunit beta;         EC=3...   113   4e-27
ATPB_BURCM RecName: Full=ATP synthase subunit beta;         EC=3...   113   4e-27
ATPB_BURCH RecName: Full=ATP synthase subunit beta;         EC=3...   113   4e-27
ATPB_BURCC RecName: Full=ATP synthase subunit beta;         EC=3...   113   4e-27
ATPB_BURCA RecName: Full=ATP synthase subunit beta;         EC=3...   113   4e-27
ATPB3_PELCD RecName: Full=ATP synthase subunit beta 3;         E...   113   4e-27
VATB_PYRHO RecName: Full=V-type ATP synthase beta chain;AltName:...   112   6e-27
ATPB_BURVG RecName: Full=ATP synthase subunit beta;         EC=3...   112   6e-27
FLII_BUCBP RecName: Full=Flagellum-specific ATP synthase;       ...   112   7e-27
ATPB_SHESW RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_SHEPC RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_SHEB9 RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_SHEB8 RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_SHEB5 RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_SHEB2 RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_MYCPN RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_DICTD RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB_BURA4 RecName: Full=ATP synthase subunit beta;         EC=3...   112   7e-27
ATPB1_BURTA RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURPS RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURP6 RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURP1 RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURP0 RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURMS RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURMA RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
ATPB1_BURM7 RecName: Full=ATP synthase subunit beta 1;         E...   112   7e-27
VATB_SULSO RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB_SULIY RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB_SULIN RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB_SULIM RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB_SULIL RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB_SULIK RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB_SULIA RecName: Full=V-type ATP synthase beta chain;AltName:...   112   9e-27
VATB2_ACEAT RecName: Full=V-type proton ATPase subunit B 2;     ...   112   9e-27
SPAL_SALTY RecName: Full=Probable ATP synthase spaL;         EC=...   112   9e-27
SPAL_SALTI RecName: Full=Probable ATP synthase spaL;         EC=...   112   9e-27
ATPB_STIAU RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_SHEPA RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_POLSQ RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_POLNS RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_MOOTA RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_LEUMM RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_KLULA RecName: Full=ATP synthase subunit beta, mitochondria...   112   9e-27
ATPB_CLOBM RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_CLOBL RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_CLOBK RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_CLOBJ RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_CLOBH RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_CLOB6 RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_CLOB1 RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_BURCJ RecName: Full=ATP synthase subunit beta;         EC=3...   112   9e-27
ATPB_SHESH RecName: Full=ATP synthase subunit beta;         EC=3...   111   1e-26
ATPB_GNEPA RecName: Full=ATP synthase subunit beta, chloroplasti...   111   1e-26
ATPB_DELAS RecName: Full=ATP synthase subunit beta;         EC=3...   111   1e-26
ATPB_CLOCE RecName: Full=ATP synthase subunit beta;         EC=3...   111   1e-26
VATB_PICTO RecName: Full=V-type ATP synthase beta chain;AltName:...   111   2e-26
VATB1_ARATH RecName: Full=V-type proton ATPase subunit B1;      ...   111   2e-26
ATPB_YEAST RecName: Full=ATP synthase subunit beta, mitochondria...   111   2e-26
ATPB_SHEPW RecName: Full=ATP synthase subunit beta;         EC=3...   111   2e-26
ATPB_NEUCR RecName: Full=ATP synthase subunit beta, mitochondria...   111   2e-26
ATPB_JASNU RecName: Full=ATP synthase subunit beta, chloroplasti...   111   2e-26
ATPB_EQUAR RecName: Full=ATP synthase subunit beta, chloroplasti...   111   2e-26
Y4YI_RHISN RecName: Full=Probable ATP synthase y4yI;         EC=...   110   2e-26
VATB_HALOH RecName: Full=V-type ATP synthase beta chain;AltName:...   110   2e-26
VATB_CAEBR RecName: Full=Probable V-type proton ATPase subunit B...   110   2e-26
VATB2_ARATH RecName: Full=V-type proton ATPase subunit B2;      ...   110   2e-26
ATPB_THELT RecName: Full=ATP synthase subunit beta;         EC=3...   110   2e-26
ATPB_ORNLO RecName: Full=ATP synthase subunit beta, chloroplasti...   110   2e-26
ATPB_CLOK5 RecName: Full=ATP synthase subunit beta;         EC=3...   110   2e-26
ATPB_BRIAM RecName: Full=ATP synthase subunit beta, chloroplasti...   110   2e-26
VATB_SCHPO RecName: Full=V-type proton ATPase subunit B;        ...   110   3e-26
VATB_NATPD RecName: Full=V-type ATP synthase beta chain;AltName:...   110   3e-26
FLII_ECOLI RecName: Full=Flagellum-specific ATP synthase;       ...   110   3e-26
ATPB_SHEON RecName: Full=ATP synthase subunit beta;         EC=3...   110   3e-26
ATPB_GOSHI RecName: Full=ATP synthase subunit beta, chloroplasti...   110   3e-26
ATPB_CYCTA RecName: Full=ATP synthase subunit beta, chloroplasti...   110   3e-26
ATPB_AMBTC RecName: Full=ATP synthase subunit beta, chloroplasti...   110   3e-26
ATPB_ALHEH RecName: Full=ATP synthase subunit beta;         EC=3...   110   3e-26
VATB_CAEEL RecName: Full=Probable V-type proton ATPase subunit B...   110   4e-26
VATB1_HORVU RecName: Full=V-type proton ATPase subunit B 1;     ...   110   4e-26
SSAN_SALTY RecName: Full=Probable secretion system apparatus ATP...   110   4e-26
ATPB_TERTT RecName: Full=ATP synthase subunit beta;         EC=3...   110   4e-26
ATPB_SHESA RecName: Full=ATP synthase subunit beta;         EC=3...   110   4e-26
ATPB_PINTH RecName: Full=ATP synthase subunit beta, chloroplasti...   110   4e-26
ATPB_HYANO RecName: Full=ATP synthase subunit beta, chloroplasti...   110   4e-26
ATPB_CARPA RecName: Full=ATP synthase subunit beta, chloroplasti...   110   4e-26
ATPB_CALS8 RecName: Full=ATP synthase subunit beta;         EC=3...   110   4e-26
ATPB_BURM9 RecName: Full=ATP synthase subunit beta;         EC=3...   110   4e-26
ATPB_BARSC RecName: Full=ATP synthase subunit beta, chloroplasti...   110   4e-26
ATPB_ACTPJ RecName: Full=ATP synthase subunit beta;         EC=3...   110   4e-26
VATB2_TREPA RecName: Full=V-type ATP synthase beta chain 2;AltNa...   109   5e-26
ATPB_THIFE RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_SHESR RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_SCHME RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_PARL1 RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_OTHSI RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_MORIN RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_LACPU RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_HYAOR RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_GOSBA RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_DESDA RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_COXBU RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_COXBR RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_COXBN RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_BURCE RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_BOWVO RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
ATPB_AZOSE RecName: Full=ATP synthase subunit beta;         EC=3...   109   5e-26
ATPB_ACOCL RecName: Full=ATP synthase subunit beta, chloroplasti...   109   5e-26
VATB_HALWD RecName: Full=V-type ATP synthase beta chain;AltName:...   109   6e-26
ATPB_SOYBN RecName: Full=ATP synthase subunit beta, chloroplasti...   109   6e-26
ATPB_SHESM RecName: Full=ATP synthase subunit beta;         EC=3...   109   6e-26
ATPB_MANES RecName: Full=ATP synthase subunit beta, chloroplasti...   109   6e-26
ATPB_HALHL RecName: Full=ATP synthase subunit beta;         EC=3...   109   6e-26
ATPB_HAEDU RecName: Full=ATP synthase subunit beta;         EC=3...   109   6e-26
VATB_METS5 RecName: Full=V-type ATP synthase beta chain;AltName:...   108   8e-26
VATB1_GOSHI RecName: Full=V-type proton ATPase subunit B 1;     ...   108   8e-26
ATPB_SHEWM RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_SHEHH RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_PSEPK RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_PSEPF RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_PSEP1 RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_PLAOC RecName: Full=ATP synthase subunit beta, chloroplasti...   108   8e-26
ATPB_PIPCE RecName: Full=ATP synthase subunit beta, chloroplasti...   108   8e-26
ATPB_PINKO RecName: Full=ATP synthase subunit beta, chloroplasti...   108   8e-26
ATPB_HAES1 RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_ACTP7 RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB_ACTP2 RecName: Full=ATP synthase subunit beta;         EC=3...   108   8e-26
ATPB1_SHEFN RecName: Full=ATP synthase subunit beta 1;         E...   108   8e-26
VATB_NEUCR RecName: Full=V-type proton ATPase subunit B;        ...   108   1e-25
VATB_COPPD RecName: Full=V-type ATP synthase beta chain;AltName:...   108   1e-25
VATB2_METHJ RecName: Full=V-type ATP synthase beta chain 2;AltNa...   108   1e-25
ATPB_WHIBI RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_TROAR RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_SPIOL RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_PSEHT RecName: Full=ATP synthase subunit beta;         EC=3...   108   1e-25
ATPB_PICAB RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_LOTJA RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_DAUCA RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_BETVU RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_ALKMQ RecName: Full=ATP synthase subunit beta;         EC=3...   108   1e-25
ATPB_ACTSZ RecName: Full=ATP synthase subunit beta;         EC=3...   108   1e-25
ATPB2_MARMS RecName: Full=ATP synthase subunit beta 2;         E...   108   1e-25
VATB_HALLT RecName: Full=V-type ATP synthase beta chain;AltName:...   108   1e-25
ATPB_WHEAT RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_PSEU2 RecName: Full=ATP synthase subunit beta;         EC=3...   108   1e-25
ATPB_PSESM RecName: Full=ATP synthase subunit beta;         EC=3...   108   1e-25
ATPB_NICSY RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_NANDO RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_LOLPR RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_IDILO RecName: Full=ATP synthase subunit beta;         EC=3...   108   1e-25
ATPB_HORVU RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_CASSA RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_CAPBU RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_CALFL RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_AGRST RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_AEGCR RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
ATPB_AEGCO RecName: Full=ATP synthase subunit beta, chloroplasti...   108   1e-25
VATB2_HORVU RecName: Full=V-type proton ATPase subunit B 2;     ...   107   2e-25
NTPB_ENTHR RecName: Full=V-type sodium ATPase subunit B;AltName:...   107   2e-25
ATPB_VITVI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_RAPSA RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_PSEPW RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_PSEAE RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_PSEAB RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_PSEA8 RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_PSEA7 RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_POPTR RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_PHOTN RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_PHAVU RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_PELHO RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_NYMAL RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_MAIZE RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_LEUCK RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_FUSNN RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_DICNV RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_CITSI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_CALFG RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_ASPEL RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_ARAHI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
VATB_HYPBU RecName: Full=V-type ATP synthase beta chain;AltName:...   107   2e-25
VATB3_ARATH RecName: Full=V-type proton ATPase subunit B3;      ...   107   2e-25
ATPB_SOLLC RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_SHEDO RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_OLIPU RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_NICTO RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_NICPL RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_NICBI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_METFK RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_MESSB RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_MEDSA RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_LAWIP RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_IPOBA RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_EUCMO RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_EUCGG RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_EUCBI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_DRANE RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_DESPS RecName: Full=ATP synthase subunit beta;         EC=3...   107   2e-25
ATPB_CRUWA RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_BRASC RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_BARVE RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_ARATH RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_AETGR RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
ATPB_AETCO RecName: Full=ATP synthase subunit beta, chloroplasti...   107   2e-25
VATB_METS3 RecName: Full=V-type ATP synthase beta chain;AltName:...   107   3e-25
VATB_METBF RecName: Full=V-type ATP synthase beta chain;AltName:...   107   3e-25
VATB_METBA RecName: Full=V-type ATP synthase beta chain;AltName:...   107   3e-25
ATPB_SORBI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_SCEOB RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_SACOF RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_SACHY RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_PSEMY RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_PSEFS RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_PANGI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_ORYSJ RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_ORYSI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_ORYSA RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_ORYNI RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_NYMOD RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_NOVAD RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_NICSP RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_NASOF RecName: Full=ATP synthase subunit beta, chloroplasti...   107   3e-25
ATPB_HELPJ RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_HELPG RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_HAEPS RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_BACHD RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
ATPB_ALCBS RecName: Full=ATP synthase subunit beta;         EC=3...   107   3e-25
VATB_PYRCJ RecName: Full=V-type ATP synthase beta chain;AltName:...   106   4e-25
VATB_ANADE RecName: Full=V-type ATP synthase beta chain;AltName:...   106   4e-25
ATPB_SYNP6 RecName: Full=ATP synthase subunit beta;         EC=3...   106   4e-25
ATPB_SYNE7 RecName: Full=ATP synthase subunit beta;         EC=3...   106   4e-25
ATPB_SOLTU RecName: Full=ATP synthase subunit beta, chloroplasti...   106   4e-25
ATPB_SOLBU RecName: Full=ATP synthase subunit beta, chloroplasti...   106   4e-25
ATPB_LACBA RecName: Full=ATP synthase subunit beta;         EC=3...   106   4e-25
ATPB_IPOAQ RecName: Full=ATP synthase subunit beta, chloroplasti...   106   4e-25
ATPB_CUCSA RecName: Full=ATP synthase subunit beta, chloroplasti...   106   4e-25
ATPB_CLAMS RecName: Full=ATP synthase subunit beta;         EC=3...   106   4e-25
ATPB_ANGLY RecName: Full=ATP synthase subunit beta, chloroplasti...   106   4e-25
ATPB_ANATD RecName: Full=ATP synthase subunit beta;         EC=3...   106   4e-25
ATPB_ACAM1 RecName: Full=ATP synthase subunit beta;         EC=3...   106   4e-25
ATPBM_CHLRE RecName: Full=ATP synthase subunit beta, mitochondri...   106   4e-25
ATPB_WOLSU RecName: Full=ATP synthase subunit beta;         EC=3...   106   5e-25
ATPB_TOBAC RecName: Full=ATP synthase subunit beta, chloroplasti...   106   5e-25
ATPB_PSEPG RecName: Full=ATP synthase subunit beta;         EC=3...   106   5e-25
ATPB_LICGR RecName: Full=ATP synthase subunit beta, chloroplasti...   106   5e-25
ATPB_HAES2 RecName: Full=ATP synthase subunit beta;         EC=3...   106   5e-25
ATPB_DRIGR RecName: Full=ATP synthase subunit beta, chloroplasti...   106   5e-25
ATPB_DESAA RecName: Full=ATP synthase subunit beta;         EC=3...   106   5e-25
ATPB_DECAR RecName: Full=ATP synthase subunit beta;         EC=3...   106   5e-25
ATPB_CONMJ RecName: Full=ATP synthase subunit beta, chloroplasti...   106   5e-25
ATPB_CHRVO RecName: Full=ATP synthase subunit beta;         EC=3...   106   5e-25
ATPB_CHLSC RecName: Full=ATP synthase subunit beta, chloroplasti...   106   5e-25
ATPB_AGAAF RecName: Full=ATP synthase subunit beta, chloroplasti...   106   5e-25
VATB2_RAT RecName: Full=V-type proton ATPase subunit B, brain is...   105   7e-25
VATB2_PONAB RecName: Full=V-type proton ATPase subunit B, brain ...   105   7e-25
VATB2_MOUSE RecName: Full=V-type proton ATPase subunit B, brain ...   105   7e-25
VATB2_HUMAN RecName: Full=V-type proton ATPase subunit B, brain ...   105   7e-25
VATB2_BOVIN RecName: Full=V-type proton ATPase subunit B, brain ...   105   7e-25
ATPB_SCHSP RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_PSEF5 RecName: Full=ATP synthase subunit beta;         EC=3...   105   7e-25
ATPB_POLSJ RecName: Full=ATP synthase subunit beta;         EC=3...   105   7e-25
ATPB_NICRU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_MYRFG RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_MAGTR RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_LIRTU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_LEMMI RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_IPOPU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_HELP2 RecName: Full=ATP synthase subunit beta;         EC=3...   105   7e-25
ATPB_GALBE RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_CLOAB RecName: Full=ATP synthase subunit beta;         EC=3...   105   7e-25
ATPB_CINCA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_BUXMI RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_BRANA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   7e-25
ATPB_AZOSB RecName: Full=ATP synthase subunit beta;         EC=3...   105   7e-25
ATPB2_VIBHB RecName: Full=ATP synthase subunit beta 2;         E...   105   7e-25
VATB_CHICK RecName: Full=V-type proton ATPase subunit B;        ...   105   9e-25
ATPB_POPAL RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_OENPA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_OENGL RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_OENEH RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_OENBI RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_MONCA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_LACRJ RecName: Full=ATP synthase subunit beta;         EC=3...   105   9e-25
ATPB_LACRD RecName: Full=ATP synthase subunit beta;         EC=3...   105   9e-25
ATPB_IPOSE RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_IPOQU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_HELPY RecName: Full=ATP synthase subunit beta;         EC=3...   105   9e-25
ATPB_HELPH RecName: Full=ATP synthase subunit beta;         EC=3...   105   9e-25
ATPB_CRETR RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_COFAR RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_CANWI RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_CALSE RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_BEARE RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
ATPB_ANGEV RecName: Full=ATP synthase subunit beta, chloroplasti...   105   9e-25
VATB_METMA RecName: Full=V-type ATP synthase beta chain;AltName:...   105   1e-24
VATB_METBU RecName: Full=V-type ATP synthase beta chain;AltName:...   105   1e-24
ATPB_TRAFO RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_SALZA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_ROYRE RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_PHYPA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_NYPFR RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_LACSA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_IDIAU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_HYPCO RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_HYOLA RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_ELAOL RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_CONAR RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_COCNU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_CLAM3 RecName: Full=ATP synthase subunit beta;         EC=3...   105   1e-24
ATPB_CHLT3 RecName: Full=ATP synthase subunit beta;         EC=3...   105   1e-24
ATPB_CHASI RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_CHAHU RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_CALUS RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_BALSE RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
ATPB_ACRAL RecName: Full=ATP synthase subunit beta, chloroplasti...   105   1e-24
VATB_METLZ RecName: Full=V-type ATP synthase beta chain;AltName:...   104   1e-24
VATB_METAC RecName: Full=V-type ATP synthase beta chain;AltName:...   104   1e-24
VATB_CLOTH RecName: Full=V-type ATP synthase beta chain;AltName:...   104   1e-24
VATB_ANASK RecName: Full=V-type ATP synthase beta chain;AltName:...   104   1e-24
VATB_ANAD2 RecName: Full=V-type ATP synthase beta chain;AltName:...   104   1e-24
VATB1_HUMAN RecName: Full=V-type proton ATPase subunit B, kidney...   104   1e-24
ATPB_SYNJA RecName: Full=ATP synthase subunit beta;         EC=3...   104   1e-24
ATPB_IPOWR RecName: Full=ATP synthase subunit beta, chloroplasti...   104   1e-24
ATPB_HELAN RecName: Full=ATP synthase subunit beta, chloroplasti...   104   1e-24
ATPB_BACPF RecName: Full=ATP synthase subunit beta;         EC=3...   104   1e-24
ATPBM_NICPL RecName: Full=ATP synthase subunit beta, mitochondri...   104   1e-24
ATPB1_BURXL RecName: Full=ATP synthase subunit beta 1;         E...   104   1e-24
ATPB_SYNJB RecName: Full=ATP synthase subunit beta;         EC=3...   104   2e-24
ATPB_PHODC RecName: Full=ATP synthase subunit beta, chloroplasti...   104   2e-24
ATPB_PHAAO RecName: Full=ATP synthase subunit beta, chloroplasti...   104   2e-24
ATPB_MARPO RecName: Full=ATP synthase subunit beta, chloroplasti...   104   2e-24
ATPB_HELAH RecName: Full=ATP synthase subunit beta;         EC=3...   104   2e-24
ATPB_CUSJA RecName: Full=ATP synthase subunit beta, plastid;    ...   104   2e-24
ATPB_CHLRE RecName: Full=ATP synthase subunit beta, chloroplasti...   104   2e-24
ATPB_CERDE RecName: Full=ATP synthase subunit beta, chloroplasti...   104   2e-24
ATPBM_MAIZE RecName: Full=ATP synthase subunit beta, mitochondri...   104   2e-24
VATB_THEVO RecName: Full=V-type ATP synthase beta chain;AltName:...   103   3e-24
VATB1_BOVIN RecName: Full=V-type proton ATPase subunit B, kidney...   103   3e-24
ATPB_SARHE RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_PSEU5 RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_OENAR RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_MANSM RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_DIOEL RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_CHLLI RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_CHAGL RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_CARMI RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_ASACA RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_ALKOO RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_STRMK RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_STIHE RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_PROVI RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_PEA RecName: Full=ATP synthase subunit beta, chloroplastic;...   103   3e-24
ATPB_FERNB RecName: Full=ATP synthase subunit beta;         EC=3...   103   3e-24
ATPB_ARIMA RecName: Full=ATP synthase subunit beta, chloroplasti...   103   3e-24
ATPB_ANEMR RecName: Full=ATP synthase subunit beta, plastid;    ...   103   3e-24
ATPB_ZYGCR RecName: Full=ATP synthase subunit beta, chloroplasti...   103   4e-24
ATPB_PSEAK RecName: Full=ATP synthase subunit beta, chloroplasti...   103   4e-24
ATPB_POPTM RecName: Full=ATP synthase subunit beta, chloroplasti...   103   4e-24
ATPB_LYSSC RecName: Full=ATP synthase subunit beta;         EC=3...   103   4e-24
ATPB_LEPVR RecName: Full=ATP synthase subunit beta, chloroplasti...   103   4e-24
VATB_ANADF RecName: Full=V-type ATP synthase beta chain;AltName:...   102   6e-24
ATPB_STRM5 RecName: Full=ATP synthase subunit beta;         EC=3...   102   6e-24
ATPB_PSE14 RecName: Full=ATP synthase subunit beta;         EC=3...   102   6e-24
ATPB_LOBMA RecName: Full=ATP synthase subunit beta, chloroplasti...   102   6e-24
ATPB_CYAP8 RecName: Full=ATP synthase subunit beta;         EC=3...   102   6e-24
ATPB_BACCQ RecName: Full=ATP synthase subunit beta;         EC=3...   102   6e-24
ATPB_BACC7 RecName: Full=ATP synthase subunit beta;         EC=3...   102   6e-24
ATPB_BACC1 RecName: Full=ATP synthase subunit beta;         EC=3...   102   6e-24
ATPB_ATRBE RecName: Full=ATP synthase subunit beta, chloroplasti...   102   6e-24
ATPB_ADICA RecName: Full=ATP synthase subunit beta, chloroplasti...   102   6e-24
ATPBO_ARATH RecName: Full=ATP synthase subunit beta-3, mitochond...   102   6e-24
ATPBN_ARATH RecName: Full=ATP synthase subunit beta-2, mitochond...   102   6e-24
ATPBM_ORYSJ RecName: Full=ATP synthase subunit beta, mitochondri...   102   6e-24
ATPBM_ARATH RecName: Full=ATP synthase subunit beta-1, mitochond...   102   6e-24
ATPB_PROMH RecName: Full=ATP synthase subunit beta;         EC=3...   102   7e-24
ATPB_LEIXX RecName: Full=ATP synthase subunit beta;         EC=3...   102   7e-24
ATPB_LACPL RecName: Full=ATP synthase subunit beta;         EC=3...   102   7e-24
ATPB_IPOOB RecName: Full=ATP synthase subunit beta, chloroplasti...   102   7e-24
ATPB_DESVV RecName: Full=ATP synthase subunit beta;         EC=3...   102   7e-24
ATPB_DESVH RecName: Full=ATP synthase subunit beta;         EC=3...   102   7e-24
ATPB_CHAVU RecName: Full=ATP synthase subunit beta, chloroplasti...   102   7e-24
ATPB_STAES RecName: Full=ATP synthase subunit beta;         EC=3...   102   1e-23
ATPB_STAEQ RecName: Full=ATP synthase subunit beta;         EC=3...   102   1e-23
ATPB_PSEE4 RecName: Full=ATP synthase subunit beta;         EC=3...   102   1e-23
ATPB_LEPIN RecName: Full=ATP synthase subunit beta;         EC=3...   102   1e-23
ATPB_LEPIC RecName: Full=ATP synthase subunit beta;         EC=3...   102   1e-23
ATPB_HAEIG RecName: Full=ATP synthase subunit beta;         EC=3...   102   1e-23
ATPB1_POLNA RecName: Full=ATP synthase subunit beta 1;         E...   102   1e-23
VATB_DEIDV RecName: Full=V-type ATP synthase beta chain;AltName:...   101   1e-23
ATPB_YERPY RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPS RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPP RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPN RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPG RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPE RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPB RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERPA RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_YERP3 RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_SYNP1 RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_MYCHJ RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_MYCH7 RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_MYCGA RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_LACSS RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_GEOTH RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_GEOKA RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_CUSEX RecName: Full=ATP synthase subunit beta, plastid;    ...   101   1e-23
ATPB_CHRSD RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB_ANTFO RecName: Full=ATP synthase subunit beta, chloroplasti...   101   1e-23
ATPB_ACIAC RecName: Full=ATP synthase subunit beta;         EC=3...   101   1e-23
ATPB2_GLUOX RecName: Full=ATP synthase subunit beta 2;         E...   101   1e-23
FLII_RHIME RecName: Full=Flagellum-specific ATP synthase;       ...   101   2e-23
ATPB_THISH RecName: Full=ATP synthase subunit beta;         EC=3...   101   2e-23
ATPB_SYNS3 RecName: Full=ATP synthase subunit beta;         EC=3...   101   2e-23
ATPB_PROMO RecName: Full=ATP synthase subunit beta, sodium ion s...   101   2e-23
ATPB_MYCH2 RecName: Full=ATP synthase subunit beta;         EC=3...   101   2e-23
ATPB_CHLP8 RecName: Full=ATP synthase subunit beta;         EC=3...   101   2e-23
ATPB_BACSK RecName: Full=ATP synthase subunit beta;         EC=3...   101   2e-23
VATB_CLOD6 RecName: Full=V-type ATP synthase beta chain;AltName:...   100   2e-23
ATPB_PRODI RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_NOCSJ RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_NITSB RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_HAEIE RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_GEOUR RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_DIAST RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACP3 RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACHK RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACCZ RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACC3 RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACC0 RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACAN RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACAH RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACAC RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_BACAA RecName: Full=ATP synthase subunit beta;         EC=3...   100   2e-23
ATPB_SYNWW RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_SYNR3 RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_RHIE6 RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_PECFR RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_LEPBL RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_LEPBJ RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_CUSRE RecName: Full=ATP synthase subunit beta, plastid;    ...   100   3e-23
ATPB_BACCR RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_BACC4 RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB_ACISJ RecName: Full=ATP synthase subunit beta;         EC=3...   100   3e-23
ATPB2_CHLTE RecName: Full=ATP synthase subunit beta 2;         E...   100   3e-23
VATB_ENTFA RecName: Full=V-type ATP synthase beta chain;AltName:...   100   4e-23
VATB_DEIRA RecName: Full=V-type ATP synthase beta chain;AltName:...   100   4e-23
VATB_DEIGD RecName: Full=V-type ATP synthase beta chain;AltName:...   100   4e-23
ATPB_VESOH RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_THICR RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_PETMO RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_PELPB RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_NEIMB RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_MICAN RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_HAEIN RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_HAEI8 RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_ERWCT RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_BACCN RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPB_BACCA RecName: Full=ATP synthase subunit beta;         EC=3...   100   4e-23
ATPBM_DAUCA RecName: Full=ATP synthase subunit beta, mitochondri...   100   4e-23
ATPB1_PELLD RecName: Full=ATP synthase subunit beta 1;         E...   100   4e-23
VATB_NITOC RecName: Full=V-type ATP synthase beta chain;AltName:...   100   5e-23
ATPB_RUBXD RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
ATPB_METPP RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
ATPB_MARAV RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
ATPB_GEOSM RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
ATPB_FUCVE RecName: Full=ATP synthase subunit beta, chloroplasti...   100   5e-23
ATPB_BART1 RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
ATPB_AQUPY RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
ATPB_AERHH RecName: Full=ATP synthase subunit beta;         EC=3...   100   5e-23
VATB_METTP RecName: Full=V-type ATP synthase beta chain;AltName:...    99   6e-23
ATPB_SULNB RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_STACT RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_SINMW RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_RUTMC RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_MESVI RecName: Full=ATP synthase subunit beta, chloroplasti...    99   6e-23
ATPB_DEHSC RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_DEHSB RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_CHLCH RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
ATPB_BACWK RecName: Full=ATP synthase subunit beta;         EC=3...    99   6e-23
VATB_THET8 RecName: Full=V-type ATP synthase beta chain;AltName:...    99   8e-23
VATB_THET2 RecName: Full=V-type ATP synthase beta chain;AltName:...    99   8e-23
VATB_THEPX RecName: Full=V-type ATP synthase beta chain;AltName:...    99   8e-23
VATB_STAMF RecName: Full=V-type ATP synthase beta chain;AltName:...    99   8e-23
VATB_PLAFA RecName: Full=V-type proton ATPase subunit B;        ...    99   8e-23
ATPB_VANDA RecName: Full=ATP synthase subunit beta, chloroplasti...    99   8e-23
ATPB_THESQ RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_THEP1 RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_THEMA RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_HUPLU RecName: Full=ATP synthase subunit beta, chloroplasti...    99   8e-23
ATPB_GEOMG RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_DESDG RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_DEHE1 RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_CLOPH RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_BACC2 RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
ATPB_ANASP RecName: Full=ATP synthase subunit beta;         EC=3...    99   8e-23
VATB_THEP3 RecName: Full=V-type ATP synthase beta chain;AltName:...    99   1e-22
ATPB_SYNY3 RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_STAPU RecName: Full=ATP synthase subunit beta, chloroplasti...    99   1e-22
ATPB_PSINU RecName: Full=ATP synthase subunit beta, chloroplasti...    99   1e-22
ATPB_PASMU RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_NEIMF RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_NEIM0 RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_HERAU RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_DESVM RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_CYAP7 RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_COLP3 RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_CLOD6 RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_AQUAE RecName: Full=ATP synthase subunit beta;         EC=3...    99   1e-22
ATPB_TOLAT RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_SODGM RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_SALG2 RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_NEPOL RecName: Full=ATP synthase subunit beta, chloroplasti...    98   1e-22
ATPB_NAUPA RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_GEOSF RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_GEOBB RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_CARRP RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_BACA2 RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
ATPB_ANOFW RecName: Full=ATP synthase subunit beta;         EC=3...    98   1e-22
VATB2_GOSHI RecName: Full=V-type proton ATPase subunit B 2;     ...    98   2e-22
ATPB_TRIEI RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_THENN RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_SYNFM RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_RHISN RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_RHIME RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_PSYA2 RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_NEIG2 RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_NEIG1 RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB_CHLVU RecName: Full=ATP synthase subunit beta, chloroplasti...    98   2e-22
ATPB_CHLAD RecName: Full=ATP synthase subunit beta;         EC=3...    98   2e-22
ATPB2_PHOPR RecName: Full=ATP synthase subunit beta 2;         E...    98   2e-22
ATPB2_PELPD RecName: Full=ATP synthase subunit beta 2;         E...    98   2e-22
VATB_METMJ RecName: Full=V-type ATP synthase beta chain;AltName:...    97   2e-22
ATPB_VEREI RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_PSECV RecName: Full=ATP synthase subunit beta, chloroplasti...    97   2e-22
ATPB_PHOLL RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_PELUB RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_PECCP RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_MYCUA RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_MYCMM RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_GEOSL RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_DICDI RecName: Full=ATP synthase subunit beta, mitochondria...    97   2e-22
ATPB_CYAME RecName: Full=ATP synthase subunit beta, chloroplasti...    97   2e-22
ATPB_CLONN RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_CHLSY RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB_CHLAT RecName: Full=ATP synthase subunit beta, chloroplasti...    97   2e-22
ATPB_CHLAA RecName: Full=ATP synthase subunit beta;         EC=3...    97   2e-22
ATPB1_PELPD RecName: Full=ATP synthase subunit beta 1;         E...    97   2e-22
ATPB_YERE8 RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_THEFY RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_LEGPL RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_LEGPH RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_LEGPC RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_LEGPA RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_FRATM RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_EUGGR RecName: Full=ATP synthase subunit beta, chloroplasti...    97   3e-22
ATPB_CELJU RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_BACSU RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_ANAVT RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
ATPB_ACICJ RecName: Full=ATP synthase subunit beta;         EC=3...    97   3e-22
VATB_THEAC RecName: Full=V-type ATP synthase beta chain;AltName:...    97   4e-22
ATPB_VIBCM RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
ATPB_VIBCH RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
ATPB_VIBC3 RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
ATPB_KINRD RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
ATPB_FRASC RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
ATPB_CYAP4 RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
ATPB_CHLL2 RecName: Full=ATP synthase subunit beta;         EC=3...    97   4e-22
VATB_METST RecName: Full=V-type ATP synthase beta chain;AltName:...    96   5e-22
ATPB_SALTY RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALTI RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALSV RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALPC RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALPB RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALNS RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALHS RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALEP RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALDC RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALCH RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALAR RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_SALA4 RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_RHILW RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_RHDSA RecName: Full=ATP synthase subunit beta, chloroplasti...    96   5e-22
ATPB_PROWI RecName: Full=ATP synthase subunit beta, plastid;    ...    96   5e-22
ATPB_NOSP7 RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_NEIMA RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_IPOCC RecName: Full=ATP synthase subunit beta, chloroplasti...    96   5e-22
ATPB_ILLOL RecName: Full=ATP synthase subunit beta, chloroplasti...    96   5e-22
ATPB_ECOHS RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_CITK8 RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUSU RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUSI RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUO2 RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUME RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUC2 RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUAB RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB_BRUA2 RecName: Full=ATP synthase subunit beta;         EC=3...    96   5e-22
ATPB3_BURXL RecName: Full=ATP synthase subunit beta 3;         E...    96   5e-22
ATPB1_MYCPU RecName: Full=ATP synthase subunit beta 1;         E...    96   5e-22
VATB2_CLOTE RecName: Full=V-type ATP synthase beta chain 2;AltNa...    96   7e-22
ATPB_SHISS RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_SHIFL RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_SHIF8 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_SHIBS RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_SHIB3 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_SALPK RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_SALPA RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_RHIL3 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_HERA2 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_FRASN RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_FRAAA RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ESCF3 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOUT RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOSM RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOSE RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOLU RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOLI RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOLC RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOL6 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOL5 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOK1 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECODH RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECOBW RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO8A RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO81 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO7I RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO5E RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO57 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO55 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO45 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO27 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_ECO24 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_CHLPB RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_BORA1 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_BIFAA RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB_BACP2 RecName: Full=ATP synthase subunit beta;         EC=3...    96   7e-22
ATPB1_PSYIN RecName: Full=ATP synthase subunit beta 1;         E...    96   7e-22
ATPB1_LISMO RecName: Full=ATP synthase subunit beta 1;         E...    96   7e-22
VATB_HALSA RecName: Full=V-type ATP synthase beta chain;AltName:...    96   9e-22
VATB_HALS3 RecName: Full=V-type ATP synthase beta chain;AltName:...    96   9e-22
ATPB_XYLFT RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_XYLFA RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_XYLF2 RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_RHOBA RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_RALME RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_PSYCK RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_MYCTU RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_MYCTA RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_MYCBT RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_MYCBP RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_MYCBO RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_FRATN RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_BREBN RecName: Full=ATP synthase subunit beta;         EC=3...    96   9e-22
ATPB_SHIDS RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_PEDPA RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_FRATW RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_FRATT RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_FRAT1 RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_ENT38 RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_EDWI9 RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_BIFLO RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_BIFLD RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_ACIC5 RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_ACIC1 RecName: Full=ATP synthase subunit beta;         EC=3...    95   1e-21
ATPB_ACEWO RecName: Full=ATP synthase subunit beta, sodium ion s...    95   1e-21
ATPB1_RHOFD RecName: Full=ATP synthase subunit beta 1;         E...    95   1e-21
ATPB1_LISMF RecName: Full=ATP synthase subunit beta 1;         E...    95   1e-21
ATPB_RALEH RecName: Full=ATP synthase subunit beta;         EC=3...    95   2e-21
ATPB_CUPTR RecName: Full=ATP synthase subunit beta;         EC=3...    95   2e-21
ATPB_BACFI RecName: Full=ATP synthase subunit beta;         EC=3...    95   2e-21
ATPB_MYCA1 RecName: Full=ATP synthase subunit beta;         EC=3...    94   2e-21
ATPB_BORPD RecName: Full=ATP synthase subunit beta;         EC=3...    94   2e-21
ATPB_BIFLI RecName: Full=ATP synthase subunit beta;         EC=3...    94   2e-21
ATPB_BIFA0 RecName: Full=ATP synthase subunit beta;         EC=3...    94   2e-21
ATPB_BACST RecName: Full=ATP synthase subunit beta;         EC=3...    94   2e-21
ATPB_BACLD RecName: Full=ATP synthase subunit beta;         EC=3...    94   2e-21
ATPB_XYLFM RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_PORYE RecName: Full=ATP synthase subunit beta, chloroplasti...    94   3e-21
ATPB_OCEIH RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_KLEP3 RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_FERIS RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_CAMHC RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_BORPE RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIAD RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB2_PELCD RecName: Full=ATP synthase subunit beta 2;         E...    94   3e-21
ATPB1_MARMS RecName: Full=ATP synthase subunit beta 1;         E...    94   3e-21
ATPB1_CHLTE RecName: Full=ATP synthase subunit beta 1;         E...    94   3e-21
HRCN_PSESY RecName: Full=Type III secretion ATP synthase hrcN;  ...    94   3e-21
ATPB_TROWT RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_TROW8 RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_PROMA RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_MYCPA RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_KLEP7 RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_CYPCA RecName: Full=ATP synthase subunit beta, mitochondria...    94   3e-21
ATPB_CHLPD RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_BORPA RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_BORBR RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIBY RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIBT RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIBS RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIBC RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIB5 RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB_ACIB3 RecName: Full=ATP synthase subunit beta;         EC=3...    94   3e-21
ATPB1_LISW6 RecName: Full=ATP synthase subunit beta 1;         E...    94   3e-21
ATPB1_LISIN RecName: Full=ATP synthase subunit beta 1;         E...    94   3e-21
FLII_BUCAP RecName: Full=Flagellum-specific ATP synthase;       ...    93   5e-21
ATPB_SYNPW RecName: Full=ATP synthase subunit beta;         EC=3...    93   5e-21
ATPB_MAGSA RecName: Full=ATP synthase subunit beta;         EC=3...    93   5e-21
ATPB_HYPNA RecName: Full=ATP synthase subunit beta;         EC=3...    93   5e-21
ATPB_FRAP2 RecName: Full=ATP synthase subunit beta;         EC=3...    93   5e-21
ATPB_DROME RecName: Full=ATP synthase subunit beta, mitochondria...    93   5e-21
ATPB_ALTMD RecName: Full=ATP synthase subunit beta;         EC=3...    93   5e-21
ATPB2_BURPS RecName: Full=ATP synthase subunit beta 2;         E...    93   5e-21
ATPB2_BURP6 RecName: Full=ATP synthase subunit beta 2;         E...    93   5e-21
FLII_SALTY RecName: Full=Flagellum-specific ATP synthase;       ...    93   6e-21
ATPB_SERP5 RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB_PROM4 RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB_OCHNE RecName: Full=ATP synthase subunit beta, chloroplasti...    93   6e-21
ATPB_HEMPU RecName: Full=ATP synthase subunit beta, mitochondria...    93   6e-21
ATPB_GEOLS RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB_FRATO RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB_FRATH RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB_FRATF RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB_BAUCH RecName: Full=ATP synthase subunit beta;         EC=3...    93   6e-21
ATPB2_BURTA RecName: Full=ATP synthase subunit beta 2;         E...    93   6e-21
ATPB_SOLUE RecName: Full=ATP synthase subunit beta;         EC=3...    92   8e-21
ATPB_MACCJ RecName: Full=ATP synthase subunit beta;         EC=3...    92   8e-21
ATPB_LACDB RecName: Full=ATP synthase subunit beta;         EC=3...    92   8e-21
ATPB_LACDA RecName: Full=ATP synthase subunit beta;         EC=3...    92   8e-21
ATPB_CORK4 RecName: Full=ATP synthase subunit beta;         EC=3...    92   8e-21
ATPB2_BURP1 RecName: Full=ATP synthase subunit beta 2;         E...    92   8e-21
ATPB2_BURP0 RecName: Full=ATP synthase subunit beta 2;         E...    92   8e-21
ATPB_THEEB RecName: Full=ATP synthase subunit beta;         EC=3...    92   1e-20
ATPB_SPHWW RecName: Full=ATP synthase subunit beta;         EC=3...    92   1e-20
ATPB_PORPU RecName: Full=ATP synthase subunit beta, chloroplasti...    92   1e-20
ATPB_LEPTE RecName: Full=ATP synthase subunit beta, chloroplasti...    92   1e-20
ATPB_GRABC RecName: Full=ATP synthase subunit beta;         EC=3...    92   1e-20
ATPB_ERWT9 RecName: Full=ATP synthase subunit beta;         EC=3...    92   1e-20
ATPB2_SHEFN RecName: Full=ATP synthase subunit beta 2;         E...    92   1e-20
ATPB_AGRT5 RecName: Full=ATP synthase subunit beta;         EC=3...    92   1e-20
ATPB2_BURMS RecName: Full=ATP synthase subunit beta 2;         E...    92   1e-20
ATPB2_BURMA RecName: Full=ATP synthase subunit beta 2;         E...    92   1e-20
ATPB2_BURM7 RecName: Full=ATP synthase subunit beta 2;         E...    92   1e-20
ATPB1_NITMU RecName: Full=ATP synthase subunit beta 1;         E...    92   1e-20
ATPB_THEM4 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_RHILO RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_RAT RecName: Full=ATP synthase subunit beta, mitochondrial;...    91   2e-20
ATPB_RALEJ RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_PEPNI RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_MYCS2 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_MOUSE RecName: Full=ATP synthase subunit beta, mitochondria...    91   2e-20
ATPB_LACAC RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_ERYLH RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_ENTS8 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_CYACA RecName: Full=ATP synthase subunit beta, chloroplasti...    91   2e-20
ATPB_CUSSA RecName: Full=ATP synthase subunit beta, plastid;    ...    91   2e-20
ATPB_CUSPE RecName: Full=ATP synthase subunit beta, plastid;    ...    91   2e-20
ATPB_CUSOB RecName: Full=ATP synthase subunit beta, plastid;    ...    91   2e-20
ATPB_CUSGR RecName: Full=ATP synthase subunit beta, plastid;    ...    91   2e-20
ATPB_BDEBA RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_ANADF RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
FLII_BUCAI RecName: Full=Flagellum-specific ATP synthase;       ...    91   2e-20
ATPB_XANCP RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_XANCB RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_XANC8 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_SACD2 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_PROM9 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_OLTVI RecName: Full=ATP synthase subunit beta, chloroplasti...    91   2e-20
ATPB_OCHA4 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_MYCLE RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB_LACS1 RecName: Full=ATP synthase subunit beta;         EC=3...    91   2e-20
ATPB1_PHOPR RecName: Full=ATP synthase subunit beta 1;         E...    91   2e-20
ATPB_SYNSC RecName: Full=ATP synthase subunit beta;         EC=3...    91   3e-20
ATPB_PTEAQ RecName: Full=ATP synthase subunit beta, chloroplasti...    91   3e-20
ATPB_PSYWF RecName: Full=ATP synthase subunit beta;         EC=3...    91   3e-20
ATPB_LACH4 RecName: Full=ATP synthase subunit beta;         EC=3...    91   3e-20
ATPB_LACCB RecName: Full=ATP synthase subunit beta;         EC=3...    91   3e-20
ATPB_LACC3 RecName: Full=ATP synthase subunit beta;         EC=3...    91   3e-20
ATPBM_HEVBR RecName: Full=ATP synthase subunit beta, mitochondri...    91   3e-20
ATPB_VIBF1 RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_RALSO RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_PROMS RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_PROM0 RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_MYCVP RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_MYCPE RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_HUMAN RecName: Full=ATP synthase subunit beta, mitochondria...    90   4e-20
ATPB_ANADE RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
ATPB_ACHLI RecName: Full=ATP synthase subunit beta;         EC=3...    90   4e-20
VATA_METBF RecName: Full=V-type ATP synthase alpha chain;       ...    90   5e-20
HRCN_PSESH RecName: Full=Type III secretion ATP synthase hrcN;  ...    90   5e-20
ATPB_VIBFM RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_UREU1 RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_SYNPX RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_STAS1 RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_SPHAL RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_PROM3 RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_MYCSS RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_MYCSK RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_MYCSJ RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_BACME RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_ACIBL RecName: Full=ATP synthase subunit beta;         EC=3...    90   5e-20
ATPB_XANC5 RecName: Full=ATP synthase subunit beta;         EC=3...    89   7e-20
ATPB_SYNS9 RecName: Full=ATP synthase subunit beta;         EC=3...    89   7e-20
ATPB_MYCGI RecName: Full=ATP synthase subunit beta;         EC=3...    89   7e-20
ATPB_MAGSM RecName: Full=ATP synthase subunit beta;         EC=3...    89   7e-20
ATPB_CORU7 RecName: Full=ATP synthase subunit beta;         EC=3...    89   7e-20
ATPB_ARCB4 RecName: Full=ATP synthase subunit beta;         EC=3...    89   7e-20
ATPB1_NITEC RecName: Full=ATP synthase subunit beta 1;         E...    89   7e-20
FLII_CAUCR RecName: Full=Flagellum-specific ATP synthase;       ...    89   9e-20
FLII_CAUCN RecName: Full=Flagellum-specific ATP synthase;       ...    89   9e-20
ATPB_XANOR RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_XANOP RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_XANOM RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_VIBVY RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_VIBVU RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_THETN RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAW RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAT RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAS RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAR RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAN RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAM RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAE RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAC RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAAB RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAA9 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAA8 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAA3 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAA2 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_STAA1 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_PROMT RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_PROM2 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_PROM1 RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_MYXXD RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_LACCA RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_GEOSW RecName: Full=ATP synthase subunit beta;         EC=3...    89   9e-20
ATPB_LACLA RecName: Full=ATP synthase subunit beta;         EC=3...    89   1e-19
ATPB_ARTAT RecName: Full=ATP synthase subunit beta;         EC=3...    89   1e-19
ATPB2_RHOS1 RecName: Full=ATP synthase subunit beta 2;         E...    89   1e-19
ATPB2_BRASB RecName: Full=ATP synthase subunit beta 2;         E...    89   1e-19
VATB_ENCCU RecName: Full=V-type proton ATPase subunit B;        ...    88   1e-19
ATPB_VIBPA RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_THEAB RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_SULDN RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_SILST RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_PROMM RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_NITWN RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_GEOTN RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_EMIHU RecName: Full=ATP synthase subunit beta, chloroplasti...    88   1e-19
ATPB_CAMC1 RecName: Full=ATP synthase subunit beta;         EC=3...    88   1e-19
ATPB_BOVIN RecName: Full=ATP synthase subunit beta, mitochondria...    88   1e-19
VATB_METTL RecName: Full=V-type ATP synthase beta chain;AltName:...    88   2e-19
VATB_GEOUR RecName: Full=V-type ATP synthase beta chain;AltName:...    88   2e-19
HRCN_PSESM RecName: Full=Type III secretion ATP synthase hrcN;  ...    88   2e-19
ATPB_XANAC RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_UREPA RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_UREP2 RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_NITOC RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_MYCCT RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_DESHY RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_BARBK RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_ARTS2 RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_ANAPZ RecName: Full=ATP synthase subunit beta;         EC=3...    88   2e-19
ATPB_VIBAL RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_RHIEC RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_PROM5 RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_PARUW RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_NEOSM RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_LACLS RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_LACLM RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_DENPU RecName: Full=ATP synthase subunit beta, chloroplasti...    87   2e-19
ATPB_CORJK RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_BUCBP RecName: Full=ATP synthase subunit beta;         EC=3...    87   2e-19
ATPB_THAPS RecName: Full=ATP synthase subunit beta, chloroplasti...    87   3e-19
ATPB_RICPR RecName: Full=ATP synthase subunit beta;         EC=3...    87   3e-19
ATPB_DESHD RecName: Full=ATP synthase subunit beta;         EC=3...    87   3e-19
ATPB_BLOFL RecName: Full=ATP synthase subunit beta;         EC=3...    87   3e-19
ATPB_AERS4 RecName: Full=ATP synthase subunit beta;         EC=3...    87   3e-19
ATPA2_PIG RecName: Full=ATP synthase subunit alpha liver isoform...    87   3e-19
VATA_METBA RecName: Full=V-type ATP synthase alpha chain;       ...    87   4e-19
ATPB_PTEES RecName: Full=ATP synthase subunit beta, chloroplasti...    87   4e-19
ATPB_ODOSI RecName: Full=ATP synthase subunit beta, chloroplasti...    87   4e-19
ATPB_CORA7 RecName: Full=ATP synthase subunit beta;         EC=3...    87   4e-19
ATPB_CAMLR RecName: Full=ATP synthase subunit beta;         EC=3...    87   4e-19
ATPB_CAMFF RecName: Full=ATP synthase subunit beta;         EC=3...    87   4e-19
ATPB1_GLUOX RecName: Full=ATP synthase subunit beta 1;         E...    87   4e-19
ATPB_MYCMS RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_HELMI RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_CAMJR RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_CAMJJ RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_CAMJE RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_CAMJD RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_CAMJ8 RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
ATPB_BARQU RecName: Full=ATP synthase subunit beta;         EC=3...    86   6e-19
VATB_THENV RecName: Full=V-type ATP synthase beta chain;AltName:...    86   7e-19
ATPB_STAHJ RecName: Full=ATP synthase subunit beta;         EC=3...    86   7e-19
ATPB_NITEU RecName: Full=ATP synthase subunit beta;         EC=3...    86   7e-19
ATPB_LACJO RecName: Full=ATP synthase subunit beta;         EC=3...    86   7e-19
ATPB_LACGA RecName: Full=ATP synthase subunit beta;         EC=3...    86   7e-19
ATPB2_RHOS4 RecName: Full=ATP synthase subunit beta 2;         E...    86   7e-19
ATPB2_RHOFD RecName: Full=ATP synthase subunit beta 2;         E...    86   7e-19
ATPB2_LISW6 RecName: Full=ATP synthase subunit beta 2;         E...    86   7e-19
ATPB2_LISMO RecName: Full=ATP synthase subunit beta 2;         E...    86   7e-19
ATPB2_LISMF RecName: Full=ATP synthase subunit beta 2;         E...    86   7e-19
ATPB2_LISIN RecName: Full=ATP synthase subunit beta 2;         E...    86   7e-19
ATPB1_VIBHB RecName: Full=ATP synthase subunit beta 1;         E...    86   7e-19
ATPB_MYCS5 RecName: Full=ATP synthase subunit beta;         EC=3...    86   9e-19
ATPB_GALSU RecName: Full=ATP synthase subunit beta, chloroplasti...    86   9e-19
ATPB_CAUCR RecName: Full=ATP synthase subunit beta;         EC=3...    86   9e-19
ATPB_CAEEL RecName: Full=ATP synthase subunit beta, mitochondria...    86   9e-19
ATPB_BUCAT RecName: Full=ATP synthase subunit beta;         EC=3...    86   9e-19
ATPB_BUCAI RecName: Full=ATP synthase subunit beta;         EC=3...    86   9e-19
ATPB_BUCA5 RecName: Full=ATP synthase subunit beta;         EC=3...    86   9e-19
ATPB2_DINSH RecName: Full=ATP synthase subunit beta 2;         E...    86   9e-19
ATPB_WIGBR RecName: Full=ATP synthase subunit beta;         EC=3...    85   1e-18
ATPB_RICTY RecName: Full=ATP synthase subunit beta;         EC=3...    85   1e-18
ATPB_PHATR RecName: Full=ATP synthase subunit beta, chloroplasti...    85   1e-18
ATPB_STRU0 RecName: Full=ATP synthase subunit beta;         EC=3...    85   2e-18
ATPB_PROMP RecName: Full=ATP synthase subunit beta;         EC=3...    85   2e-18
ATPB_ORITI RecName: Full=ATP synthase subunit beta;         EC=3...    85   2e-18
ATPB_STRSV RecName: Full=ATP synthase subunit beta;         EC=3...    84   2e-18
ATPB_RHOSR RecName: Full=ATP synthase subunit beta;         EC=3...    84   2e-18
ATPB_RHOOB RecName: Full=ATP synthase subunit beta;         EC=3...    84   2e-18
ATPB_ORITB RecName: Full=ATP synthase subunit beta;         EC=3...    84   2e-18
ATPB_DICAN RecName: Full=ATP synthase subunit beta, chloroplasti...    84   2e-18
ATPB_CHICK RecName: Full=ATP synthase subunit beta, mitochondria...    84   2e-18
ATPB_CAMC5 RecName: Full=ATP synthase subunit beta;         EC=3...    84   2e-18
ATPB_BRASO RecName: Full=ATP synthase subunit beta;         EC=3...    84   2e-18
ATPB1_RHOS4 RecName: Full=ATP synthase subunit beta 1;         E...    84   2e-18
ATPB1_RHOS1 RecName: Full=ATP synthase subunit beta 1;         E...    84   2e-18
ATPB1_BRASB RecName: Full=ATP synthase subunit beta 1;         E...    84   2e-18
VATA1_METHJ RecName: Full=V-type ATP synthase alpha chain 1;    ...    84   3e-18
ATPB_STRS7 RecName: Full=ATP synthase subunit beta;         EC=3...    84   3e-18
ATPB_STREM RecName: Full=ATP synthase subunit beta;         EC=3...    84   3e-18
ATPB_STRE4 RecName: Full=ATP synthase subunit beta;         EC=3...    84   3e-18
ATPB_RHOPB RecName: Full=ATP synthase subunit beta;         EC=3...    84   3e-18
ATPB_RHOP2 RecName: Full=ATP synthase subunit beta;         EC=3...    84   3e-18
ATPB_PYLLI RecName: Full=ATP synthase subunit beta, chloroplasti...    84   3e-18
ATPB_GUITH RecName: Full=ATP synthase subunit beta, chloroplasti...    84   3e-18
ATPB_GLOVI RecName: Full=ATP synthase subunit beta;         EC=3...    84   3e-18
ATPB_ADIRA RecName: Full=ATP synthase subunit beta, chloroplasti...    84   3e-18
VATA_ANASK RecName: Full=V-type ATP synthase alpha chain;       ...    84   4e-18
ATPB_RHOPA RecName: Full=ATP synthase subunit beta;         EC=3...    84   4e-18
ATPB_MICSZ RecName: Full=ATP synthase subunit beta, chloroplasti...    84   4e-18
ATPB_JANMA RecName: Full=ATP synthase subunit beta;         EC=3...    84   4e-18
ATPB_COREF RecName: Full=ATP synthase subunit beta;         EC=3...    84   4e-18
ATPB_BRAJA RecName: Full=ATP synthase subunit beta;         EC=3...    84   4e-18
ATPB_ARTCA RecName: Full=ATP synthase subunit beta;         EC=3...    84   4e-18
VATB_PYRIL RecName: Full=V-type ATP synthase beta chain;AltName:...    83   5e-18
ATPB_SILPO RecName: Full=ATP synthase subunit beta;         EC=3...    83   5e-18
ATPB_RHOS5 RecName: Full=ATP synthase subunit beta;         EC=3...    83   5e-18
ATPB_RHORU RecName: Full=ATP synthase subunit beta;         EC=3...    83   5e-18
ATPB_RHORT RecName: Full=ATP synthase subunit beta;         EC=3...    83   5e-18
ATPB_BUCAP RecName: Full=ATP synthase subunit beta;         EC=3...    83   5e-18
VATA2_METHJ RecName: Full=V-type ATP synthase alpha chain 2;    ...    83   6e-18
ATPB_STRZP RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRZJ RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRT2 RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRR6 RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRPS RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRPN RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRPJ RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRPI RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRP7 RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRP4 RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_STRP2 RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
ATPB_HERAR RecName: Full=ATP synthase subunit beta;         EC=3...    83   6e-18
VATA_HALMA RecName: Full=V-type ATP synthase alpha chain;       ...    82   8e-18
ATPB_STRZT RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_STRTD RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_STRT1 RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_STRA5 RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_STRA1 RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_RHOPS RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_RHOP5 RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
ATPB_RHOCA RecName: Full=ATP synthase subunit beta;         EC=3...    82   8e-18
VATB_PYRAR RecName: Full=V-type ATP synthase beta chain;AltName:...    82   1e-17
VATA_METMA RecName: Full=V-type ATP synthase alpha chain;       ...    82   1e-17
ATPB_OSTTA RecName: Full=ATP synthase subunit beta, chloroplasti...    82   1e-17
ATPB_METCA RecName: Full=ATP synthase subunit beta;         EC=3...    82   1e-17
ATPB_CORDI RecName: Full=ATP synthase subunit beta;         EC=3...    82   1e-17
VATA_METBU RecName: Full=V-type ATP synthase alpha chain;       ...    82   1e-17
VATA_HALSA RecName: Full=V-type ATP synthase alpha chain;       ...    82   1e-17
VATA_HALS3 RecName: Full=V-type ATP synthase alpha chain;       ...    82   1e-17
ATPB_STRGC RecName: Full=ATP synthase subunit beta;         EC=3...    82   1e-17
ATPB_ROSDO RecName: Full=ATP synthase subunit beta;         EC=3...    82   1e-17
ATPB_PROAC RecName: Full=ATP synthase subunit beta;         EC=3...    82   1e-17
ATPB_CYAPA RecName: Full=ATP synthase subunit beta, cyanelle;   ...    82   1e-17
ATPB_ANAMM RecName: Full=ATP synthase subunit beta;         EC=3...    82   1e-17
ATPB_STRMU RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRA3 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_SORC5 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_RHOE4 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_MESFL RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
VATB_BORGA RecName: Full=V-type ATP synthase beta chain;AltName:...    81   2e-17
VATB_BORAP RecName: Full=V-type ATP synthase beta chain;AltName:...    81   2e-17
VATB1_TREPA RecName: Full=V-type ATP synthase beta chain 1;AltNa...    81   2e-17
VATA_NITOC RecName: Full=V-type ATP synthase alpha chain;       ...    81   2e-17
VATA_ANAD2 RecName: Full=V-type ATP synthase alpha chain;       ...    81   2e-17
ATPB_STRPM RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRPG RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRPF RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRPD RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRPC RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRPB RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRP8 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRP6 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRP3 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_STRP1 RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_SALAI RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_RHOBL RecName: Full=ATP synthase subunit beta;         EC=3...    81   2e-17
ATPB_RICRS RecName: Full=ATP synthase subunit beta;         EC=3...    80   3e-17
ATPB_RICRO RecName: Full=ATP synthase subunit beta;         EC=3...    80   3e-17
ATPB_RICPU RecName: Full=ATP synthase subunit beta;         EC=3...    80   3e-17
ATPB_RICM5 RecName: Full=ATP synthase subunit beta;         EC=3...    80   3e-17
ATPB_RICAE RecName: Full=ATP synthase subunit beta;         EC=3...    80   3e-17
VATB_BORHD RecName: Full=V-type ATP synthase beta chain;AltName:...    80   4e-17
VATA_SULIM RecName: Full=V-type ATP synthase alpha chain;       ...    80   4e-17
VATA_SULIL RecName: Full=V-type ATP synthase alpha chain;       ...    80   4e-17
VATA_SULIK RecName: Full=V-type ATP synthase alpha chain;       ...    80   4e-17
VATA_SULIA RecName: Full=V-type ATP synthase alpha chain;       ...    80   4e-17
ATPB_MARMM RecName: Full=ATP synthase subunit beta;         EC=3...    80   4e-17
ATPB_CORGL RecName: Full=ATP synthase subunit beta;         EC=3...    80   4e-17
ATPB_CORGB RecName: Full=ATP synthase subunit beta;         EC=3...    80   4e-17
ATPB_ALISL RecName: Full=ATP synthase subunit beta;         EC=3...    80   4e-17
ATPB2_PELLD RecName: Full=ATP synthase subunit beta 2;         E...    80   4e-17
VATB_BORT9 RecName: Full=V-type ATP synthase beta chain;AltName:...    80   5e-17
VATA_SULIN RecName: Full=V-type ATP synthase alpha chain;       ...    80   5e-17
VATA_NATPD RecName: Full=V-type ATP synthase alpha chain;       ...    80   5e-17
VATA_METAC RecName: Full=V-type ATP synthase alpha chain;       ...    80   5e-17
ATPB_XANP2 RecName: Full=ATP synthase subunit beta;         EC=3...    80   5e-17
ATPB_SALTO RecName: Full=ATP synthase subunit beta;         EC=3...    80   5e-17
ATPB_RICCN RecName: Full=ATP synthase subunit beta;         EC=3...    80   5e-17
ATPB_GLUDA RecName: Full=ATP synthase subunit beta;         EC=3...    80   5e-17
VATB_TREDE RecName: Full=V-type ATP synthase beta chain;AltName:...    79   7e-17
ATPB_ZYMMO RecName: Full=ATP synthase subunit beta;         EC=3...    79   7e-17
ATPB_RICCK RecName: Full=ATP synthase subunit beta;         EC=3...    79   7e-17
ATPB_RICAH RecName: Full=ATP synthase subunit beta;         EC=3...    79   7e-17
ATPB_BIGNA RecName: Full=ATP synthase subunit beta, chloroplasti...    79   7e-17
ATPB_BARHE RecName: Full=ATP synthase subunit beta;         EC=3...    79   7e-17
VATB_BORBZ RecName: Full=V-type ATP synthase beta chain;AltName:...    79   9e-17
VATB_BORBU RecName: Full=V-type ATP synthase beta chain;AltName:...    79   9e-17
VATA_SULIY RecName: Full=V-type ATP synthase alpha chain;       ...    79   9e-17
ATPB_BLOPB RecName: Full=ATP synthase subunit beta;         EC=3...    79   9e-17
ATPB_AZOC5 RecName: Full=ATP synthase subunit beta;         EC=3...    79   9e-17
ATPB2_NITMU RecName: Full=ATP synthase subunit beta 2;         E...    79   9e-17
ATPB_STRSY RecName: Full=ATP synthase subunit beta;         EC=3...    79   1e-16
ATPB_STRS2 RecName: Full=ATP synthase subunit beta;         EC=3...    79   1e-16
ATPB_STRPZ RecName: Full=ATP synthase subunit beta;         EC=3...    79   1e-16
ATPB_MYCMO RecName: Full=ATP synthase subunit beta;         EC=3...    79   1e-16
ATPB_AMOA5 RecName: Full=ATP synthase subunit beta;         EC=3...    79   1e-16
ATPB2_POLNA RecName: Full=ATP synthase subunit beta 2;         E...    79   1e-16
VATA_ANADF RecName: Full=V-type ATP synthase alpha chain;       ...    78   2e-16
ATPB_CAUSK RecName: Full=ATP synthase subunit beta;         EC=3...    78   2e-16
ATPB2_PSYIN RecName: Full=ATP synthase subunit beta 2;         E...    78   2e-16
VATA_PYRIL RecName: Full=V-type ATP synthase alpha chain;       ...    78   2e-16
VATA_NANEQ RecName: Full=V-type ATP synthase alpha chain;       ...    78   2e-16
ATPB_MICPL RecName: Full=ATP synthase subunit beta, chloroplasti...    78   2e-16
ATPB_CYTLY RecName: Full=ATP synthase subunit beta;         EC=3...    78   2e-16
VATA_SULSO RecName: Full=V-type ATP synthase alpha chain;       ...    77   3e-16
VATA_HYPBU RecName: Full=V-type ATP synthase alpha chain;       ...    77   3e-16
VATA_ANADE RecName: Full=V-type ATP synthase alpha chain;       ...    77   3e-16
FLII_AQUAE RecName: Full=Flagellum-specific ATP synthase;       ...    77   3e-16
ATPB_NOCFA RecName: Full=ATP synthase subunit beta;         EC=3...    77   3e-16
ATPB_BLEOC RecName: Full=ATP synthase subunit beta, chloroplasti...    77   3e-16
ATPB_AZOPC RecName: Full=ATP synthase subunit beta;         EC=3...    77   3e-16
VATA_STRZJ RecName: Full=V-type ATP synthase alpha chain;       ...    77   4e-16
VATA_STRPN RecName: Full=V-type ATP synthase alpha chain;       ...    77   4e-16
VATA_STRPJ RecName: Full=V-type ATP synthase alpha chain;       ...    77   4e-16
VATA_STAMF RecName: Full=V-type ATP synthase alpha chain;       ...    77   4e-16
VATA_HALVO RecName: Full=V-type ATP synthase alpha chain;       ...    77   4e-16
ATPB_ENTFA RecName: Full=ATP synthase subunit beta;         EC=3...    77   4e-16
VATA_STRP4 RecName: Full=V-type ATP synthase alpha chain;       ...    76   7e-16
VATA_HALWD RecName: Full=V-type ATP synthase alpha chain;       ...    76   7e-16
VATA_PYRCJ RecName: Full=V-type ATP synthase alpha chain;       ...    75   1e-15
VATA_ARCFU RecName: Full=V-type ATP synthase alpha chain;       ...    75   1e-15
ATPB_STRGG RecName: Full=ATP synthase subunit beta;         EC=3...    75   1e-15
ATPB_NITHX RecName: Full=ATP synthase subunit beta;         EC=3...    75   1e-15
ATPB_EHRRW RecName: Full=ATP synthase subunit beta;         EC=3...    75   1e-15
ATPB_EHRRG RecName: Full=ATP synthase subunit beta;         EC=3...    75   1e-15
VATA_STRPI RecName: Full=V-type ATP synthase alpha chain;       ...    75   1e-15
VATA_PYRAE RecName: Full=V-type ATP synthase alpha chain;       ...    75   1e-15
VATA_THENV RecName: Full=V-type ATP synthase alpha chain;       ...    75   2e-15
VATA_SULAC RecName: Full=V-type ATP synthase alpha chain;       ...    75   2e-15
VATA_METLZ RecName: Full=V-type ATP synthase alpha chain;       ...    75   2e-15
ATPB_GRAFK RecName: Full=ATP synthase subunit beta;         EC=3...    75   2e-15
ATPB_ENTHR RecName: Full=ATP synthase subunit beta;         EC=3...    75   2e-15
VATA_THET8 RecName: Full=V-type ATP synthase alpha chain;       ...    74   2e-15
VATA_THET2 RecName: Full=V-type ATP synthase alpha chain;       ...    74   2e-15
VATA_PYRAR RecName: Full=V-type ATP synthase alpha chain;       ...    74   2e-15
VATA_METKA RecName: Full=V-type ATP synthase alpha chain;       ...    74   2e-15
ATPB_STRLI RecName: Full=ATP synthase subunit beta;         EC=3...    74   2e-15
ATPB_STRCO RecName: Full=ATP synthase subunit beta;         EC=3...    74   2e-15
VATA_METMJ RecName: Full=V-type ATP synthase alpha chain;       ...    74   3e-15
VATA1_CLOTE RecName: Full=V-type ATP synthase alpha chain 1;    ...    74   3e-15
ATPB_RENSM RecName: Full=ATP synthase subunit beta;         EC=3...    74   4e-15
ATPB_OLICO RecName: Full=ATP synthase subunit beta;         EC=3...    74   4e-15
VATA_SULTO RecName: Full=V-type ATP synthase alpha chain;       ...    73   5e-15
VATA_METS5 RecName: Full=V-type ATP synthase alpha chain;       ...    73   5e-15
VATA3_METHJ RecName: Full=V-type ATP synthase alpha chain 3;    ...    73   5e-15
ATPB_DICDH RecName: Full=ATP synthase subunit beta, chloroplasti...    73   5e-15
ATPB_BACV8 RecName: Full=ATP synthase subunit beta;         EC=3...    73   5e-15
NTPA_ENTHR RecName: Full=V-type sodium ATPase catalytic subunit ...    73   6e-15
ATPB_RICFE RecName: Full=ATP synthase subunit beta;         EC=3...    73   6e-15
VATA_METB6 RecName: Full=V-type ATP synthase alpha chain;       ...    72   1e-14
ATPB_WOLWR RecName: Full=ATP synthase subunit beta;         EC=3...    72   1e-14
ATPB_PARDP RecName: Full=ATP synthase subunit beta;         EC=3...    72   1e-14
ATPB_FLAPJ RecName: Full=ATP synthase subunit beta;         EC=3...    72   1e-14
VATA_IGNH4 RecName: Full=V-type ATP synthase alpha chain;       ...    72   1e-14
ATPB_WOLPM RecName: Full=ATP synthase subunit beta;         EC=3...    71   2e-14
ATPB1_PSEA6 RecName: Full=ATP synthase subunit beta 1;         E...    71   2e-14
VATA_STRSV RecName: Full=V-type ATP synthase alpha chain;       ...    71   2e-14
VATA_STRGC RecName: Full=V-type ATP synthase alpha chain;       ...    71   2e-14
VATA2_CLOTE RecName: Full=V-type ATP synthase alpha chain 2;    ...    71   2e-14
ATPB_RICB8 RecName: Full=ATP synthase subunit beta;         EC=3...    71   2e-14
ATPB_FLAJ1 RecName: Full=ATP synthase subunit beta;         EC=3...    71   2e-14
VATA_THEGJ RecName: Full=V-type ATP synthase alpha chain;       ...    70   3e-14
VATA_ENTFA RecName: Full=V-type ATP synthase alpha chain;       ...    70   3e-14
VATA_DESSY RecName: Full=V-type ATP synthase alpha chain;       ...    70   3e-14
VATA_DEIGD RecName: Full=V-type ATP synthase alpha chain;       ...    70   3e-14
VATA_CLOTH RecName: Full=V-type ATP synthase alpha chain;       ...    70   3e-14
VATA1_TREPA RecName: Full=V-type ATP synthase alpha chain 1;    ...    70   3e-14
ATPB_WOLPP RecName: Full=ATP synthase subunit beta;         EC=3...    70   3e-14
ATPB_GRATL RecName: Full=ATP synthase subunit beta, chloroplasti...    70   3e-14
VATB_PYRAE RecName: Full=V-type ATP synthase beta chain;AltName:...    70   4e-14
VATA_NITMS RecName: Full=V-type ATP synthase alpha chain;       ...    70   4e-14
ATPB_STRAW RecName: Full=ATP synthase subunit beta;         EC=3...    70   4e-14
VATA_UNCMA RecName: Full=V-type ATP synthase alpha chain;       ...    70   5e-14
VATA_CLOBM RecName: Full=V-type ATP synthase alpha chain;       ...    70   5e-14
VATA_CLOBL RecName: Full=V-type ATP synthase alpha chain;       ...    70   5e-14
VATA_CLOBK RecName: Full=V-type ATP synthase alpha chain;       ...    70   5e-14
VATA_STRP8 RecName: Full=V-type ATP synthase alpha chain;       ...    69   7e-14
VATA_ASHGO RecName: Full=V-type proton ATPase catalytic subunit ...    69   7e-14
VATA_STRPM RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRPG RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRPF RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRPD RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRPC RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRPB RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRP6 RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_STRP1 RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_PARUW RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
VATA_CLOD6 RecName: Full=V-type ATP synthase alpha chain;       ...    69   9e-14
ATPB_RICBR RecName: Full=ATP synthase subunit beta;         EC=3...    69   9e-14
VATA_THESM RecName: Full=V-type ATP synthase alpha chain;       ...    69   1e-13
VATA_THESI RecName: Full=V-type ATP synthase alpha chain;       ...    69   1e-13
VATA_STRPZ RecName: Full=V-type ATP synthase alpha chain;       ...    69   1e-13
VATA_STRP3 RecName: Full=V-type ATP synthase alpha chain;       ...    69   1e-13
VATA_PYRKO RecName: Full=V-type ATP synthase alpha chain;       ...    69   1e-13
VATA_GOSHI RecName: Full=V-type proton ATPase catalytic subunit ...    69   1e-13
ATPB_EHRCJ RecName: Full=ATP synthase subunit beta;         EC=3...    69   1e-13
VATB_CHLFF RecName: Full=V-type ATP synthase beta chain;AltName:...    68   2e-13
VATA_DEIRA RecName: Full=V-type ATP synthase alpha chain;       ...    68   2e-13
VATA2_TREPA RecName: Full=V-type ATP synthase alpha chain 2;    ...    68   2e-13
ATPB_EHRCR RecName: Full=ATP synthase subunit beta;         EC=3...    68   2e-13
VATA_HALOH RecName: Full=V-type ATP synthase alpha chain;       ...    68   2e-13
VATB_CHLCV RecName: Full=V-type ATP synthase beta chain;AltName:...    67   3e-13
VATA_THEPX RecName: Full=V-type ATP synthase alpha chain;       ...    67   3e-13
VATA_THEP3 RecName: Full=V-type ATP synthase alpha chain;       ...    67   3e-13
VATA_THEON RecName: Full=V-type ATP synthase alpha chain;       ...    67   3e-13
VATA_CLOBH RecName: Full=V-type ATP synthase alpha chain;       ...    67   3e-13
VATA_CLOB1 RecName: Full=V-type ATP synthase alpha chain;       ...    67   3e-13
VATB_CHLAB RecName: Full=V-type ATP synthase beta chain;AltName:...    67   3e-13
ATPB_BACFR RecName: Full=ATP synthase subunit beta;         EC=3...    67   3e-13
ATPB_BACFN RecName: Full=ATP synthase subunit beta;         EC=3...    67   3e-13
VATA_DEIDV RecName: Full=V-type ATP synthase alpha chain;       ...    67   5e-13
VATA_PLAFA RecName: Full=V-type proton ATPase catalytic subunit ...    66   8e-13
VATA_PLAF7 RecName: Full=V-type proton ATPase catalytic subunit ...    66   8e-13
VATA_METTP RecName: Full=V-type ATP synthase alpha chain;       ...    66   8e-13
VATA_METM7 RecName: Full=V-type ATP synthase alpha chain;       ...    66   8e-13
ATPB_PARD8 RecName: Full=ATP synthase subunit beta;         EC=3...    66   8e-13
VATA_METST RecName: Full=V-type ATP synthase alpha chain;       ...    65   1e-12
VATA_BORBZ RecName: Full=V-type ATP synthase alpha chain;       ...    65   1e-12
VATA_BORBU RecName: Full=V-type ATP synthase alpha chain;       ...    65   1e-12
VATA_METS3 RecName: Full=V-type ATP synthase alpha chain;       ...    65   2e-12
VATA_DICDI RecName: Full=V-type proton ATPase catalytic subunit ...    65   2e-12
VATA_CLOBB RecName: Full=V-type ATP synthase alpha chain;       ...    65   2e-12
VATA_BETVU RecName: Full=V-type proton ATPase catalytic subunit ...    65   2e-12
VATA_BORGA RecName: Full=V-type ATP synthase alpha chain;       ...    64   2e-12
VATA_PHAAU RecName: Full=V-type proton ATPase catalytic subunit ...    64   3e-12
VATA_CLOBA RecName: Full=V-type ATP synthase alpha chain;       ...    64   3e-12
ATPB_SULMW RecName: Full=ATP synthase subunit beta;         EC=3...    64   3e-12
VATA_SCHPO RecName: Full=V-type proton ATPase catalytic subunit ...    64   4e-12
VATA_HORVU RecName: Full=V-type proton ATPase catalytic subunit ...    64   4e-12
VATB_CHLPN RecName: Full=V-type ATP synthase beta chain;AltName:...    63   5e-12
VATA_METMP RecName: Full=V-type ATP synthase alpha chain;       ...    63   5e-12
VATA_METM6 RecName: Full=V-type ATP synthase alpha chain;       ...    63   5e-12
VATA_METJA RecName: Full=V-type ATP synthase alpha chain;       ...    63   5e-12
VATA_BORAP RecName: Full=V-type ATP synthase alpha chain;       ...    63   5e-12
ATPB_BACTN RecName: Full=ATP synthase subunit beta;         EC=3...    63   5e-12
VATA_TRYCO RecName: Full=V-type proton ATPase catalytic subunit ...    63   7e-12
VATA_METVS RecName: Full=V-type ATP synthase alpha chain;       ...    63   7e-12
VATA_MAIZE RecName: Full=V-type proton ATPase catalytic subunit ...    63   7e-12
VATA_CITUN RecName: Full=V-type proton ATPase catalytic subunit ...    63   7e-12
VATA_BORHD RecName: Full=V-type ATP synthase alpha chain;       ...    63   7e-12
ATPB_LEPBP RecName: Full=ATP synthase subunit beta;         EC=3...    63   7e-12
ATPB_LEPBA RecName: Full=ATP synthase subunit beta;         EC=3...    63   7e-12
VATA_TREDE RecName: Full=V-type ATP synthase alpha chain;       ...    62   9e-12
VATA_THEVO RecName: Full=V-type ATP synthase alpha chain;       ...    62   9e-12
VATA_METM5 RecName: Full=V-type ATP synthase alpha chain;       ...    62   9e-12
VATA_BORT9 RecName: Full=V-type ATP synthase alpha chain;       ...    62   9e-12
VATA_PYRFU RecName: Full=V-type ATP synthase alpha chain;       ...    62   1e-11
VATA_DAUCA RecName: Full=V-type proton ATPase catalytic subunit ...    62   1e-11
VATA_BRANA RecName: Full=V-type proton ATPase catalytic subunit ...    62   1e-11
VATA2_ACEAT RecName: Full=V-type proton ATPase catalytic subunit...    62   1e-11
VATA1_DROME RecName: Full=V-type proton ATPase catalytic subunit...    62   1e-11
VATA1_ACEAT RecName: Full=V-type proton ATPase catalytic subunit...    62   1e-11
VATA_METTH RecName: Full=V-type ATP synthase alpha chain;       ...    62   1e-11
VATA_META3 RecName: Full=V-type ATP synthase alpha chain;       ...    62   1e-11
VATA_ENCCU RecName: Full=V-type proton ATPase catalytic subunit ...    62   1e-11
VATA_AEDAL RecName: Full=V-type proton ATPase catalytic subunit ...    62   1e-11
VATA_AEDAE RecName: Full=V-type proton ATPase catalytic subunit ...    62   1e-11
VATA2_DROME RecName: Full=V-type proton ATPase catalytic subunit...    62   1e-11
VATB_CHLMU RecName: Full=V-type ATP synthase beta chain;AltName:...    61   2e-11
VATA_THEAC RecName: Full=V-type ATP synthase alpha chain;       ...    61   2e-11
VATA_NEUCR RecName: Full=V-type proton ATPase catalytic subunit ...    61   2e-11
VATA_MANSE RecName: Full=V-type proton ATPase catalytic subunit ...    61   2e-11
VATA_ARATH RecName: Full=V-type proton ATPase catalytic subunit ...    61   2e-11
ATPB_JANSC RecName: Full=ATP synthase subunit beta;         EC=3...    61   2e-11
ATPB_DROVI RecName: Full=ATP synthase subunit beta, mitochondria...    61   2e-11
VATA_ANOGA RecName: Full=V-type proton ATPase catalytic subunit ...    61   2e-11
VATA_PYRHO RecName: Full=V-type ATP synthase alpha chain;       ...    60   4e-11
VATA_PYRAB RecName: Full=V-type ATP synthase alpha chain;       ...    60   4e-11
VATA_CLONN RecName: Full=V-type ATP synthase alpha chain;       ...    60   4e-11
VATA_CENSY RecName: Full=V-type ATP synthase alpha chain;       ...    60   4e-11
VATA_CHLPN RecName: Full=V-type ATP synthase alpha chain;       ...    60   6e-11
VATA_AERPE RecName: Full=V-type ATP synthase alpha chain;       ...    60   6e-11
VATA_CLOPS RecName: Full=V-type ATP synthase alpha chain;       ...    59   9e-11
VATA_CLOPE RecName: Full=V-type ATP synthase alpha chain;       ...    59   9e-11
VATA_CLOP1 RecName: Full=V-type ATP synthase alpha chain;       ...    59   9e-11
VATA_CHICK RecName: Full=V-type proton ATPase catalytic subunit ...    59   9e-11
VATB_CHLTR RecName: Full=V-type ATP synthase beta chain;AltName:...    59   1e-10
VATB_CHLTA RecName: Full=V-type ATP synthase beta chain;AltName:...    59   1e-10
VATA_CYACA RecName: Full=V-type proton ATPase catalytic subunit ...    59   1e-10
VATA_CAEBR RecName: Full=V-type proton ATPase catalytic subunit ...    58   2e-10
ATPB_WOLTR RecName: Full=ATP synthase subunit beta;         EC=3...    58   2e-10
ATPB_SALRD RecName: Full=ATP synthase subunit beta;         EC=3...    58   2e-10
VATB_CHLTB RecName: Full=V-type ATP synthase beta chain;AltName:...    58   2e-10
VATB_CHLT2 RecName: Full=V-type ATP synthase beta chain;AltName:...    58   2e-10
VATA_BORDL RecName: Full=V-type ATP synthase alpha chain;       ...    58   2e-10
VATB_METKA RecName: Full=V-type ATP synthase beta chain;AltName:...    57   3e-10
VATA_PONAB RecName: Full=V-type proton ATPase catalytic subunit ...    57   3e-10
VATA_MOUSE RecName: Full=V-type proton ATPase catalytic subunit ...    57   3e-10
VATA_HUMAN RecName: Full=V-type proton ATPase catalytic subunit ...    57   3e-10
VATA_CHLMU RecName: Full=V-type ATP synthase alpha chain;       ...    57   3e-10
VATA_CHLCV RecName: Full=V-type ATP synthase alpha chain;       ...    57   3e-10
VATA_CAEEL RecName: Full=V-type proton ATPase catalytic subunit ...    57   3e-10
VATA_BOVIN RecName: Full=V-type proton ATPase catalytic subunit ...    57   3e-10
VATA_PIG RecName: Full=V-type proton ATPase catalytic subunit A;...    57   4e-10
VATA_CHLTR RecName: Full=V-type ATP synthase alpha chain;       ...    57   4e-10
VATA_CHLTB RecName: Full=V-type ATP synthase alpha chain;       ...    57   4e-10
VATA_CHLTA RecName: Full=V-type ATP synthase alpha chain;       ...    57   4e-10
VATA_CHLT2 RecName: Full=V-type ATP synthase alpha chain;       ...    57   4e-10
VATB_PARUW RecName: Full=V-type ATP synthase beta chain;AltName:...    56   8e-10
VATA_CHLAB RecName: Full=V-type ATP synthase alpha chain;       ...    56   8e-10
VATA_BORRA RecName: Full=V-type ATP synthase alpha chain;       ...    55   1e-09
ATPB_CYTH3 RecName: Full=ATP synthase subunit beta;         EC=3...    55   1e-09
VATA_THEPD RecName: Full=V-type ATP synthase alpha chain;       ...    54   3e-09
VATA_CANTR RecName: Full=V-type proton ATPase catalytic subunit ...    53   5e-09
VATA_YEAST RecName: Full=V-type proton ATPase catalytic subunit ...    52   9e-09
YLC7_YEREN RecName: Full=Uncharacterized protein in lcrE 5'regio...    47   5e-07
ATPA_POPEU RecName: Full=ATP synthase subunit alpha, chloroplast...    45   2e-06
ATPB_ASPND RecName: Full=ATP synthase subunit beta, chloroplasti...    43   5e-06
RHO_MYCLE RecName: Full=Transcription termination factor rho;   ...    39   1e-04
RHO_STRLI RecName: Full=Transcription termination factor rho;   ...    37   4e-04
RHO_DEIRA RecName: Full=Transcription termination factor rho;   ...    37   4e-04
RHO_MYCTU RecName: Full=Transcription termination factor rho;   ...    36   7e-04
RHO_MYCBO RecName: Full=Transcription termination factor rho;   ...    36   7e-04

>ATPA_NITOC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  978 bits (2528), Expect = 0.0
 Identities = 515/515 (100%), Positives = 515/515 (100%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN
Sbjct: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG
Sbjct: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV
Sbjct: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVV         LQFIA
Sbjct: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL
Sbjct: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD
Sbjct: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS
Sbjct: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW
Sbjct: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515


>ATPA1_METCA RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  840 bits (2169), Expect = 0.0
 Identities = 425/513 (82%), Positives = 477/513 (92%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLNA+EIS+LI++RI  F+   E+R+EGT+VSLTDGIVRIHGL DVM GEM+EFPGNTY
Sbjct: 1   MQLNASEISDLIKQRIGKFDLGVESRSEGTIVSLTDGIVRIHGLQDVMQGEMVEFPGNTY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAV+LG Y+H+SEGD AKCTGRILEVPVGEALLGRVVDALG PIDG GP
Sbjct: 61  GMALNLERDSVGAVVLGSYEHLSEGDTAKCTGRILEVPVGEALLGRVVDALGNPIDGAGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A+  SPIEK+APGVI+RQSVSQP+QTGLK+IDSM+PVGRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDAKLFSPIEKIAPGVISRQSVSQPLQTGLKAIDSMIPVGRGQRELIIGDRQTGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKGTG+KCIYVA+GQK SS+A VVRKL+EHGA+EHTIVV         LQFIAPY
Sbjct: 181 DAIINQKGTGVKCIYVAVGQKQSSIANVVRKLQEHGAMEHTIVVXXXXXXXXXLQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++R+NAE VE+LT+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 ASRINAEEVERLTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+NAGLSVSRVGGAAQTK+IKKLGGG+RLDLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAVNAGLSVSRVGGAAQTKVIKKLGGGIRLDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           +ERGQRVTELMKQ QYSPMS+ QMAVSLFAANEG+LDD+EV K++DFE ALQ YM+S   
Sbjct: 421 IERGQRVTELMKQNQYSPMSIAQMAVSLFAANEGYLDDIEVSKVRDFEDALQEYMKSQCA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL  I  TGDY+D I A L  AI+ FK T+ W
Sbjct: 481 ELLKSIDATGDYNDAIQAGLHEAIKKFKATHAW 513


>ATPA_THISH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  815 bits (2106), Expect = 0.0
 Identities = 407/513 (79%), Positives = 461/513 (89%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN  EISELI+KRI  ++A  +ARTEGTVVSL+DGIVR+HGLADVM GEMIEFPGNTY
Sbjct: 1   MQLNPTEISELIKKRIASYDAAAQARTEGTVVSLSDGIVRLHGLADVMQGEMIEFPGNTY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HI EGD A+CTGRILEVPVGEALLGRVV++LG+ +DG G 
Sbjct: 61  GLALNLERDSVGAVVLGDYKHIKEGDTARCTGRILEVPVGEALLGRVVNSLGMAVDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+   TSPIEK+APGVI RQSV QPVQTGLK+ID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 IDTSLTSPIEKIAPGVIERQSVDQPVQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKGTG+KCIYVA+GQKASS+A VV KLE+HGALEHTI+V         +QFIAPY
Sbjct: 181 DAIINQKGTGVKCIYVAVGQKASSIANVVTKLEQHGALEHTIIVAATASESAAMQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRG+DALIIYDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGQDALIIYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRL LAQYRELAAF+QFASDLDE TRKQ
Sbjct: 361 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLALAQYRELAAFSQFASDLDELTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTELMKQ Q+SPMSV +MA SLFAANEG+LDDV+  K+ DFE A+  ++RSS  
Sbjct: 421 LERGKRVTELMKQGQFSPMSVAEMAFSLFAANEGYLDDVDAKKVVDFEKAMLDFLRSSKT 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +LL KI + GDY+D+I A ++AA++ FK  ++W
Sbjct: 481 DLLAKINEKGDYNDDIQAGMKAALDEFKAKHSW 513


>ATPA_ALHEH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  795 bits (2052), Expect = 0.0
 Identities = 401/513 (78%), Positives = 466/513 (90%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI++RIE FEA  EAR +GT+VS+ DGI RIHGLAD M GEM+EFP +T+
Sbjct: 1   MQLNPSEISELIKRRIENFEAVAEARNQGTIVSVGDGICRIHGLADAMQGEMLEFPNDTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAVILG Y+H+SEGD  KCTGRILEVPVGE+LLGRVVDALG P+D  G 
Sbjct: 61  GMALNLERDSVGAVILGDYEHLSEGDTVKCTGRILEVPVGESLLGRVVDALGNPVDAKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A+ +SP+EKVAPGVI+RQSV QPVQTGLK++D+MVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IKAEGSSPVEKVAPGVISRQSVDQPVQTGLKAVDAMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKCIYVAIGQKASS+A VV KL+EH AL+HTIVV         +Q++A Y
Sbjct: 181 DAIINQKNSGIKCIYVAIGQKASSIASVVEKLKEHDALDHTIVVXXXXXXXXXMQYLAAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +AR+NAE VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQI+LETDLF
Sbjct: 301 AARINAEEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAINAGLSVSRVGG+AQTK+IKKLGGG+RL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NSGIRPAINAGLSVSRVGGSAQTKLIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERGQRV ELMKQ QY+PM+V +M +SL+AA+ G+LDDVEV+K+ DF++AL  Y+RS   
Sbjct: 421 LERGQRVMELMKQPQYTPMTVAEMGISLYAADAGYLDDVEVNKVVDFQAALLDYLRSEEK 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            LLD++  T DY+DE+  +++ A+E FK++ TW
Sbjct: 481 GLLDELNSTPDYNDEVVGKMKKAVEAFKSSRTW 513


>ATPA_SACD2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  793 bits (2047), Expect = 0.0
 Identities = 395/512 (77%), Positives = 450/512 (87%), Gaps = 1/512 (0%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I++RI+     TEA+ EGTVVS+TDGI+RIHGLADVM+GEMIEF G  YG
Sbjct: 3   QLNPSEISEIIKQRIDNLAVSTEAQNEGTVVSVTDGIIRIHGLADVMYGEMIEFEGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAV+LG YQ ++EG   KCTGRILEVPVGE L GRVVDALG PIDG GPI
Sbjct: 63  IALNLERDSVGAVVLGDYQGVAEGQSCKCTGRILEVPVGEELCGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            A+ T  IEK+APGVI RQSV QPVQ GLK++D+MVP+GRGQRELIIGDRQTGKTAVA+D
Sbjct: 123 NAKKTDAIEKIAPGVIARQSVDQPVQIGLKAVDTMVPIGRGQRELIIGDRQTGKTAVAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQKGTGIKCIYVAIGQKASSVA VVRKLEEHGA++HTIVV         +QF+AP+A
Sbjct: 183 AIINQKGTGIKCIYVAIGQKASSVASVVRKLEEHGAMDHTIVVAATASDPASMQFLAPFA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           ARVNA++VE+LT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLFN
Sbjct: 303 ARVNADYVEQLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAF+QFASDLDEAT+ QL
Sbjct: 363 AGIRPAMNAGISVSRVGGSAQTKVIKKLSGGIRTALAQYRELAAFSQFASDLDEATKAQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E G+RVTELMKQ QYSP SVG+MAV ++AANEG+L DVEV KI DFESAL  YM SSH +
Sbjct: 423 EHGERVTELMKQKQYSPQSVGEMAVVVYAANEGYLKDVEVSKIGDFESALLSYMNSSHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L++ +   G YSDEIA +L++A++ FK T TW
Sbjct: 483 LMNTM-NGGSYSDEIAGQLKSALDTFKATQTW 513


>ATPA_HALHL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  791 bits (2044), Expect = 0.0
 Identities = 392/513 (76%), Positives = 453/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +Q+N +EISELI++RIE F+A  EAR EGTVVS+ DGI RIHGLADVMFGEM+EFP +T+
Sbjct: 1   MQVNPSEISELIKRRIENFDAAAEARNEGTVVSVGDGICRIHGLADVMFGEMLEFPDDTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAV+LG YQHI EG   KCTGRILEVPVG+A+LGRVVDALG P DG GP
Sbjct: 61  GMALNLERDSVGAVLLGDYQHIKEGATVKCTGRILEVPVGDAMLGRVVDALGRPTDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+ + + PIEKVAPGVITR+ V QPVQTGLK+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 IKTEGSEPIEKVAPGVITREGVDQPVQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKCIYVA+GQK S+VA VVRKLEEHGA+++TIVV         +Q+IAPY
Sbjct: 181 DAIINQKDSGIKCIYVAVGQKNSTVANVVRKLEEHGAMDNTIVVNAGASESAAMQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRG+DALIIYDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGQDALIIYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++R+NAE VE+ T G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQI+LETDLF
Sbjct: 301 ASRINAEEVERRTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+NAGLSVSRVGG+AQTKIIKKLGGGVRL LAQYRELAAF+QFASDLDE TR+Q
Sbjct: 361 NSGVRPAVNAGLSVSRVGGSAQTKIIKKLGGGVRLALAQYRELAAFSQFASDLDETTRQQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+R  ELMKQ QY P SVG+MA  LFAANEG++DDVE D++  FE AL  Y+R+ H 
Sbjct: 421 LERGKRTMELMKQGQYEPQSVGEMAFVLFAANEGYVDDVENDQVVRFEKALLDYLRAEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +IT+TGDY+DEI AE++ A++ FK   TW
Sbjct: 481 ELLQRITETGDYNDEIHAEMQKAMDAFKKNRTW 513


>ATPA2_LEGPH RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 517

 Score =  787 bits (2033), Expect = 0.0
 Identities = 390/514 (75%), Positives = 448/514 (87%)

Query: 2   QLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNT 61
           Q+ LN +EISELIRK+I+ F   +EAR EGT+VSL DGIVR+HGLADVM GEMIEFPG  
Sbjct: 4   QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGV 63

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
           YGLA+NLERDSVGAVILG    ++EG + KCTGRILEVPVG+ LLGRVVDALG PIDG G
Sbjct: 64  YGLALNLERDSVGAVILGDSSTLAEGQKGKCTGRILEVPVGKGLLGRVVDALGNPIDGKG 123

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           PIE+   SPIEKVAPGVITR+SV QPVQTGLK+ID+M+PVGRGQRELIIGDRQTGKTA+A
Sbjct: 124 PIESSGMSPIEKVAPGVITRKSVDQPVQTGLKAIDAMIPVGRGQRELIIGDRQTGKTAIA 183

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           IDAIINQKGTG+KC+YVAIGQKASSVA +VRKLEEHGALEHTIVV         LQ+IAP
Sbjct: 184 IDAIINQKGTGVKCVYVAIGQKASSVASIVRKLEEHGALEHTIVVVAGASDSAALQYIAP 243

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           Y+GC MGEYF +RGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLLE
Sbjct: 244 YSGCTMGEYFMERGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLLE 303

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR+NA+ VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+ DL
Sbjct: 304 RAARINADEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLDVDL 363

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           FN+G+RPAIN+GLSVSRVGGAAQTKI+KKLGGG RL LAQ+REL AF+QFASDLD+ATRK
Sbjct: 364 FNSGVRPAINSGLSVSRVGGAAQTKIMKKLGGGTRLALAQFRELEAFSQFASDLDDATRK 423

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           QLERGQR+TELMKQ QYSP++V +M VSLF   +G+LDDV V++I  FE++L  YMRS+H
Sbjct: 424 QLERGQRITELMKQKQYSPLTVAEMGVSLFVVEKGYLDDVPVNEISSFEASLHDYMRSTH 483

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
             LL  I + G Y +EI A+L+ A+E FK T +W
Sbjct: 484 AALLHAINEAGAYDNEIEAKLKKAVEEFKNTGSW 517


>ATPA2_LEGPA RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 517

 Score =  787 bits (2033), Expect = 0.0
 Identities = 390/514 (75%), Positives = 448/514 (87%)

Query: 2   QLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNT 61
           Q+ LN +EISELIRK+I+ F   +EAR EGT+VSL DGIVR+HGLADVM GEMIEFPG  
Sbjct: 4   QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGV 63

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
           YGLA+NLERDSVGAVILG    ++EG + KCTGRILEVPVG+ LLGRVVDALG PIDG G
Sbjct: 64  YGLALNLERDSVGAVILGDSSTLAEGQKGKCTGRILEVPVGKGLLGRVVDALGNPIDGKG 123

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           PIE+   SPIEKVAPGVITR+SV QPVQTGLK+ID+M+PVGRGQRELIIGDRQTGKTA+A
Sbjct: 124 PIESSGMSPIEKVAPGVITRKSVDQPVQTGLKAIDAMIPVGRGQRELIIGDRQTGKTAIA 183

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           IDAIINQKGTG+KC+YVAIGQKASSVA +VRKLEEHGALEHTIVV         LQ+IAP
Sbjct: 184 IDAIINQKGTGVKCVYVAIGQKASSVASIVRKLEEHGALEHTIVVVAGASDSAALQYIAP 243

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           Y+GC MGEYF +RGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLLE
Sbjct: 244 YSGCTMGEYFMERGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLLE 303

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR+NA+ VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+ DL
Sbjct: 304 RAARINADEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLDVDL 363

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           FN+G+RPAIN+GLSVSRVGGAAQTKI+KKLGGG RL LAQ+REL AF+QFASDLD+ATRK
Sbjct: 364 FNSGVRPAINSGLSVSRVGGAAQTKIMKKLGGGTRLALAQFRELEAFSQFASDLDDATRK 423

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           QLERGQR+TELMKQ QYSP++V +M VSLF   +G+LDDV V++I  FE++L  YMRS+H
Sbjct: 424 QLERGQRITELMKQKQYSPLTVAEMGVSLFVVEKGYLDDVPVNEISSFEASLHDYMRSTH 483

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
             LL  I + G Y +EI A+L+ A+E FK T +W
Sbjct: 484 AALLHAINEAGAYDNEIEAKLKKAVEEFKNTGSW 517


>ATPA_LEGPL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 517

 Score =  787 bits (2032), Expect = 0.0
 Identities = 389/514 (75%), Positives = 448/514 (87%)

Query: 2   QLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNT 61
           Q+ LN +EISELIRK+I+ F   +EAR EGT+VSL DGIVR+HGLADVM GEMIEFPG  
Sbjct: 4   QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGV 63

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
           YGLA+NLERDSVGAVILG    ++EG + KCTGRILEVPVG+ LLGRVVDALG PIDG G
Sbjct: 64  YGLALNLERDSVGAVILGDSSTLAEGQKGKCTGRILEVPVGKGLLGRVVDALGNPIDGKG 123

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           PIE+   SPIEKVAPGVITR+SV QPVQTGLK+ID+M+PVGRGQRELIIGDRQTGKTA+A
Sbjct: 124 PIESSGMSPIEKVAPGVITRKSVDQPVQTGLKAIDAMIPVGRGQRELIIGDRQTGKTAIA 183

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           IDAIINQKGTG+KC+YVA+GQKASSVA +VRKLEEHGALEHTIVV         LQ+IAP
Sbjct: 184 IDAIINQKGTGVKCVYVAVGQKASSVASIVRKLEEHGALEHTIVVVAGASDSAALQYIAP 243

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           Y+GC MGEYF +RGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLLE
Sbjct: 244 YSGCTMGEYFMERGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLLE 303

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR+NA+ VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+ DL
Sbjct: 304 RAARINADEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLDVDL 363

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           FN+G+RPAIN+GLSVSRVGGAAQTKI+KKLGGG RL LAQ+REL AF+QFASDLD+ATRK
Sbjct: 364 FNSGVRPAINSGLSVSRVGGAAQTKIMKKLGGGTRLALAQFRELEAFSQFASDLDDATRK 423

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           QLERGQR+TELMKQ QYSP++V +M VSLF   +G+LDDV V++I  FE++L  YMRS+H
Sbjct: 424 QLERGQRITELMKQKQYSPLTVAEMGVSLFVVEKGYLDDVPVNEISSFEASLHDYMRSTH 483

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
             LL  I + G Y +EI A+L+ A+E FK T +W
Sbjct: 484 AALLHAINEAGAYDNEIEAKLKKAVEEFKNTGSW 517


>ATPA2_LEGPC RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 517

 Score =  786 bits (2030), Expect = 0.0
 Identities = 388/514 (75%), Positives = 448/514 (87%)

Query: 2   QLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNT 61
           Q+ LN +EISELIRK+I+ F   +EAR EGT+VSL DGIVR+HGLADVM GEMIEFPG  
Sbjct: 4   QVALNPSEISELIRKKIDQFSVVSEARNEGTIVSLKDGIVRLHGLADVMAGEMIEFPGGV 63

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
           YGLA+NL+RDSVGAVILG    ++EG + KCTGRILEVPVG+ LLGRVVDALG PIDG G
Sbjct: 64  YGLALNLKRDSVGAVILGDSSTLAEGQKGKCTGRILEVPVGKGLLGRVVDALGNPIDGKG 123

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           PIE+   SPIEKVAPGV+TR+S+ QPVQTGLK+ID+M+PVGRGQRELIIGDRQTGKTA+A
Sbjct: 124 PIESSGMSPIEKVAPGVVTRKSIDQPVQTGLKAIDAMIPVGRGQRELIIGDRQTGKTAIA 183

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           IDAIINQKGTG+KC+YVAIGQKASSVA +VRKLEEHGALEHTIVV         LQ+IAP
Sbjct: 184 IDAIINQKGTGVKCVYVAIGQKASSVASIVRKLEEHGALEHTIVVVAGASDSAALQYIAP 243

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           YAGC MGEYF +RGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLLE
Sbjct: 244 YAGCTMGEYFMERGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLLE 303

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR+NA+ VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+ DL
Sbjct: 304 RAARINADEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLDVDL 363

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           FN+G+RPAIN+GLSVSRVGGAAQTKI+KKLGGG RL LAQ+REL AF+QFASDLD+ATRK
Sbjct: 364 FNSGVRPAINSGLSVSRVGGAAQTKIMKKLGGGTRLALAQFRELEAFSQFASDLDDATRK 423

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           QLERGQR+TELMKQ QYSP++V +M VSLF   +G+LDDV V++I  FE++L  YMRS+H
Sbjct: 424 QLERGQRITELMKQKQYSPLTVAEMGVSLFVVEKGYLDDVPVNEISSFEASLHDYMRSTH 483

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
             LL  I + G Y +EI A+L+ A+E FK T +W
Sbjct: 484 AALLHAINEAGAYDNEIEAKLKKAVEEFKNTGSW 517


>ATPA_TERTT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  783 bits (2023), Expect = 0.0
 Identities = 391/512 (76%), Positives = 446/512 (87%), Gaps = 1/512 (0%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+     TEA+ EGTVVS+TDGI+RIHGLA+VM+GEMIEF G  YG
Sbjct: 3   QLNPSEISEIIKARIDNLSVTTEAQNEGTVVSVTDGIIRIHGLAEVMYGEMIEFEGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAVILG YQ ++EG   KCTGRILEVPVG  L GRVVDALG PIDG GPI
Sbjct: 63  IALNLERDSVGAVILGDYQGVAEGQTCKCTGRILEVPVGPELQGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+AT  IEK+APGVI RQSV QPVQ GLK++D+MVP+GRGQRELIIGDRQTGKTA+A+D
Sbjct: 123 DAKATDAIEKIAPGVIARQSVDQPVQIGLKAVDTMVPIGRGQRELIIGDRQTGKTAIAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQKGTGIKCIYVAIGQKASS+A VVRKLEEHGA++HTIVV         +QF+AP+A
Sbjct: 183 AIINQKGTGIKCIYVAIGQKASSIASVVRKLEEHGAMDHTIVVAATASDPASMQFLAPFA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEY+RDRGED LIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYYRDRGEDCLIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           ARVNA HVEK T G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+DLFN
Sbjct: 303 ARVNAAHVEKYTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESDLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAFAQFASDLDEAT+ QL
Sbjct: 363 AGIRPAMNAGISVSRVGGSAQTKVIKKLSGGIRTALAQYRELAAFAQFASDLDEATKAQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
             GQRVTELMKQ QYSP SV +MAV ++AANEGFL+DVEV K+  FES+L  YM SSH E
Sbjct: 423 NHGQRVTELMKQKQYSPQSVAEMAVVVYAANEGFLEDVEVAKMGAFESSLLSYMNSSHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ ++  TG YSD+IA +L+ A+ENFK T TW
Sbjct: 483 LMAEM-NTGAYSDDIAGKLKGALENFKATQTW 513


>ATPA_CHRSD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  781 bits (2016), Expect = 0.0
 Identities = 386/512 (75%), Positives = 446/512 (87%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS++I++RIE  +  +EAR EGTVVS++DGIV+IHGLAD MFGEMIEFPG+ +G
Sbjct: 3   QLNPSEISDIIKQRIEKLDVASEARNEGTVVSVSDGIVKIHGLADAMFGEMIEFPGSIFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           + +NLERDSVGAV+LG Y  + EG  A+CTGRILEVPVG  L+GRVVD LG+PIDG G +
Sbjct: 63  MVLNLERDSVGAVVLGDYLQLEEGMTAQCTGRILEVPVGPELIGRVVDPLGVPIDGKGEL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           + + T  +EKVAPGVITRQSV +P+QTGLKSID+MVP+GRGQRELIIGDRQ GK+A+AID
Sbjct: 123 DTKLTDAVEKVAPGVITRQSVDEPIQTGLKSIDAMVPIGRGQRELIIGDRQIGKSAIAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
            IINQKG G+ C+YVAIGQK S++A VVRKLEEHGA+EHTIVV         +QF+A Y+
Sbjct: 183 TIINQKGKGVTCVYVAIGQKQSTIANVVRKLEEHGAMEHTIVVAAGAADPAPMQFLAAYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           ARVNA+HVEKLT G+VKGKTGSLTALPIIETQ GDVSAF+PTNVISITDGQIFLET+LFN
Sbjct: 303 ARVNADHVEKLTNGEVKGKTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLETNLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +G+RPAINAGLSVSRVGG+AQTKIIKKLGG VRL LAQYRELAAF+QFASDLDEATRKQL
Sbjct: 363 SGVRPAINAGLSVSRVGGSAQTKIIKKLGGSVRLALAQYRELAAFSQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QYSP+SV +MAVSL+AANEGFLDDVEV K+ DFE AL  YM+S H E
Sbjct: 423 EHGQRVTELMKQNQYSPLSVAEMAVSLYAANEGFLDDVEVSKVLDFERALHAYMKSEHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LLDKI ++G Y DEI   L++ +E FK+T TW
Sbjct: 483 LLDKINQSGGYDDEIQQGLKSGLETFKSTQTW 514


>ATPA1_NITMU RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  780 bits (2013), Expect = 0.0
 Identities = 391/513 (76%), Positives = 449/513 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + LN +EISELI+ RIEG EA  E RT+GTVVS+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MHLNPSEISELIKSRIEGLEATAEVRTQGTVVSVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HI+EGD  KCTGRILEVPVGE L+GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHITEGDTVKCTGRILEVPVGEELIGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I  + + PIEK+APGV+ RQSV+QPVQTGLK+ID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 ITTKHSEPIEKIAPGVVWRQSVNQPVQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS++ VVRKLEEHGA+E+TIVV         +QFIAPY
Sbjct: 181 DAIINQKGENMICIYVAIGQKASSISNVVRKLEEHGAMEYTIVVAATASESAAMQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRD G DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDTGRDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+A +VEK T G VKGKTGSLTALP+IETQAGDV+AF+PTNVISITDGQIFLE+DLF
Sbjct: 301 AARVSAAYVEKETNGAVKGKTGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLESDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGGVRL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGVRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+ VTELMKQ QYS +SV +MA++LFA N+G+LDDVEV +   FESAL+G++RS +G
Sbjct: 421 LERGKMVTELMKQPQYSTLSVSEMALTLFAVNKGYLDDVEVSRALAFESALRGFIRSKYG 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            +LDKI  T D   E   EL AAI++FK   T+
Sbjct: 481 AILDKIETTKDLDAETEKELDAAIQDFKKNGTY 513


>ATPA_METFK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  774 bits (1998), Expect = 0.0
 Identities = 389/513 (75%), Positives = 443/513 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EISELI+ R+E F    EART+GTV+S+TDGIVRIHGL++VM GEMIEFPGN Y
Sbjct: 1   MQLSTSEISELIKSRLENFSTSAEARTQGTVISVTDGIVRIHGLSNVMAGEMIEFPGNVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y++ISEGD  KCTGRILEVPVG  L+GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGDYENISEGDTVKCTGRILEVPVGPELVGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI R+SVSQPVQTG+K+IDSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKLTDKIEKVAPGVIARKSVSQPVQTGIKAIDSMVPVGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKAS++A VVRKLEEHGA+E+TIVV         LQF+APY
Sbjct: 181 DAIINQKGQNMTCIYVAIGQKASTIANVVRKLEEHGAMEYTIVVAASASDPAALQFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFY+HSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYIHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIET AGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETAAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGGVRL LAQYRELAAFAQFASDLDE TRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGVRLALAQYRELAAFAQFASDLDEVTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+RG+ VTELMKQ QY+P+S  +MAV+L AAN+GF DDV V +   FESAL  +++S + 
Sbjct: 421 LDRGRLVTELMKQAQYAPLSTSEMAVTLLAANKGFFDDVPVARALAFESALHSFLKSKYK 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            +LDKI  T D   +    L AAI++FK TN +
Sbjct: 481 SILDKIDSTNDLGGDDEKALEAAIQDFKATNAY 513


>ATPA_RALPJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  773 bits (1997), Expect = 0.0
 Identities = 396/508 (77%), Positives = 453/508 (89%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EIS+LI+ RIEG +A  +A+  GTV+S+TDGI RIHGL+ VM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISDLIKTRIEGLKAGADAKNTGTVISVTDGICRIHGLSGVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HISEGD  KCTGRILEVPVG  LLGRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHISEGDEVKCTGRILEVPVGPELLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKSID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKKTDVIEKVAPGVIARQSVSQPVQTGLKSIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG GI C+YVAIGQKAS++A VVRKLEEHGALE+TIVV         +Q+++ Y
Sbjct: 181 DAIINQKGKGIFCVYVAIGQKASTIANVVRKLEEHGALEYTIVVXXXXXXXXXMQYLSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAEH+EK+T G+VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNAEHIEKITNGEVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V Q+A SL+AAN GFLD+V+V  I  FE  L   +++ + 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWQLAASLYAANNGFLDNVDVKDILAFEKGLHDTLKTKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I  T D S +  A LRAAIE+FK
Sbjct: 481 DLINRIEDTKDLSKDDEAALRAAIEDFK 508


>ATPA_RUTMC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  772 bits (1994), Expect = 0.0
 Identities = 383/513 (74%), Positives = 449/513 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLNA EIS+LI+K+IEGF+ D E RTEG+VVS++DGIVRIHGLADV FGEM+EFP NT+
Sbjct: 1   MQLNAHEISDLIKKQIEGFDFDAEVRTEGSVVSVSDGIVRIHGLADVQFGEMLEFPNNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE++SVGAVILG Y HISEGD  KCT R++EVPVGEA+LGRVV+ LG  IDG   
Sbjct: 61  GMALNLEQNSVGAVILGDYLHISEGDVVKCTNRLVEVPVGEAMLGRVVNPLGKAIDGKDD 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+ Q   P+E +APGVI R+SV QP+QTG+K+ID+MVPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IDVQGARPLEIMAPGVINRKSVDQPIQTGIKAIDAMVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GI+C+YVAIGQK SSVA VVRKLEE+GALE+TI+V         LQ+IAPY
Sbjct: 181 DTIINQKDSGIRCVYVAIGQKDSSVAAVVRKLEEYGALENTIIVTAGAASAPALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC M EYFRDRGEDALI+YDDLTKQAWAYR+VSLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMAEYFRDRGEDALIVYDDLTKQAWAYREVSLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK+T G+VKGKTGSLTALPIIETQ GDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKMTNGEVKGKTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAGLSVSRVGG+AQT IIKKLGGG+RLDLAQYRELAAFAQF+SDLD  T+ Q
Sbjct: 361 NAGIRPAINAGLSVSRVGGSAQTNIIKKLGGGIRLDLAQYRELAAFAQFSSDLDSETKAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           ++RGQRVTELMKQ QYSP+S+ +MA SLFA N G LDD+EV+K+ DFE+AL  YM ++  
Sbjct: 421 IDRGQRVTELMKQNQYSPLSIAEMATSLFAVNSGLLDDIEVNKVVDFEAALIAYMNANQI 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ KI  TGDY+D+I+ EL+AAI++FK  +TW
Sbjct: 481 LLMSKINDTGDYNDKISNELQAAIDDFKQNHTW 513


>ATPA_RALSO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  772 bits (1993), Expect = 0.0
 Identities = 395/508 (77%), Positives = 453/508 (89%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EIS+LI+ RIEG +A  +A+  GTV+S+TDGI RIHGL+ VM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISDLIKTRIEGLKAGADAKNTGTVISVTDGICRIHGLSGVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HISEG+  KCTGRILEVPVG  LLGRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGDYEHISEGNEVKCTGRILEVPVGPELLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKSID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKKTDVIEKVAPGVIARQSVSQPVQTGLKSIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG GI C+YVAIGQKAS++A VVRKLEEHGALE+TIVV         +Q+++ Y
Sbjct: 181 DAIINQKGKGIFCVYVAIGQKASTIANVVRKLEEHGALEYTIVVXXXXXXXXXMQYLSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAEH+EK+T G+VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNAEHIEKITNGEVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V Q+A SL+AAN GFLD+V+V  I  FE  L   +++ + 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWQLAASLYAANNGFLDNVDVKDILAFEKGLHDQLKTKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I  T D S +  A LRAAIE+FK
Sbjct: 481 DLINRIEDTKDLSKDDEAALRAAIEDFK 508


>ATPA_ALTMD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  771 bits (1991), Expect = 0.0
 Identities = 386/513 (75%), Positives = 454/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI+KRIE F   +EAR EGT+V++TDGI+RIHGLADVM GEMIE PG+ Y
Sbjct: 1   MQLNSTEIAELIKKRIEQFNVSSEARNEGTIVAVTDGIIRIHGLADVMQGEMIELPGSRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  + EGD+ + TGRILEVPVG ALLGRVV+ LG PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLKEGDKVQSTGRILEVPVGNALLGRVVNTLGEPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A    P+EK+APGVI RQSV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+
Sbjct: 121 IDAAGFEPVEKIAPGVIERQSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQCGKTAMAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKGTGIKC+YVA+GQKAS++A VVRKLEEHGAL+HTIVV         LQ++APY
Sbjct: 181 DAIINQKGTGIKCVYVAVGQKASTIANVVRKLEEHGALDHTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN ++VE  T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEQYVENYTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+NAG+SVSRVGGAAQTKIIKKLGGG+RL LAQYRELAAF+QFASDLD+ATR+Q
Sbjct: 361 NAGIRPAVNAGISVSRVGGAAQTKIIKKLGGGIRLALAQYRELAAFSQFASDLDDATREQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+P+S+  M VSLFA  +GFL  +E++KI DFE+AL  YM S H 
Sbjct: 421 LEHGERVTELMKQKQYAPLSIANMGVSLFAVEKGFLKGIELNKILDFEAALHSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+  I ++G+Y+DEIA++L  A+ NFK T TW
Sbjct: 481 DLMKTINESGNYNDEIASKLNDALTNFKATQTW 513


>ATPA_MARAV RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  766 bits (1977), Expect = 0.0
 Identities = 391/512 (76%), Positives = 456/512 (89%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS++I+KRIE  +  +EA+ EGT++S++DGIV IHGLADVM+GEMIEF   TYG
Sbjct: 3   QLNPSEISDIIKKRIEKLDISSEAKNEGTILSVSDGIVLIHGLADVMYGEMIEFANGTYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAV+LG Y+ ++EG + +CTGRILEVPVG  LLGRVVD+LG PIDG G +
Sbjct: 63  MALNLERDSVGAVVLGDYEGLAEGQKVRCTGRILEVPVGNELLGRVVDSLGNPIDGKGEL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               TSP+EKVAPGVI RQSV +PVQTGLK+ID+MVP+GRGQRELIIGDRQ GKTAVAID
Sbjct: 123 GNSLTSPVEKVAPGVIARQSVDEPVQTGLKAIDTMVPIGRGQRELIIGDRQIGKTAVAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK TGIKCIYVA+GQK SS+A VVRKLEEHGA++HTIVV         +QF+APYA
Sbjct: 183 AIINQKHTGIKCIYVAVGQKQSSIAAVVRKLEEHGAMDHTIVVXXXXXXXXXMQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           G +MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER+
Sbjct: 243 GTSMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RVNA++VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LFN
Sbjct: 303 SRVNADYVEQFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKI+KKLGG +RL LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAMNAGISVSRVGGAAQTKIMKKLGGNIRLALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QYSPM+V +M   LFAANEGFLDDV+V+K+  FE+ L  +MRS   E
Sbjct: 423 EHGQRVTELMKQNQYSPMTVAEMGTVLFAANEGFLDDVDVNKVVKFEAQLLDWMRSEQKE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LLDKI   G+++D+I A L+AA+E FKTT +W
Sbjct: 483 LLDKIGPEGNFNDDITAGLKAALEKFKTTQSW 514


>ATPA_RALEH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  765 bits (1975), Expect = 0.0
 Identities = 389/508 (76%), Positives = 447/508 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI G  A+ E R  GTV+S+TDGI R+HGL+ VM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRISGLGAEAEVRNTGTVISVTDGICRVHGLSGVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HISEGD  KCTGRILEVPVG+ LLGRVV+ LG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHISEGDTVKCTGRILEVPVGKELLGRVVNTLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKSID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKETDVIEKVAPGVIARQSVSQPVQTGLKSIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG G+ C+YVA+GQKAS++A VVRKLEEHGA+E+T            +Q++APY
Sbjct: 181 DAIINQKGKGVFCVYVAVGQKASTIANVVRKLEEHGAMEYTXXXXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VEK T G VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNADYVEKFTNGAVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++K L GG+R DLAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVVKNLSGGIRTDLAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V Q+A SLFAAN GFLD+VEV  I  FE  L  ++++ + 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWQLAASLFAANNGFLDNVEVKDILPFEKGLHDHLKTKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I +T   S E  A LRAA+E+FK
Sbjct: 481 DLINRIEETKQLSKEDEAALRAAVEDFK 508


>ATPA2_HAHCH RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 514

 Score =  764 bits (1974), Expect = 0.0
 Identities = 381/512 (74%), Positives = 436/512 (85%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN               +  +EA+TEGT+VS++DGIV IHGLADVM+GEMIEF G  YG
Sbjct: 3   QLNPXXXXXXXXXXXXXLDISSEAKTEGTIVSVSDGIVLIHGLADVMYGEMIEFEGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           LA+NLERDSVGAV+LG Y+ ++EG + + TGRILEVPVGE LLGRVVD LG PIDG G +
Sbjct: 63  LALNLERDSVGAVVLGDYKDLAEGQKVRVTGRILEVPVGEQLLGRVVDGLGNPIDGKGAL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           E   T P+EKVAPGVI R+SV QP+QTG KS+D+MVP+GRGQREL+IGDRQTGKTA+AID
Sbjct: 123 ETTLTEPVEKVAPGVIARKSVGQPMQTGYKSVDTMVPIGRGQRELVIGDRQTGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQKGTGIKCIYVAIGQK SS+A VVRKLEEHGA++HTIVV         +QF+APY+
Sbjct: 183 AIINQKGTGIKCIYVAIGQKQSSIANVVRKLEEHGAMDHTIVVAAGAADPASMQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RVN E+VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 303 SRVNEEYVEKYTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGGAAQTKI+KKLGGG+RL LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAMNAGISVSRVGGAAQTKIMKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ Q++PM+V +M + LFAANEGFLDDV+  K+  FE+AL  Y +S  G+
Sbjct: 423 EHGQRVTELMKQKQFAPMTVAEMGLVLFAANEGFLDDVDAKKVVPFEAALLSYAKSEFGD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LL KI + GDY+DEIAA L++ IE FK+T TW
Sbjct: 483 LLAKINEAGDYNDEIAAGLKSCIEKFKSTQTW 514


>ATPA_IDILO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  764 bits (1972), Expect = 0.0
 Identities = 388/513 (75%), Positives = 450/513 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI++RIE FE  +EAR EGT++S+ DGI+RIHGLAD + GEM+E PGN Y
Sbjct: 1   MQLNSNEIAELIKQRIEKFEVTSEARNEGTIMSVQDGIIRIHGLADCLQGEMVELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  + EG + K TGRILEVPVGE LLGRVV+ LG PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLQEGTKVKSTGRILEVPVGEKLLGRVVNTLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA    P+EK+APGVI RQSV QPVQTG KSIDSM+PVGRGQRELIIGDRQTGKTA+A+
Sbjct: 121 IEADGYEPVEKIAPGVIERQSVDQPVQTGYKSIDSMIPVGRGQRELIIGDRQTGKTALAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQK S+++ VVRKLEEHGA+E+TIVV                
Sbjct: 181 DAIINQKDSGIKCVYVAIGQKNSTISAVVRKLEEHGAMENTIVVXXXXXXXXXXXXXXXX 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 XGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VEK T+GKVKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNADYVEKFTDGKVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+NAG+SVSRVGG+AQTKIIKKLGGG+RL LAQYRELAAFAQFASDLDE+TR Q
Sbjct: 361 NSGIRPAVNAGVSVSRVGGSAQTKIIKKLGGGIRLALAQYRELAAFAQFASDLDESTRSQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE GQRVTELMKQ QY PMSV QMAVS++A  +GFL DVE+DKI DFE +LQ +M S + 
Sbjct: 421 LEHGQRVTELMKQKQYKPMSVAQMAVSIYAVEKGFLKDVEIDKIMDFEESLQSFMASEYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+ +I KTG+Y+D+I A+L+AA+E FK T +W
Sbjct: 481 ELMAEIDKTGNYNDDIDAQLKAALEKFKQTQSW 513


>ATPA_ALCBS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  763 bits (1969), Expect = 0.0
 Identities = 377/512 (73%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI   +  TEAR EGTVVS++DGIVRIHGLADVMFGEMIEF G  YG
Sbjct: 3   QLNPSEISEIIKSRIAKLDTSTEARNEGTVVSVSDGIVRIHGLADVMFGEMIEFEGGIYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG + +CTGRILEVP G  +LGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGDYLGLAEGQKVRCTGRILEVPTGPEMLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           EA+ T  +EKVAPGVI R+ V++PVQTG KSID+MVP+GRGQRELIIGDRQ GKTAVA+D
Sbjct: 123 EAKQTDAVEKVAPGVIWRREVNEPVQTGYKSIDAMVPIGRGQRELIIGDRQIGKTAVAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GIKC+YVAIGQK S++A VVRKLEEHGA+E+TI+V         +QF+AP+A
Sbjct: 183 AIINQKDSGIKCVYVAIGQKQSTIANVVRKLEEHGAMENTIIVAASASDPASMQFLAPFA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           A+VN ++VEK T G+VKGKTGSLTALPIIETQ GDVSAF+PTNVISITDGQIFLETDLFN
Sbjct: 303 AKVNEDYVEKFTNGEVKGKTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLETDLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKI+KKLGGG+RL LAQYRELAAFAQFASDLD++TR+QL
Sbjct: 363 SGIRPAMNAGVSVSRVGGAAQTKIVKKLGGGIRLALAQYRELAAFAQFASDLDDSTREQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQ VTELMKQ QYSPMSV +M V L+AANEG+L  +EV+KI  FE+AL  YM S    
Sbjct: 423 EHGQAVTELMKQKQYSPMSVAEMGVVLYAANEGYLKGMEVEKIGAFEAALLDYMNSEKKA 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+DKI + GDY+ EI AE++ +++ FK T TW
Sbjct: 483 LMDKINEKGDYNGEIEAEIKESLDQFKATQTW 514


>ATPA_RALME RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  761 bits (1966), Expect = 0.0
 Identities = 381/508 (75%), Positives = 437/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI G  AD E R  GTV+S+TDGI R+HGL+ VM GEM+EFPGNTY
Sbjct: 1   MQLNPSEISELIKSRISGLGADAEVRNTGTVISVTDGICRVHGLSGVMQGEMLEFPGNTY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HISEGD  KCTGRILEVPVG+ LLGRVV+ LG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHISEGDTVKCTGRILEVPVGKELLGRVVNTLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKSID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKETDVIEKVAPGVIARQSVSQPVQTGLKSIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D+IINQKG G+ C+YVAIGQKAS+++ VVRKLEEHGA+E+TIVV         +Q++A Y
Sbjct: 181 DSIINQKGKGVFCVYVAIGQKASTISNVVRKLEEHGAMEYTIVVAATASDSAAMQYLAAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN ++V K T G V GKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEDYVAKFTNGAVTGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V Q+A SL+AAN GFLD+V+V  I  FE  L  ++++   
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWQLAASLYAANNGFLDNVDVKDILPFEKGLHDHLKTKFA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I  T D S E  A LRAAIE+F+
Sbjct: 481 DLVNRIEDTKDLSKEDEAALRAAIEDFR 508


>ATPA_BURM1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  761 bits (1966), Expect = 0.0
 Identities = 387/513 (75%), Positives = 454/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDVVKTTGRILEVPVGPELIGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+ +TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMAYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V ++  FE  L+ ++++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKQVLPFEKGLREFLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LRAAIE+FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRAAIESFKKSGAY 513


>ATPA_THIDA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  761 bits (1965), Expect = 0.0
 Identities = 395/513 (76%), Positives = 445/513 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ +IE   A +E RT+GT+VS+TDGIVRIHGL+DVM GEMIE PGNT+
Sbjct: 1   MQLNPSEISELIKAKIENLGASSELRTQGTIVSVTDGIVRIHGLSDVMSGEMIEMPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAVILG Y+HI EGD AKCTGRI                   PIDG GP
Sbjct: 61  GVALNLERDSVGAVILGDYEHIKEGDVAKCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A ++ PIE++APGVI R+SV QPVQTGLKSID+MVPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IAADSSMPIERIAPGVIERKSVDQPVQTGLKSIDAMVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKGTG+KCIYVA+GQKASSVA VVRKLEEHGA+EHTIVV         +Q+IAPY
Sbjct: 181 DAIINQKGTGVKCIYVAVGQKASSVANVVRKLEEHGAMEHTIVVXXXXXXXXXMQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRD GEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDIGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VEKLT G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNADYVEKLTGGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAGLSVSRVGGAAQTK++KKLGGGVRL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGLSVSRVGGAAQTKVVKKLGGGVRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTELMKQ QYSPMSV QMA++LFA N G++D+VEV+KI  FE+ALQ +M+S + 
Sbjct: 421 LERGRRVTELMKQAQYSPMSVSQMALTLFAVNNGYMDEVEVNKILAFEAALQAFMKSKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            ++D I  +G+   E    L AA+E FK T  +
Sbjct: 481 AIMDTIETSGNLDGETEKALTAAVEEFKKTGVY 513


>ATPA_BURCM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  761 bits (1964), Expect = 0.0
 Identities = 388/513 (75%), Positives = 453/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDVVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLVCIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLPFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LRAAIE+FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRAAIESFKKSGAY 513


>ATPA_BURA4 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  761 bits (1964), Expect = 0.0
 Identities = 388/513 (75%), Positives = 453/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDVVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLVCIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLPFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LRAAIE+FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRAAIESFKKSGAY 513


>ATPA1_BURTA RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  761 bits (1964), Expect = 0.0
 Identities = 389/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AAI++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAAIKDFKKSGAY 513


>ATPA_BURVG RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  760 bits (1962), Expect = 0.0
 Identities = 387/513 (75%), Positives = 453/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDVVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLSFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LRAAIE+FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRAAIESFKKSGAY 513


>ATPA1_BURPS RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  760 bits (1962), Expect = 0.0
 Identities = 388/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA1_BURP6 RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  760 bits (1962), Expect = 0.0
 Identities = 388/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA1_BURP1 RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  760 bits (1962), Expect = 0.0
 Identities = 388/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA1_BURP0 RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  760 bits (1962), Expect = 0.0
 Identities = 388/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA_RALEJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  759 bits (1960), Expect = 0.0
 Identities = 391/508 (76%), Positives = 443/508 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI G  AD E R  GTV+S+TDGI R+HGL+ VM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRISGLGADAEVRNTGTVISVTDGICRVHGLSGVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HISEGD  KCTGRILEVPVG+ LLGRVV+ LG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGDYEHISEGDTVKCTGRILEVPVGKELLGRVVNTLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKETDVIEKVAPGVIARQSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG GI C+YVAIGQKAS++A VVRKLEEHGA+E+T            +Q++A Y
Sbjct: 181 DAIINQKGKGIFCVYVAIGQKASTIANVVRKLEEHGAMEYTXXXXXXXXXXXXMQYLAAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVENFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++K L GG+R DLAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVVKNLSGGIRTDLAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P  V Q+A SLFAAN GFLD+VEV  I  FE  L  ++++ + 
Sbjct: 421 LERGRRVTELLKQAQYQPQQVWQLAASLFAANNGFLDNVEVKDILPFEKGLHDHLKTKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I +T   S E    LRAAIE+F+
Sbjct: 481 DLVNRIEETKVLSKEDEPALRAAIEDFR 508


>ATPA_BURM9 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  759 bits (1959), Expect = 0.0
 Identities = 387/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRV+DALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVLDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA1_BURMS RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  759 bits (1959), Expect = 0.0
 Identities = 387/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRV+DALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVLDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA1_BURMA RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  759 bits (1959), Expect = 0.0
 Identities = 387/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRV+DALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVLDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA1_BURM7 RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  759 bits (1959), Expect = 0.0
 Identities = 387/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRV+DALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVLDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTGLKSIDSMVP+GRGQRELIIGDRQ GKTAVAI
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGLKSIDSMVPIGRGQRELIIGDRQCGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSLF+AN G+LDD++V  +  FE  L+ Y+++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLFSANNGYLDDLDVKDVLPFEKGLREYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +  + L AA+++FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDESALHAALKDFKKSGAY 513


>ATPA_BURCJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  758 bits (1956), Expect = 0.0
 Identities = 386/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLSFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LR+AIE FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRSAIEAFKKSGAY 513


>ATPA_VESOH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  757 bits (1955), Expect = 0.0
 Identities = 377/513 (73%), Positives = 445/513 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLNA EIS+LI+K+IEGF+   EARTEG+VVS++DGIVRIHGL DV FGEMIEF  NT+
Sbjct: 1   MQLNAHEISDLIKKQIEGFDFTAEARTEGSVVSVSDGIVRIHGLGDVQFGEMIEFSNNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+DSVGAVILG Y HI EGD  KCT R++EVPVGEA+LGRVV+ LG  IDG G 
Sbjct: 61  GMALNLEQDSVGAVILGDYLHILEGDIVKCTNRLVEVPVGEAMLGRVVNPLGKAIDGKGD 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+AQ   P+E +APGVI R+SV QP+QTG+K+ID+MVPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IDAQGVRPLEVMAPGVIDRKSVDQPIQTGIKAIDAMVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GI+C+YVAIGQK SSVA VVRKLEE+GAL +TI+V         LQ+IAPY
Sbjct: 181 DAIINQRDSGIRCVYVAIGQKDSSVATVVRKLEEYGALANTIIVVAGAAVSPALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAM EYFRDRGED LI+YDDLTKQAWAYR+VSLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMAEYFRDRGEDVLIVYDDLTKQAWAYREVSLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA++VEK+T GKVKG+TGSLTALPIIETQ GDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNADYVEKMTNGKVKGQTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAIN GLSVSRVGGAAQT IIKKLGGG+RLDLAQYREL AFAQF+SDLD  T+ Q
Sbjct: 361 NAGIRPAINVGLSVSRVGGAAQTNIIKKLGGGIRLDLAQYRELVAFAQFSSDLDVETKAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           ++RGQRVTELMKQ QYSP+S+ +MA  LF+AN G LDD+EV+KI DFE +L  YM+ +  
Sbjct: 421 IDRGQRVTELMKQNQYSPLSIAEMATLLFSANSGLLDDIEVNKIVDFEVSLIAYMKVNQV 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+++I + G+Y+D+I+ EL+ AI++FKT  TW
Sbjct: 481 SLMNRINEIGNYNDKISNELQVAIDDFKTNYTW 513


>ATPA_BURCH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  757 bits (1955), Expect = 0.0
 Identities = 386/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLPFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LR+AIE FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRSAIEAFKKSGAY 513


>ATPA_BURCC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  757 bits (1955), Expect = 0.0
 Identities = 386/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLPFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LR+AIE FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRSAIEAFKKSGAY 513


>ATPA_BURCA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  757 bits (1955), Expect = 0.0
 Identities = 386/513 (75%), Positives = 452/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++SH 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLPFEKGLRDNLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LR+AIE FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRSAIEAFKKSGAY 513


>ATPA_THICR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  757 bits (1954), Expect = 0.0
 Identities = 374/513 (72%), Positives = 445/513 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLNA+EIS LI+ RI+GF+   E+ +EGTVVS+ DGI  IHG++DVM+GEM++F   T+
Sbjct: 1   MQLNASEISNLIKDRIKGFDGAAESGSEGTVVSIADGIALIHGVSDVMYGEMVQFDEATF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVG V+LG Y+HISEGD+  CTGRILEVPVG  L GRVVD LG PIDG G 
Sbjct: 61  GMALNLERDSVGVVVLGEYEHISEGDKVTCTGRILEVPVGPELNGRVVDGLGRPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A+ TSPIE++APGVI RQSV QP+ TG+KSIDSM+PVGRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDAKVTSPIERIAPGVIERQSVDQPMMTGIKSIDSMIPVGRGQRELIIGDRQTGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAII+QK TG+KCIYVA+GQKAS+V  V RKLEE+GA+++T++V         LQ++A Y
Sbjct: 181 DAIISQKNTGVKCIYVAMGQKASTVNNVARKLEEYGAMDNTVIVAANASDPAALQYLAAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEY+RDRGEDALIIYDDLTKQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYYRDRGEDALIIYDDLTKQAQAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LF
Sbjct: 301 AARVNAEYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETGLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           + GIRPA+NAGLSVSRVGG+AQTK IKKLGGG+RLDLAQYRELAAFAQFASDLD AT+ Q
Sbjct: 361 SQGIRPAVNAGLSVSRVGGSAQTKAIKKLGGGIRLDLAQYRELAAFAQFASDLDPATKAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTELMKQ QYSP+++ +MAVSL+AANEG+LDDVEV+K+ DFE+AL  Y+ S++ 
Sbjct: 421 LERGKRVTELMKQKQYSPLTIAEMAVSLYAANEGYLDDVEVEKVLDFEAALHAYLNSNNA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L  KI   GD++DEI +E++A I+ FK    +
Sbjct: 481 DLAAKINAKGDWNDEIISEVKAMIDAFKANGVY 513


>ATPA_BURS3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  756 bits (1951), Expect = 0.0
 Identities = 385/513 (75%), Positives = 453/513 (88%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDIVKTTGRILEVPVGPELVGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T  IEK+APGVI R+SVSQPVQTG+KSID+MVP+GRGQRELIIGDRQ GKTAVA+
Sbjct: 121 VNAKLTDAIEKIAPGVIWRKSVSQPVQTGIKSIDAMVPIGRGQRELIIGDRQCGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+  VVRKLEE GA+E+TIVV         +Q++APY
Sbjct: 181 DAIINQKGKDLICIYVAIGQKASSIMNVVRKLEETGAMEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ E+VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEEYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AVSL+AAN G+LDD++V ++  FE  L+  +++S+ 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVSLYAANNGYLDDLDVKQVLSFEKGLRESLKTSNA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T D S +    LR+AIE+FK +  +
Sbjct: 481 DLIKRIEDTKDLSKDDEGALRSAIESFKKSGAY 513


>ATPA2_BURXL RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 513

 Score =  755 bits (1950), Expect = 0.0
 Identities = 385/513 (75%), Positives = 451/513 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G EA  + R +GTV+S+TDGIVRIHGL++VM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLEASADVRNQGTVISVTDGIVRIHGLSEVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  K TGRILEVPVG  LLGRVVDALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDVVKTTGRILEVPVGPELLGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEK+APGVI R+SVS+PVQTGLKSID+MVPVGRGQRELIIGDRQ GKTAVA+
Sbjct: 121 INAKKTDAIEKIAPGVIWRKSVSEPVQTGLKSIDAMVPVGRGQRELIIGDRQCGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKASS+  VVRKLEE GALE+TIVV         +Q++APY
Sbjct: 181 DTIINQKGKNLFCIYVAIGQKASSIMNVVRKLEETGALEYTIVVXXXXXXXXXMQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+ ++VEK T G+VKGK+GSLTALP+IETQAGDV+AF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSEDYVEKFTNGEVKGKSGSLTALPVIETQAGDVTAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL+KQ QY P+ V ++AV+LFAAN G+LDD+EV ++  FE  L+ Y++S H 
Sbjct: 421 LERGRRVTELLKQPQYQPLQVWELAVALFAANNGYLDDLEVAQVLPFEKGLRDYLKSKHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I  T + S +  A L  A+++FK +  +
Sbjct: 481 DLIKRIEDTKELSKDDEALLHTALKDFKKSGAY 513


>ATPA_DECAR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  754 bits (1946), Expect = 0.0
 Identities = 380/510 (74%), Positives = 440/510 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ +I+  +  +E RT+GTVVS+TDGI R+HGL DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSKIQNLQGASEVRTQGTVVSVTDGICRVHGLQDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAV+LG Y+HISEGD  K TGRILEVPVG  LLGRVV++LG PIDG GP
Sbjct: 61  GMALNLERDSVGAVVLGEYEHISEGDIVKTTGRILEVPVGPELLGRVVNSLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLK +DSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKLTDKIEKVAPGVIWRQSVSQPVQTGLKCVDSMVPVGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG G+ C+YVAIGQKAS++A VVRKLEEHGA+E+TIVV         LQ++APY
Sbjct: 181 DAIINQKGKGLFCVYVAIGQKASTIANVVRKLEEHGAMEYTIVVAAPASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRD GEDALIIYDDLTKQAW YRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDTGEDALIIYDDLTKQAWGYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+A  VEKL+ G +KGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVSAAWVEKLSNGAIKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGGVRL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKLIKKLGGGVRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+ VTELMKQ QYSPMS+ +MAV+L+AA++G+ DDVEV +  + E A+ GY++++  
Sbjct: 421 LERGRLVTELMKQPQYSPMSISEMAVTLYAADKGYFDDVEVKRALECEKAMIGYLKTNCA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           +L+  +  T D S +   +L A I  FK++
Sbjct: 481 DLMKTMESTADLSADSEKQLAAGIAAFKSS 510


>ATPA_AZOSE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  754 bits (1946), Expect = 0.0
 Identities = 376/508 (74%), Positives = 439/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EIS+LI+ RI+  +    +R EGTVVS+TDGI R+HGLADVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISDLIKSRIQNLQLAATSRNEGTVVSVTDGITRVHGLADVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HI+EGD  K TGRILEVPVG  L+GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHITEGDPVKATGRILEVPVGPELIGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKS+D+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKLTDKIEKVAPGVIWRQSVSQPVQTGLKSVDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + C+YVAIGQKAS++A VVRKLEEHGA+E+TIVV         +QFIAPY
Sbjct: 181 DAIINQKGQDMFCVYVAIGQKASTIANVVRKLEEHGAMEYTIVVAATASESAAMQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+A+HVEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+TDLF
Sbjct: 301 ASRVSADHVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLDTDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTELMKQ QY+P+SV  MA++L+A N G+ DDVEV ++  FES LQ Y+++ + 
Sbjct: 421 LERGRRVTELMKQPQYAPLSVADMAITLYAVNNGYFDDVEVPRLLAFESGLQQYVKAKNP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            L+ KI  + +   +   +L A I+ FK
Sbjct: 481 ALVTKIMTSKELDADGEKQLVAVIDEFK 508


>ATPA_PSEAE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  752 bits (1941), Expect = 0.0
 Identities = 384/512 (75%), Positives = 448/512 (87%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGT+VS++DGIVRI+GLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG YQ ++EG  AKCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGEYQGLAEGMNAKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+AT  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 DAKATDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTALAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GIKC+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQ++APY+
Sbjct: 183 AIINQKDSGIKCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQYLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+ +M++SL+AA  GFL DVE+ K+  FE AL  Y +  H  
Sbjct: 423 EHGQRVTELMKQKQYAPMSIAEMSLSLYAAERGFLQDVEIAKVGSFEQALISYFQREHAA 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LL KI + GD++DEI A ++A IE FK T TW
Sbjct: 483 LLAKINEKGDFNDEIDAGIKAGIEKFKATQTW 514


>ATPA_PSEAB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  752 bits (1941), Expect = 0.0
 Identities = 384/512 (75%), Positives = 448/512 (87%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGT+VS++DGIVRI+GLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG YQ ++EG  AKCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGEYQGLAEGMNAKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+AT  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 DAKATDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTALAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GIKC+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQ++APY+
Sbjct: 183 AIINQKDSGIKCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQYLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+ +M++SL+AA  GFL DVE+ K+  FE AL  Y +  H  
Sbjct: 423 EHGQRVTELMKQKQYAPMSIAEMSLSLYAAERGFLQDVEIAKVGSFEQALISYFQREHAA 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LL KI + GD++DEI A ++A IE FK T TW
Sbjct: 483 LLAKINEKGDFNDEIDAGIKAGIEKFKATQTW 514


>ATPA_PSEA8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  752 bits (1941), Expect = 0.0
 Identities = 384/512 (75%), Positives = 448/512 (87%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGT+VS++DGIVRI+GLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG YQ ++EG  AKCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGEYQGLAEGMNAKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+AT  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 DAKATDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTALAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GIKC+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQ++APY+
Sbjct: 183 AIINQKDSGIKCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQYLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+ +M++SL+AA  GFL DVE+ K+  FE AL  Y +  H  
Sbjct: 423 EHGQRVTELMKQKQYAPMSIAEMSLSLYAAERGFLQDVEIAKVGSFEQALISYFQREHAA 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LL KI + GD++DEI A ++A IE FK T TW
Sbjct: 483 LLAKINEKGDFNDEIDAGIKAGIEKFKATQTW 514


>ATPA_PSEA7 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  752 bits (1941), Expect = 0.0
 Identities = 384/512 (75%), Positives = 448/512 (87%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGT+VS++DGIVRI+GLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIEKLDVASQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG YQ ++EG  AKCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGEYQGLAEGMNAKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+AT  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 DAKATDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTALAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GIKC+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQ++APY+
Sbjct: 183 AIINQKDSGIKCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQYLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+ +M++SL+AA  GFL DVE+ K+  FE AL  Y +  H  
Sbjct: 423 EHGQRVTELMKQKQYAPMSIAEMSLSLYAAERGFLQDVEIAKVGSFEQALISYFQREHAA 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           LL KI + GD++DEI A ++A IE FK T TW
Sbjct: 483 LLAKINEKGDFNDEIDAGIKAGIEKFKATQTW 514


>ATPA_AZOSB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  752 bits (1941), Expect = 0.0
 Identities = 376/508 (74%), Positives = 438/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EIS+LI+ RI+  +    +R EGTVVS+TDGI RIHGL DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISDLIKSRIQNLQLAATSRNEGTVVSVTDGITRIHGLTDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HI+EGD  K TGRILEVPVG  L+GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHITEGDTVKATGRILEVPVGPELIGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI RQSVSQPVQTGLKS+DSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKLTDKIEKVAPGVIARQSVSQPVQTGLKSVDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + C+YVAIGQKAS++A VVRKLEE+GA+E+TIVV         +Q+++ Y
Sbjct: 181 DAIINQKGQNMFCVYVAIGQKASTIANVVRKLEENGAMEYTIVVAATASESAAMQYLSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRG+DALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VEK T G+VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNADYVEKFTNGEVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTELMKQ QY+P+SV +MA++L+A N G+ DDVEV ++  FES LQ ++++   
Sbjct: 421 LERGRRVTELMKQPQYAPLSVAEMAITLYAVNNGYFDDVEVARVLAFESGLQQFVKAKAP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           EL+ KIT T +   +    L AAI  FK
Sbjct: 481 ELVAKITDTKELDADGEKTLVAAIAEFK 508


>ATPA_PSEMY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  751 bits (1939), Expect = 0.0
 Identities = 385/512 (75%), Positives = 446/512 (87%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I++RIE  +   +AR EGT+VS++DGIVRI+GLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKQRIESLDVTAQARNEGTIVSVSDGIVRIYGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGSYLTLAEGMSAKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            A A+  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 NAAASDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTALAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI+C+YVAIGQK S++A VVRKLEE GAL +TIVV         LQF+APYA
Sbjct: 183 AIINQKDSGIRCVYVAIGQKQSTIANVVRKLEEAGALANTIVVXXXXXXXXXLQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+ +M+VSL+AA  GFL DVEV K+  FE AL  + +  H +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIAEMSVSLYAAERGFLQDVEVAKVISFEQALIAFFKRDHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI + GD++DEI A L+A IE FK T TW
Sbjct: 483 LMAKINEKGDFNDEIDAGLKAGIEKFKATQTW 514


>ATPA_NEIMF RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  751 bits (1938), Expect = 0.0
 Identities = 387/510 (75%), Positives = 443/510 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN AEIS+LI+ +IE    + E RT GTVVS+TDGIVRIHGL+D M GEM+EFPGNT+
Sbjct: 1   MQLNPAEISDLIKAKIENLSVNAEVRTRGTVVSVTDGIVRIHGLSDAMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLAMNLERDSVGAV+LG Y+HI EGD   CTGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLAMNLERDSVGAVVLGEYEHIKEGDTVTCTGRILEVPVGRELVGRVVDALGRPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T+PIEK+APGVI R+SV QP+QTGLK+IDSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTLTAPIEKIAPGVIARKSVDQPMQTGLKAIDSMVPVGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+NQKGTG+ CIYVAIGQKASS+A VVRKLEEHGA+EHTIVV         LQ+IAPY
Sbjct: 181 DAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTIVVXXXXXXXXXLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN   VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+ VTELMKQ Q+S ++  +MA++L+A N G   DV V K   FES    ++R+ H 
Sbjct: 421 LEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSDVPVAKALAFESEFLSFVRTQHP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           E+L+ +  +G  SDE    L AA+++FK++
Sbjct: 481 EVLEAVNASGAMSDESEKTLEAAMKSFKSS 510


>ATPA_NEIM0 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  750 bits (1937), Expect = 0.0
 Identities = 386/510 (75%), Positives = 443/510 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN AEIS+LI+ +IE    + E RT GTV+S+TDGIVRIHGL+D M GEM+EFPGNT+
Sbjct: 1   MQLNPAEISDLIKAKIENLSVNAEVRTRGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLAMNLERDSVGAV+LG Y+HI EGD   CTGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLAMNLERDSVGAVVLGEYEHIKEGDTVTCTGRILEVPVGRELVGRVVDALGRPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T+PIEK+APGVI R+SV QP+QTGLK+IDSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTLTAPIEKIAPGVIARKSVDQPMQTGLKAIDSMVPVGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+NQKGTG+ CIYVAIGQKASS+A VVRKLEEHGA+EHTIVV         LQ+IAPY
Sbjct: 181 DAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTIVVXXXXXXXXXLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN   VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+ VTELMKQ Q+S ++  +MA++L+A N G   DV V K   FES    ++R+ H 
Sbjct: 421 LEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSDVPVAKALAFESEFLSFVRTQHP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           E+L+ +  +G  SDE    L AA+++FK++
Sbjct: 481 EVLEAVNASGAMSDESEKTLEAAMKSFKSS 510


>ATPA_HERAR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 511

 Score =  750 bits (1936), Expect = 0.0
 Identities = 375/508 (73%), Positives = 435/508 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G     E R +GTV+S++DGI RIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLGESAEIRNQGTVISVSDGICRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVP+G  L GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPIGPELRGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A+ T+PIEK+APGVI RQSV QP+QTG+K+ID+MVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 VNAKLTAPIEKIAPGVIARQSVDQPMQTGIKAIDAMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASSV  +VR LE+HGA+E+TIVV         +QF++ Y
Sbjct: 181 DAIINQKGQNVTCIYVAIGQKASSVKNIVRSLEQHGAMEYTIVVAATASESAAMQFVSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLD +TRKQ
Sbjct: 361 NSGIRPAINAGISVSRVGGAAQTKVIKGLSGGIRTDLAQYRELAAFAQFASDLDASTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+RG RVTEL+KQ QY+P+S+  MAVSLFA N+G+ DD+EV ++  FES L G+M+SSH 
Sbjct: 421 LDRGARVTELLKQAQYAPLSISLMAVSLFAVNKGYFDDLEVKRVLAFESGLHGFMKSSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            LL KI  T     +  A L AAI +FK
Sbjct: 481 ALLQKIEDTKKLEKDDEAVLAAAIADFK 508


>ATPA_CELJU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  749 bits (1935), Expect = 0.0
 Identities = 366/512 (71%), Positives = 438/512 (85%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I++RI G E  TEA+ EGTVVS+TDGI+RIHGLA+VM+GEMIEF G  YG
Sbjct: 3   QLNPSEISEIIKQRIAGLEFSTEAQNEGTVVSVTDGIIRIHGLAEVMYGEMIEFEGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAVILG Y+ ++EG + KCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLERDSVGAVILGDYRGVAEGQKCKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EK+APGVI R+SV QPVQ GLK+ID+MVP+GRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 NTSQTDAVEKIAPGVIWRKSVDQPVQIGLKAIDAMVPIGRGQRELIIGDRQIGKTAIAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQKG+GIKCIYVAIGQKASS+A VVRKLEEHGA++HTIV+         +QF+AP+A
Sbjct: 183 AIINQKGSGIKCIYVAIGQKASSIASVVRKLEEHGAMDHTIVIAATASDPAAMQFLAPFA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRG+DALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGQDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AG+RP++NAG+SVSRVGGAAQTK+IKKL GG+R  LAQYRELAAF+QFASDLDEAT+ QL
Sbjct: 363 AGVRPSMNAGISVSRVGGAAQTKVIKKLSGGIRTALAQYRELAAFSQFASDLDEATKSQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ Q++P+SV QMA+ L+AANEG L D+EV+K+ DFE+AL  + ++ + +
Sbjct: 423 EHGQRVTELMKQKQFAPLSVAQMALVLYAANEGHLKDIEVNKVLDFEAALLSFAKAEYAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            +  I  TGD++ E+  + +  I   K + TW
Sbjct: 483 TIAHIDATGDWNGELEGKFKELITKLKASRTW 514


>ATPA_NEIMB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  749 bits (1933), Expect = 0.0
 Identities = 386/510 (75%), Positives = 443/510 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN AEIS+LI+ +IE    + E RT GTV+S+TDGIVRIHGL+D M GEM+EFPGNT+
Sbjct: 1   MQLNPAEISDLIKAKIENLSVNAEVRTCGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLAMNLERDSVGAV+LG Y+HI EGD   CTGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLAMNLERDSVGAVVLGEYEHIKEGDTVTCTGRILEVPVGRELVGRVVDALGRPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T+PIEK+APGVI R+SV QP+QTGLK+IDSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTLTAPIEKIAPGVIARKSVDQPMQTGLKAIDSMVPVGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+NQKGTG+ CIYVAIGQKASS+A VVRKLEEHGA+EHTIVV         LQ+IAPY
Sbjct: 181 DAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTIVVXXXXXXXXXLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN   VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+ VTELMKQ Q+S ++  +MA++L+A N G   DV V K   FES    ++R+ H 
Sbjct: 421 LEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSDVPVAKALAFESEFLSFVRTQHP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           E+L+ +  +G  SDE    L AA+++FK++
Sbjct: 481 EVLEAVNASGAMSDESEKTLEAAMKSFKSS 510


>ATPA_NEIMA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  748 bits (1932), Expect = 0.0
 Identities = 385/510 (75%), Positives = 443/510 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN AEIS+LI+ +IE    + E RT GTV+S+TDGIVRIHGL+D M GEM+EFPGNT+
Sbjct: 1   MQLNPAEISDLIKAKIENLSVNAEVRTRGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLAMNLERDSVGAV+LG ++HI EGD   CTGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLAMNLERDSVGAVVLGEHEHIKEGDTVTCTGRILEVPVGRELVGRVVDALGRPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T+PIEK+APGVI R+SV QP+QTGLK+IDSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTLTAPIEKIAPGVIARKSVDQPMQTGLKAIDSMVPVGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+NQKGTG+ CIYVAIGQKASS+A VVRKLEEHGA+EHTIVV         LQ+IAPY
Sbjct: 181 DAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTIVVXXXXXXXXXLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN   VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+ VTELMKQ Q+S ++  +MA++L+A N G   DV V K   FES    ++R+ H 
Sbjct: 421 LEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSDVPVAKALAFESEFLSFVRTQHP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           E+L+ +  +G  SDE    L AA+++FK++
Sbjct: 481 EVLEAVNASGAMSDESEKTLEAAMKSFKSS 510


>ATPA_CHRVO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  748 bits (1932), Expect = 0.0
 Identities = 388/508 (76%), Positives = 444/508 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EIS+LI+ +I+      E RT+GTV+S+TDGIVRIHGLADVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISDLIKAKIQNLAEGAEVRTKGTVISVTDGIVRIHGLADVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLAMNLERDSVGAV+LG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PIDG GP
Sbjct: 61  GLAMNLERDSVGAVVLGEYEHISEGDEVKCTGRILEVPVGPELVGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I AQ +SPIEK+APGVI R+SVSQP+QTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAQKSSPIEKIAPGVIARKSVSQPMQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG G+ CIYVA+GQKASS+A VVRKLEEHGA+ HTI+V         LQFIAPY
Sbjct: 181 DAIINQKGNGVICIYVAVGQKASSIANVVRKLEEHGAMGHTIIVXXXXXXXXXLQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRD GEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDIGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +AR+N E VEKLT G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARINEEEVEKLTGGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G+ VTELMKQ Q+S +S  +MA++L+A N+G  +DV V K   FE+     +R++H 
Sbjct: 421 LAHGEVVTELMKQKQFSTLSTAEMALTLWAVNKGSYEDVPVKKALAFEAEFLANVRANHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++L  +  +GD S +    L  A+E+FK
Sbjct: 481 DVLQAVNASGDLSADNEKVLAKAMESFK 508


>ATPA_JANMA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 511

 Score =  747 bits (1929), Expect = 0.0
 Identities = 374/508 (73%), Positives = 433/508 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI+G     E R +GTV+S++DGI RIHGL+DVM GEM+EFPGNT+
Sbjct: 1   MQLNPSEISELIKSRIQGLGDTAEIRNQGTVISVSDGICRIHGLSDVMQGEMLEFPGNTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVP+G  L GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPIGPELCGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I  + T+PIEK+APGVI RQSV QP+QTG+K+ID+MVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 INTKLTTPIEKIAPGVIARQSVDQPMQTGIKAIDAMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG G+ CIYVAIGQKASS+  +VR LE+HGA+E+TIVV         +QF++ Y
Sbjct: 181 DAIINQKGQGVTCIYVAIGQKASSIKNIVRALEQHGAMEYTIVVAATASESAAMQFVSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LF
Sbjct: 301 AARVNADYVEAFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLD +TRKQ
Sbjct: 361 NSGVRPAINAGISVSRVGGAAQTKVIKGLSGGIRTDLAQYRELAAFAQFASDLDASTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+RG RVTEL+KQ QY+P+S   MAVSLFA N+G+ DD+EV ++  FES L G+M+SSH 
Sbjct: 421 LDRGARVTELLKQAQYAPLSTSLMAVSLFAVNKGYFDDLEVKQVLAFESGLHGFMKSSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            LL KI  T     +  A L AAI +FK
Sbjct: 481 ALLQKIEDTKKLEKDDEAVLAAAIADFK 508


>ATPA_NEIG1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  746 bits (1925), Expect = 0.0
 Identities = 383/510 (75%), Positives = 441/510 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN AEIS+LI+ +IE    + E  T GTV+S+TDGIVRIHGL+D M GEM+EFPGNT 
Sbjct: 1   MQLNPAEISDLIKAKIENLSVNAEVSTRGTVISVTDGIVRIHGLSDAMQGEMLEFPGNTL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLAMNLERDSVGAV+LG Y+HI EGD   CTGRILEVPVG  L+GRVVDALG PIDG GP
Sbjct: 61  GLAMNLERDSVGAVVLGEYEHIKEGDTVTCTGRILEVPVGRELVGRVVDALGRPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T+P+EK+APGVI R+SV QP+QTGLK+IDSM+PVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTLTAPVEKIAPGVIARKSVDQPMQTGLKAIDSMIPVGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+NQKGTG+ CIYVAIGQKASS+A VVRKLEEHGA+EHTIVV         LQ+IAPY
Sbjct: 181 DAIVNQKGTGVICIYVAIGQKASSIANVVRKLEEHGAMEHTIVVXXXXXXXXXLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN   VEKLT G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEHEVEKLTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+ VTELMKQ Q+S ++  +MA++L+A N G   DV V K   FES    ++R+ H 
Sbjct: 421 LEHGEVVTELMKQKQFSTLNTAEMALTLWAINNGSYSDVPVAKALAFESEFLSFVRTQHP 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           E+L+ +  +G  SDE    L AA+++FK++
Sbjct: 481 EVLEAVNASGAMSDESEKTLEAAMKSFKSS 510


>ATPA_STRMK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  745 bits (1924), Expect = 0.0
 Identities = 371/515 (72%), Positives = 434/515 (84%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EISELI+ RIE  +   E+R EGTV S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISELIKNRIEKVKLAAESRNEGTVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+H+ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYEHLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+    T+P+E+VAPGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPLGTDLTAPVERVAPGVIWRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAM 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS++A +VRKLEE+GAL HTIVV         +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTIANIVRKLEENGALAHTIVVAATASESAAMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
            Y+GC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 AYSGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK TEGKV GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTEGKVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ K+  TG + ++I    +  I  FKTT +W
Sbjct: 481 QGELVSKVNATGGWDNDIEGAFKKGIAEFKTTGSW 515


>ATPA_BORA1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  745 bits (1923), Expect = 0.0
 Identities = 378/508 (74%), Positives = 443/508 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISEL++ RIEG  A T+ RT+GTVVS+TDGI RIHGL+DVM GEM+EFP N +
Sbjct: 1   MQLNPSEISELLKSRIEGLGASTDVRTQGTVVSVTDGITRIHGLSDVMQGEMLEFPNNVF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y  +SEGD+ K TGRILEVPVG  L GRVV+ LG+PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGDYTGVSEGDQVKTTGRILEVPVGPELRGRVVNTLGLPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I  + T  IEKVAPGVI R+SVSQP+QTG+K+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTKETDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+QKG G+ C+YVAIGQKAS++  VVRKLEEHGA+E+TIVV         +Q++A Y
Sbjct: 181 DTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTIVVXXXXXXXXXMQYLAAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK++KKL GG+R DLAQYRELAAFAQFASDLD+ATR+Q
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDLAQYRELAAFAQFASDLDDATRRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RV EL+KQ QY P+ V ++AVSL+  N G+LDDV+V ++  FE +L+  +++ H 
Sbjct: 421 LERGKRVVELLKQPQYQPLQVWELAVSLYTVNNGYLDDVDVAQVLSFEKSLKDQLKAKHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            L+ +I  T + S +  AEL AA+++FK
Sbjct: 481 ALIQRIEDTKELSKDDEAELAAAVQDFK 508


>ATPA_PSEE4 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  744 bits (1920), Expect = 0.0
 Identities = 383/512 (74%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG+ +G
Sbjct: 3   QLNPSEISEIIKGRIEKLDVSSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGSVFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG PIDG GP+
Sbjct: 63  MALNLEQDSVGAVVLGDYTSLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPIDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+A+D
Sbjct: 123 NNTETDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTAMAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVA+GQK S++A VVRKLEE GAL +TIVV         LQF+APYA
Sbjct: 183 AIINQKNSGIFCVYVAVGQKQSTIANVVRKLEEAGALANTIVVXXXXXXXXXLQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVEV K+  FE AL  Y    H E
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEVAKVGSFEQALIAYFNRDHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A ++A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGMKAGIEKFKATQTW 514


>ATPA_FRAP2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  743 bits (1918), Expect = 0.0
 Identities = 369/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI+KRIE F+   E ++EG++VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKKRIEKFDNSVELKSEGSIVSVADGIVTIYGLDDVTAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGRGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE   +SPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IETAHSSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKGTG+KCIYVAIGQKASS+A +VR+LEEHGA+EHTI+V         LQ+IAPY
Sbjct: 181 DAIINQKGTGVKCIYVAIGQKASSIANIVRQLEEHGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRGEDALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGEDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQ+REL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQFRELEAFSQFASDLDEATRSQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +S+  MA+SL+AA+ G+LD +EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSIALMALSLYAADNGYLDSLEVSEVIPFESALHALAENKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E++ +I +TG Y  EIA +L+  +E+ K    W
Sbjct: 481 EVVAEINETGKYDAEIAEKLKTIVEDCKANQAW 513


>ATPA_LARHH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  743 bits (1917), Expect = 0.0
 Identities = 370/508 (72%), Positives = 435/508 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELIR +I+   + TEART GTV+S+TDG++RIHGL D M GEM+EFPG TY
Sbjct: 1   MQLNPSEISELIRAKIQNLPSATEARTTGTVISVTDGVIRIHGLKDAMQGEMLEFPGGTY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYEHISEGDEVKCTGRILEVPVGPELVGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A+A+SP+EKVAPGVI R+SV QP+QTGLK ID+M+P+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 IQAKASSPVEKVAPGVIARKSVDQPLQTGLKGIDAMIPIGRGQRELIIGDRQTGKTAVAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG+G+ CIYVAIGQKASS+A VVRKLEEHGA++HTI+V         LQ+IAPY
Sbjct: 181 DAIINQKGSGVICIYVAIGQKASSIANVVRKLEEHGAMDHTIIVAASASETAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRD G D+LI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDTGRDSLIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEKLT G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNAEYVEKLTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+NAG+SVSRVGGAAQT +IKKLGGG+RL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAVNAGISVSRVGGAAQTNVIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G+ VTELMKQ Q+S + V +MA++L+   +G+ + + V     FES     ++++H 
Sbjct: 421 LSHGEIVTELMKQKQFSTLKVSEMAMTLYGVTKGYYEGIPVKTALKFESDFLSNIKANHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ELL  I K+G  SDE   +L  A E+FK
Sbjct: 481 ELLADIEKSGKLSDENDKKLAQAYESFK 508


>ATPA_SHESH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  742 bits (1916), Expect = 0.0
 Identities = 362/513 (70%), Positives = 439/513 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSETRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EGD+ K TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYASLAEGDKVKTTGRILEVPVGNGLLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IEHDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQIGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVA+GQKAS++A VVRKL+EHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKDSGIKCVYVAVGQKASTIANVVRKLDEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTKGEVKGRTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMS+   +VSLFAA +G+L  +E+ KI DFE++L  +M S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSIADQSVSLFAAEKGYLKSIELAKIGDFEASLLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+  I  TG Y+ +I  EL+A+++ F  T TW
Sbjct: 481 ELMKTINDTGSYNADIEGELKASLDKFVETQTW 513


>ATPA_POLNS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  742 bits (1915), Expect = 0.0
 Identities = 381/508 (75%), Positives = 437/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI     D++ R EGTV+S+TDGI R+HGL+ VM GEM+EFP NT 
Sbjct: 1   MQLNPSEISELIKSRISELGVDSQVRNEGTVISVTDGICRVHGLSGVMQGEMLEFPNNTI 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y HI EGD  KCTGRILEVPVG  LLGRVV  LG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYTHIKEGDPVKCTGRILEVPVGPELLGRVVSVLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I  + T  IEKVAPGVI RQSVSQPVQTGLK+ID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTKLTDFIEKVAPGVIARQSVSQPVQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG G+ C+YVAIGQKAS++A VVRKL E+GA+++TIVV         +Q+++ Y
Sbjct: 181 DAIINQKGKGVYCVYVAIGQKASTIANVVRKLTENGAIDYTIVVXXXXXXXXXMQYLSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNAEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGG AQTK+IKKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGVRPAINAGISVSRVGGTAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL KQ QY P+ V +MA SL+A N GF DD+EV  +  FE  LQ +++S + 
Sbjct: 421 LERGRRVTELCKQAQYKPLQVWEMAASLYAVNNGFFDDLEVKNVLAFEKGLQDHLKSKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+ +I  T D S +  A LRAA+E++K
Sbjct: 481 DLVARIEATKDLSKDDEAALRAAVEDYK 508


>ATPA_BORPD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  741 bits (1914), Expect = 0.0
 Identities = 377/508 (74%), Positives = 443/508 (87%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISEL++ RIEG  A  + RT+GTVVS+TDGI RIHGL+DVM GEM+EFP N +
Sbjct: 1   MQLNPSEISELLKSRIEGLGASADIRTQGTVVSVTDGITRIHGLSDVMQGEMLEFPNNVF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAVILG Y  +SEGD+ K TGRILEVPVG  L GRVV+ LG+PIDG GP
Sbjct: 61  GVALNLERDSVGAVILGDYTGVSEGDQVKTTGRILEVPVGPELKGRVVNTLGVPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+ + T  IEKVAPGVI R+SVSQP+QTG+K+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 IDTKETDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+QKG G+ C+YVAIGQKAS++  VVRKLEEHGA+E+TIVV         +Q++A Y
Sbjct: 181 DTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTIVVXXXXXXXXXMQYLAAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLD+ATR+Q
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RV EL+KQ QY P+ V ++AV+L+  N G+LDDV+V ++  FE +L+  +++ H 
Sbjct: 421 LERGKRVVELLKQPQYQPLQVWELAVTLYTVNNGYLDDVDVAQVLAFEKSLKDQLKAKHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            L+ +I  T + S +  AEL AAI++FK
Sbjct: 481 ALIQRIEDTKELSKDDEAELAAAIQDFK 508


>ATPA_PSEU5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  741 bits (1913), Expect = 0.0
 Identities = 382/512 (74%), Positives = 443/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I++RIE      +AR EGTVVS++DGIVRI+GLADVM+GEMIEFPG  +G
Sbjct: 3   QLNPSEISEIIKQRIEKSNVAAQARNEGTVVSVSDGIVRIYGLADVMYGEMIEFPGGIFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGNYLGLTEGMSAKCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            AQAT  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 NAQATDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI+C+YVAIGQK S++A VVRKLEEHGAL++TIVV         LQ++APYA
Sbjct: 183 AIINQKNSGIRCVYVAIGQKQSTIANVVRKLEEHGALQNTIVVXXXXXXXXXLQYLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGISVSRVGGAAQTKIVKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  M++SL+AA  G+L DVEV K+  FE AL  +      +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMSLSLYAAERGYLADVEVAKVGAFEQALIAFFNREFAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I   GD++DEI A L+A IE FK T +W
Sbjct: 483 LMARINVKGDFNDEIDAGLKAGIEKFKATQSW 514


>ATPA_PSEPG RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  741 bits (1912), Expect = 0.0
 Identities = 383/512 (74%), Positives = 439/512 (85%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAVILG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG PIDG GP+
Sbjct: 63  MALNLEQDSVGAVILGAYDTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPIDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 GNTQTDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVA+GQK S+VA +VRKLEE+GAL +TI           LQF+APYA
Sbjct: 183 AIINQKDSGIFCVYVAVGQKRSTVANIVRKLEENGALANTIXXXXXXXXXXXLQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVEV KI  FE AL  +    H E
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEVSKIGSFEQALIAFFNRDHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A L+A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGLKAGIEKFKATQTW 514


>ATPA_PSEF5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  741 bits (1912), Expect = 0.0
 Identities = 379/512 (74%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIEKLDVTSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG P+DG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYTSLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPVDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG K++D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 NNTETDAVEKVAPGVIWRKSVDQPVQTGYKAVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVAIGQK S++A VVRKLEE+GAL +TI+V         LQF+APY+
Sbjct: 183 AIINQKDSGIFCVYVAIGQKQSTIANVVRKLEENGALANTIIVXXXXXXXXXLQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  M++SL+AA  GFL DVE+ K+  FE A+  Y    H +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMSLSLYAAERGFLTDVEIAKVGSFEQAMIAYFNRDHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A L+A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGLKAGIEKFKATQTW 514


>ATPA_PSESM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  740 bits (1910), Expect = 0.0
 Identities = 380/512 (74%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDKLDVTSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG P+DG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYTTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPVDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG K++D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 NNTETDAVEKVAPGVIWRKSVDQPVQTGYKAVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQF+APY+
Sbjct: 183 AIINQKNSGIFCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVE+ KI  FE AL  Y    H +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEIAKIGSFEQALIAYFNRDHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A ++A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGMKAGIEKFKATQTW 514


>ATPA_PSEPW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  740 bits (1910), Expect = 0.0
 Identities = 381/512 (74%), Positives = 439/512 (85%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG PIDG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYDTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPIDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 GNTETDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVA+GQK S+VA +VRKLEE+GAL +TI           LQF+APYA
Sbjct: 183 AIINQKDSGIFCVYVAVGQKRSTVANIVRKLEENGALANTIXXXXXXXXXXXLQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVE+ KI  FE AL  Y    H E
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEIAKIGSFEQALIAYFNRDHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A ++A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGIKAGIEKFKATQTW 514


>ATPA_FRATM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  739 bits (1909), Expect = 0.0
 Identities = 365/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV+ GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVVAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEEHGA+EHTI+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +TG Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETGKYDADIADKLKIIVEDCKANQAW 513


>ATPA_PSEPK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  739 bits (1908), Expect = 0.0
 Identities = 383/512 (74%), Positives = 439/512 (85%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG+ YG
Sbjct: 3   QLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGSVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAVILG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG PIDG GP+
Sbjct: 63  MALNLEQDSVGAVILGAYDTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPIDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 GNTQTDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVA+GQK S+VA +VRKLEE GAL +TI           LQF+APYA
Sbjct: 183 AIINQKDSGIFCVYVAVGQKRSTVANIVRKLEETGALANTIXXXXXXXXXXXLQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVEV KI  FE AL  +    H E
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLIDVEVSKIGSFEQALIAFFNRDHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A L+A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGLKAGIEKFKATQTW 514


>ATPA_PSEP1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  739 bits (1908), Expect = 0.0
 Identities = 383/512 (74%), Positives = 438/512 (85%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDNLDVSSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAVILG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG PIDG GP+
Sbjct: 63  MALNLEQDSVGAVILGAYDTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPIDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG KS+D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 GNTQTDAVEKVAPGVIWRKSVDQPVQTGYKSVDAMIPVGRGQRELIIGDRQIGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVA+GQK S+VA +VRKLEE GAL +TI           LQF+APYA
Sbjct: 183 AIINQKNSGIFCVYVAVGQKRSTVANIVRKLEETGALANTIXXXXXXXXXXXLQFLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVEV KI  FE AL  +    H E
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLIDVEVSKIGSFEQALIAFFNRDHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A L+A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGLKAGIEKFKATQTW 514


>ATPA_POLSQ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  739 bits (1908), Expect = 0.0
 Identities = 381/508 (75%), Positives = 437/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ RI     D++ R EGTV+S+TDGI R+HGL+ VM GEM+EFP NT 
Sbjct: 1   MQLNPSEISELIKSRISEMGVDSQVRNEGTVISVTDGICRVHGLSGVMQGEMLEFPNNTI 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAV+LG Y HI EGD  KCTGRILEVPVG  LLGRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVVLGEYTHIKEGDPVKCTGRILEVPVGPELLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I  + T  IEKVAPGVI RQSVSQPVQTGLK+ID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTKLTDFIEKVAPGVIARQSVSQPVQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG G+ C+YVAIGQKAS++A VVRKL E GA+E+T            +Q+++ Y
Sbjct: 181 DAIINQKGKGVYCVYVAIGQKASTIANVVRKLTELGAMEYTXXXXXXXXXXXXMQYLSAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNAEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RVTEL KQ QY P+ V +MA SL+A N G+ DD+EV  +  FE  LQ +++S + 
Sbjct: 421 LERGRRVTELCKQAQYKPLQVWEMAASLYAVNNGYFDDLEVKNVLAFEKGLQDHLKSKYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+ +I +T D S +  A LRAAIE++K
Sbjct: 481 DLVARIEETKDLSKDDEAALRAAIEDYK 508


>ATPA_NITEU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  739 bits (1908), Expect = 0.0
 Identities = 381/513 (74%), Positives = 440/513 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ +IEG    +E RT+GT+VSLTDGIVR+HGL+DVM GEM+EFPG T+
Sbjct: 1   MQLNPSEISELIKSKIEGLSVTSEFRTQGTIVSLTDGIVRVHGLSDVMQGEMLEFPGGTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+H+ EGD  KCT RILEVPVGEALLGRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGAYEHLKEGDIVKCTSRILEVPVGEALLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T PIEK+APGV+ R+SV QPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IAAEGTEPIEKIAPGVVWRKSVDQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+A VVRKLEE GA+ +TI           +Q+IAPY
Sbjct: 181 DAIINQKGEDVICIYVAIGQKASSIANVVRKLEEVGAMAYTIXXXXXXXXXXXMQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRD+G+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDKGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE            SLTALPIIETQAGDV+AF+PTNVISITDGQIFLE+DLF
Sbjct: 301 AARVNADYVEXXXXXXXXXXXXSLTALPIIETQAGDVTAFVPTNVISITDGQIFLESDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+  TELMKQ QY+ + V +MA++LFA N+G+ DDV++ +   FESAL+ ++RS HG
Sbjct: 421 LERGKMATELMKQSQYATLKVSEMALTLFALNKGYFDDVDIKRALAFESALKSHIRSHHG 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            +LDKI  + +   E    L AAI+ FK   T+
Sbjct: 481 AILDKIEASKELDAETEKALEAAIQEFKQNGTY 513


>ATPA_PSEU2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  739 bits (1907), Expect = 0.0
 Identities = 379/512 (74%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDKLDVTSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG P+DG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYTTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPVDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG K++D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 NNTETDAVEKVAPGVIWRKSVDQPVQTGYKAVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQF+APY+
Sbjct: 183 AIINQKNSGIFCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVE+ KI  FE AL  Y    H +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEIAKIGSFEQALIAYFNRDHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI + ++A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDSGMKAGIEKFKATQTW 514


>ATPA_PSEFS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  739 bits (1907), Expect = 0.0
 Identities = 369/512 (72%), Positives = 432/512 (84%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDKLDVTSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG P+DG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYTSLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPVDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG K++D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 GNTETDAVEKVAPGVIWRKSVDQPVQTGYKAVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVAIGQK S++A VVRKLEE+GAL +TI+V         LQF+APY+
Sbjct: 183 AIINQKNSGIFCVYVAIGQKQSTIANVVRKLEENGALANTIIVAASASESPALQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVE+ K+  FE AL  Y    H E
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEIAKVGSFEQALIAYFNRDHAE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++D+I A ++A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDDIDAGMKAGIEKFKATQTW 514


>ATPA_PSE14 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  739 bits (1907), Expect = 0.0
 Identities = 379/512 (74%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RI+  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIDKLDVTSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG P+DG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYTTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPVDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG K++D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 NNTETDAVEKVAPGVIWRKSVDQPVQTGYKAVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVAIGQK S++A VVRKLEE+GAL +TIVV         LQF+APY+
Sbjct: 183 AIINQKNSGIFCVYVAIGQKQSTIANVVRKLEENGALANTIVVXXXXXXXXXLQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  MA+SL+AA  GFL DVE+ KI  FE AL  Y    H +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMALSLYAAERGFLTDVEIAKIGSFEQALIAYFNRDHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI + ++A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDSGMKAGIEKFKATQTW 514


>ATPA_FRATN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  739 bits (1907), Expect = 0.0
 Identities = 365/513 (71%), Positives = 435/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVAAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEEHGA+EHTI+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +TG Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETGKYDADIADKLKIIVEDCKANQAW 513


>ATPA_DELAS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 517

 Score =  738 bits (1906), Expect = 0.0
 Identities = 375/513 (73%), Positives = 432/513 (84%), Gaps = 5/513 (0%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG    ++ R EGTVVS+TDGIVR+HGL+DVM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLAGSSDIRNEGTVVSVTDGIVRVHGLSDVMQGEMLEFPAGKD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              ++GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GQPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPVGPELIGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI RQSV QP+QTG+KSIDSMVPVGRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGIKSIDSMVPVGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG G+ CIYVAIGQKASS+  VVR LE+ GA+E+TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALEQAGAMEYTIVVAATASESAAMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK++K   GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLVKGQSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+S   M  SLFA N+G++DD++V ++  FES L  ++
Sbjct: 421 ATRKQLDRGARVTELLKQAQYSPLSTALMGASLFAVNKGYMDDIQVKQVLAFESGLHQFL 480

Query: 478 RSSHGELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++SHG L+DK+  +     +  AEL AAI  FK
Sbjct: 481 KTSHGALIDKLNASKAMDKDSEAELNAAIAAFK 513


>ATPA_PSEPF RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  738 bits (1904), Expect = 0.0
 Identities = 378/512 (73%), Positives = 441/512 (86%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISE+I+ RIE  +  ++AR EGTVVS++DGIVRIHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPSEISEIIKGRIEKLDVTSQARNEGTVVSVSDGIVRIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  ++EG  AKCTGRILEVPVG+ LLGRVVDALG P+DG GP+
Sbjct: 63  MALNLEQDSVGAVVLGAYTTLAEGMSAKCTGRILEVPVGKELLGRVVDALGNPVDGKGPL 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
               T  +EKVAPGVI R+SV QPVQTG K++D+M+PVGRGQRELIIGDRQ GKTA+AID
Sbjct: 123 GNTETDAVEKVAPGVIWRKSVDQPVQTGYKAVDAMIPVGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AIINQK +GI C+YVAIGQK S++A VVRKLEE+GAL +TI+V         LQF+APY+
Sbjct: 183 AIINQKDSGIFCVYVAIGQKQSTIANVVRKLEENGALANTIIVXXXXXXXXXLQFLAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGE+FRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEFFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ +FN
Sbjct: 303 SRVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESAMFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 SGIRPAVNAGVSVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+PMS+  M++SL+AA  GFL D+E+ KI  FE AL  +    H +
Sbjct: 423 EHGQRVTELMKQKQYAPMSIADMSLSLYAAERGFLTDIEITKIGSFEQALIAFFNRDHAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ KI   GD++DEI A L+A IE FK T TW
Sbjct: 483 LMAKINVKGDFNDEIDAGLKAGIEKFKATQTW 514


>ATPA1_NITEC RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  737 bits (1903), Expect = 0.0
 Identities = 378/508 (74%), Positives = 439/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISELI+ +IEG    +E RT+GT+VSLTDGIVR+HGL+DVM GEM+EFPG TY
Sbjct: 1   MQLNPSEISELIKSKIEGLSVTSEFRTQGTIVSLTDGIVRVHGLSDVMQGEMLEFPGGTY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+H++EGD  KCTGR+LEVPVGEALLGRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGAYEHLTEGDIVKCTGRVLEVPVGEALLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + AQ   PIEK+APGVI+R+SV QP+QTGLKS+DSMVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 VAAQGMEPIEKIAPGVISRKSVDQPMQTGLKSVDSMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVAIGQKASS+A VVRKLEE GA+ +TI           +Q+IAPY
Sbjct: 181 DAIINQKGEDMICIYVAIGQKASSIANVVRKLEEVGAMAYTIXXXXXXXXXXXMQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRD+G+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDKGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE            SLTALPIIETQAGDV+AF+PTNVISITDGQIFLE+DLF
Sbjct: 301 AARVNADYVEXXXXXXXXXXXXSLTALPIIETQAGDVTAFVPTNVISITDGQIFLESDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IKKLGGG+RL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NAGIRPAINAGVSVSRVGGAAQTKVIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+  TELMKQ QY+ + V +MA++LFA N+G+ DDV++ +   FESAL+ ++RS H 
Sbjct: 421 LERGKMATELMKQAQYATLKVSEMALTLFALNKGYFDDVDIKRALAFESALKSHVRSHHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            +LDKI  T +   E    L AAI+ FK
Sbjct: 481 AILDKIETTKELDAETEKALEAAIQEFK 508


>ATPA_XYLFM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  737 bits (1902), Expect = 0.0
 Identities = 369/515 (71%), Positives = 432/515 (83%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EISELI+ RIE  +   E+R EGTV S++DGIVRI GLAD M GEMIE P  
Sbjct: 1   MATTLNPSEISELIKTRIEQVKLSAESRNEGTVTSVSDGIVRIFGLADAMQGEMIELPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TY LA+NLERDSVGAVILG Y+H+ EGD AK TGRILEVPVG++LLGRVV+ALG PIDG 
Sbjct: 61  TYALALNLERDSVGAVILGDYKHLREGDVAKTTGRILEVPVGKSLLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G +    T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GTLGPTQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAM 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID +I+QK TGIKC+YVAIGQKAS++A +VRKLEE+ AL+HTIVV         LQ+I+
Sbjct: 181 AIDTVISQKDTGIKCVYVAIGQKASTIANIVRKLEENDALDHTIVVAATASESAALQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
            YAGC MGEYF DRGEDALIIYDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 AYAGCTMGEYFMDRGEDALIIYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTQGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDE TR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDETTR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+ MSV   A+S++A NEG+LDD+ VDK+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYTSMSVANQALSIYAVNEGYLDDIPVDKVLTFEEGLHAHFSNT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            G L+DKI  +GD+ + I A  +  IE FKTT +W
Sbjct: 481 QGALIDKINNSGDWDNNIEAAFKQHIEEFKTTGSW 515


>ATPA_FRATT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  737 bits (1902), Expect = 0.0
 Identities = 364/513 (70%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVAAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEEHGA+EH I+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHAIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +TG Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETGKYDADIADKLKIIVEDCKANQAW 513


>ATPA_FRAT1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  737 bits (1902), Expect = 0.0
 Identities = 364/513 (70%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVAAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEEHGA+EH I+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHAIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +TG Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETGKYDADIADKLKIIVEDCKANQAW 513


>ATPA_FRATW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  736 bits (1901), Expect = 0.0
 Identities = 364/513 (70%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVAAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A C GRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCIGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEEHGA+EHTI+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEHGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +TG Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETGKYDADIADKLKIIVEDCKANQAW 513


>ATPA_DIAST RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 519

 Score =  736 bits (1900), Expect = 0.0
 Identities = 387/515 (75%), Positives = 442/515 (85%), Gaps = 7/515 (1%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG  A ++ R +GTVVS+TDGIVR+HGL+DVM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVTDGIVRVHGLSDVMQGEMLEFPAAAD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              ++GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GQPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPVGPELIGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI RQSV QP+QTGLKSIDSMVP+GRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGLKSIDSMVPIGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG G+ CIYVAIGQKASS+  VVR LE+ GA+E+TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALEQAGAMEYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VE  T+G+VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEAFTKGEVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLIKGLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+S   M  +LF  N+GFLDDV+V K+  FE+ L  Y+
Sbjct: 421 ATRKQLDRGARVTELLKQPQYSPLSTALMGATLFTVNKGFLDDVDVKKVLAFEAGLHQYL 480

Query: 478 RSSHGELLDKI--TKTGDYSDEIAAELRAAIENFK 510
           ++SHG LLD++   +  D   +  AEL  AI  FK
Sbjct: 481 KTSHGALLDRLQQNRAFDKEGKDEAELTQAITAFK 515


>ATPA_ACISJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 519

 Score =  736 bits (1900), Expect = 0.0
 Identities = 387/515 (75%), Positives = 442/515 (85%), Gaps = 7/515 (1%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG  A ++ R +GTVVS+TDGIVR+HGL+DVM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVTDGIVRVHGLSDVMQGEMLEFPAAAD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              ++GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GQPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPVGPELIGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI RQSV QP+QTGLKSIDSMVP+GRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARQSVDQPLQTGLKSIDSMVPIGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG G+ CIYVAIGQKASS+  VVR LE+ GA+E+TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQGVTCIYVAIGQKASSIKNVVRALEQAGAMEYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VE  T+G+VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEAFTKGEVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLIKGLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+S   M  +LF  N+GFLDDV+V K+  FE+ L  Y+
Sbjct: 421 ATRKQLDRGARVTELLKQPQYSPLSTALMGATLFTVNKGFLDDVDVKKVLAFEAGLHQYL 480

Query: 478 RSSHGELLDKI--TKTGDYSDEIAAELRAAIENFK 510
           ++SHG LLD++   +  D   +  AEL  AI  FK
Sbjct: 481 KTSHGALLDRLQQNRAFDKEGKDEAELTQAITAFK 515


>ATPA_XYLFA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  735 bits (1898), Expect = 0.0
 Identities = 368/515 (71%), Positives = 433/515 (84%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EISELI+ RIE  +   E+R EGTV S++DGIVRI GLAD M GEMIE P  
Sbjct: 1   MATTLNPSEISELIKTRIEQVKLSAESRNEGTVTSVSDGIVRIFGLADAMQGEMIELPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TY LA+NLERDSVGAV+LG Y+H+ EGD AK TGRILEVPVG++LLGRVV+ALG PIDG 
Sbjct: 61  TYALALNLERDSVGAVVLGDYEHLREGDIAKTTGRILEVPVGKSLLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G +    T+P+E+VAPGVI R+SV+QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GALGPTQTAPVERVAPGVIWRKSVNQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAM 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID +I+QK TGIKC+YVAIGQKAS++A +VRKLEE+ AL+HTIVV         LQ+I+
Sbjct: 181 AIDTVISQKDTGIKCVYVAIGQKASTIANIVRKLEENDALDHTIVVAATASESAALQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
            YAGC MGEYF DRGEDALIIYDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 AYAGCTMGEYFMDRGEDALIIYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTQGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDE TR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDETTR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+ MSV   A+S++A NEG+LDDV VDK+  FE +L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYTSMSVANQALSIYAVNEGYLDDVPVDKVLTFEESLHAHFSNT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
              L+DKI  +GD+ + I A  +  IE FKTT +W
Sbjct: 481 QSALIDKINTSGDWDNNIEAAFKKHIEEFKTTGSW 515


>ATPA_LEPCP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  735 bits (1898), Expect = 0.0
 Identities = 381/508 (75%), Positives = 435/508 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN AEISELI+ RIEG  A T+ R +GTVVS+TDGIVR+HGL+D M GEM+EFPGN +
Sbjct: 1   MQLNPAEISELIKSRIEGLGAATDVRNQGTVVSVTDGIVRVHGLSDAMAGEMLEFPGNVF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGAVILG Y+ ISEGD  +CTGRILEVPVG  L+GRVV+ALG PIDG GP
Sbjct: 61  GLALNLERDSVGAVILGEYEGISEGDTVRCTGRILEVPVGPELIGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ T  IEKVAPGVI R+SV QPVQTGLKSIDSMVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 INAKMTDVIEKVAPGVIARKSVDQPVQTGLKSIDSMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + C+YVAIGQKASS+  VVR LE+ GA+E+TIVV         +Q+I+ Y
Sbjct: 181 DAIINQKGQNMTCVYVAIGQKASSIKNVVRALEQAGAMEYTIVVXXXXXXXXXMQYISAY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 TGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G VKGKTGSLTALP+IETQAGDVSAF+PTNVISITDGQIFLET LF
Sbjct: 301 AARVNADYVEAFTKGAVKGKTGSLTALPVIETQAGDVSAFVPTNVISITDGQIFLETSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLD +TRKQ
Sbjct: 361 NAGIRPAINAGISVSRVGGAAQTKLIKGLSGGIRTDLAQYRELAAFAQFASDLDASTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+RG RVTEL+KQ QYSP  +  M  +L+A N+G+LDD+EV K+  FES +  Y+++SH 
Sbjct: 421 LDRGARVTELLKQAQYSPQPISLMGATLYAVNKGYLDDIEVKKVLAFESGMHQYLKTSHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            LL K+  T     +  AEL+ AI  FK
Sbjct: 481 ALLQKLETTKALDKDAEAELQGAIAAFK 508


>ATPA2_MARMS RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 514

 Score =  734 bits (1896), Expect = 0.0
 Identities = 368/512 (71%), Positives = 421/512 (82%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN               +  ++A+ EGT+VS+ DGIV IHGLADVM+GEMIEFPG  YG
Sbjct: 3   QLNPXXXXXXXXXXXXNLDVSSDAQNEGTIVSVADGIVLIHGLADVMYGEMIEFPGGVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAV+LG YQ + EG + KCTGRILEVP+G  LLGRVVDALG PIDG G I
Sbjct: 63  IALNLERDSVGAVVLGKYQDLVEGQKVKCTGRILEVPIGPELLGRVVDALGNPIDGKGAI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            A+ T  +EKVAPGVI RQSV QP+QTG K+ID+MVP+GRGQRELIIGDRQ GKTA+AID
Sbjct: 123 NAKLTDKVEKVAPGVIERQSVDQPIQTGYKAIDAMVPIGRGQRELIIGDRQIGKTALAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
            II QK +GIKC+YVAIGQK S++A VVRKLEE GA+E+T VV         + +IAPY 
Sbjct: 183 TIIAQKDSGIKCVYVAIGQKQSTIANVVRKLEEAGAMEYTTVVAAGASDPAAMLYIAPYT 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RVN ++VEK T G+VKGKTGSLTALPIIETQ GDVSAF+PTNVISITDGQIFLET  FN
Sbjct: 303 SRVNVDYVEKFTNGEVKGKTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLETSSFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGGAAQTKI+KKLGGG+RL LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAMNAGISVSRVGGAAQTKIVKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E G++VTELMKQ Q+SPMSV  M V L+AAN+GFL+DVE  KI  FE+AL  YM S H +
Sbjct: 423 EHGKQVTELMKQKQFSPMSVADMGVVLYAANDGFLEDVETSKIGSFETALLSYMNSEHTD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+  I KTG+++ EI A  +AAIE FK T TW
Sbjct: 483 LMADINKTGNFNGEIEATFKAAIEKFKATQTW 514


>ATPA1_VIBHB RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  734 bits (1896), Expect = 0.0
 Identities = 374/513 (72%), Positives = 444/513 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F+  +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  Y
Sbjct: 1   MQLNSTEISDLIKQRIESFDVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY ++ EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYANLKEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQREL+IGDRQTGKTA+AI
Sbjct: 121 IEAKLTSPVEVIAPGVIARKSVDQPVQTGYKSVDSMIPIGRGQRELVIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKDSGIFSIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQF+SDLDEAT+KQ
Sbjct: 361 NAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFSSDLDEATKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTELMKQ QY+PMSV   A+ +FAA  G+L DVE++K+ DFE+AL  Y R  + 
Sbjct: 421 LDHGQKVTELMKQKQYAPMSVFDQALVIFAAERGYLADVELNKLLDFEAALLSYARGQYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E   +I KTG Y+DE+ A+L+   ++F  T TW
Sbjct: 481 EFAAEIDKTGAYNDEVEAQLKKLTDDFVATQTW 513


>ATPA_FRATO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  734 bits (1894), Expect = 0.0
 Identities = 363/513 (70%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVTAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEE+GA+EHTI+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEYGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +T  Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETDKYDADIADKLKIIVEDCKANQAW 513


>ATPA_FRATH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  734 bits (1894), Expect = 0.0
 Identities = 363/513 (70%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVTAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEE+GA+EHTI+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEYGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +T  Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETDKYDADIADKLKIIVEDCKANQAW 513


>ATPA_FRATF RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  734 bits (1894), Expect = 0.0
 Identities = 363/513 (70%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL+ +EIS LI++RIE F+   E ++EGT+VS+ DGIV I+GL DV  GEMI+ PG+ Y
Sbjct: 1   MQLSPSEISGLIKQRIEKFDNSVELKSEGTIVSVADGIVTIYGLNDVTAGEMIKLPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NL  DSVGAV+LG Y+HI EGD+A CTGRILEVPVGEALLGRVVDALG PIDG G 
Sbjct: 61  GLALNLNTDSVGAVVLGDYEHIKEGDKAYCTGRILEVPVGEALLGRVVDALGNPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    TSPIEK+APGVI R+SV Q +QTG+KSIDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 VATDLTSPIEKIAPGVIWRKSVDQALQTGIKSIDSMVPIGRGQRELIIGDRQIGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKGTG+KCIYVAIGQKAS++A +VR+LEE+GA+EHTI+V         LQ+IAPY
Sbjct: 181 DTIINQKGTGVKCIYVAIGQKASTIANIVRQLEEYGAMEHTIIVAATASDSAALQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G+VKGKTGSLTALPIIETQAGD+SAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGEVKGKTGSLTALPIIETQAGDISAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPAIN G SVSRVGGAAQTKIIKKLGGG+RL LAQYREL AF+QFASDLDEATR Q
Sbjct: 361 NSGLRPAINPGNSVSRVGGAAQTKIIKKLGGGIRLALAQYRELEAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQRVTEL+KQ Q+S +SV  MA+SL+AA+ G+LD++EV ++  FESAL     + + 
Sbjct: 421 LNRGQRVTELLKQKQFSTLSVALMALSLYAADNGYLDNLEVSEVIPFESALHALAETKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +++ +I +T  Y  +IA +L+  +E+ K    W
Sbjct: 481 DVIAEINETDKYDADIADKLKIIVEDCKANQAW 513


>ATPA_COXBU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  734 bits (1894), Expect = 0.0
 Identities = 364/515 (70%), Positives = 426/515 (82%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  QL AAEIS++I  RIE F    E RTEGT++++ DGIVR++GL DVMFGEM+EFP N
Sbjct: 1   MSTQLRAAEISDIIESRIEKFGIKAEERTEGTILNIKDGIVRVYGLRDVMFGEMVEFPEN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TYGLA NLERDSVGAV++GPY+H+ EG  A+CTGRILEVPVGEALLGRVVD LG PIDG 
Sbjct: 61  TYGLAFNLERDSVGAVVMGPYEHLEEGMTARCTGRILEVPVGEALLGRVVDGLGKPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPI+   TSPIEKVAPGVITR+SV   + TGLKSID+MVP+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPIDTSETSPIEKVAPGVITRKSVDTSLPTGLKSIDAMVPIGRGQRELIIGDRQTGKTAI 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQK TG+KCIYVAIGQK SSVA VVRKLEEHGA+EHTIVV         LQ++A
Sbjct: 181 AIDTIINQKHTGVKCIYVAIGQKQSSVAAVVRKLEEHGAMEHTIVVNASASEAAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLL
Sbjct: 241 PYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A VN  +V++ T+GKV GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQI+L+ +
Sbjct: 301 ERAAHVNEAYVKEFTKGKVTGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIYLDVN 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAINAGLSVSRVGGAAQT          R+ LAQYREL AF+QFASDLDEATR
Sbjct: 361 LFNAGIRPAINAGLSVSRVGGAAQTXXXXXXXXXXRIALAQYRELEAFSQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLE GQRV E++KQ QY P+SVG+MA+  +  N  +LD VE+ K+ DFE +L  ++R  
Sbjct: 421 KQLEHGQRVMEILKQPQYQPLSVGEMAIIWYVVNNNYLDQVELKKVVDFERSLLSFLRDQ 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           H +LLD+I K  +YS++I  +++A +E F  T ++
Sbjct: 481 HQDLLDEINKNPNYSEKIIEKIKAVVEEFVKTQSY 515


>ATPA_COXBR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  734 bits (1894), Expect = 0.0
 Identities = 364/515 (70%), Positives = 426/515 (82%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  QL AAEIS++I  RIE F    E RTEGT++++ DGIVR++GL DVMFGEM+EFP N
Sbjct: 1   MSTQLRAAEISDIIESRIEKFGIKAEERTEGTILNIKDGIVRVYGLRDVMFGEMVEFPEN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TYGLA NLERDSVGAV++GPY+H+ EG  A+CTGRILEVPVGEALLGRVVD LG PIDG 
Sbjct: 61  TYGLAFNLERDSVGAVVMGPYEHLEEGMTARCTGRILEVPVGEALLGRVVDGLGKPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPI+   TSPIEKVAPGVITR+SV   + TGLKSID+MVP+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPIDTSETSPIEKVAPGVITRKSVDTSLPTGLKSIDAMVPIGRGQRELIIGDRQTGKTAI 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQK TG+KCIYVAIGQK SSVA VVRKLEEHGA+EHTIVV         LQ++A
Sbjct: 181 AIDTIINQKHTGVKCIYVAIGQKQSSVAAVVRKLEEHGAMEHTIVVNASASEAAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLL
Sbjct: 241 PYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A VN  +V++ T+GKV GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQI+L+ +
Sbjct: 301 ERAAHVNEAYVKEFTKGKVTGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIYLDVN 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAINAGLSVSRVGGAAQT          R+ LAQYREL AF+QFASDLDEATR
Sbjct: 361 LFNAGIRPAINAGLSVSRVGGAAQTXXXXXXXXXXRIALAQYRELEAFSQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLE GQRV E++KQ QY P+SVG+MA+  +  N  +LD VE+ K+ DFE +L  ++R  
Sbjct: 421 KQLEHGQRVMEILKQPQYQPLSVGEMAIIWYVVNNNYLDQVELKKVVDFERSLLSFLRDQ 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           H +LLD+I K  +YS++I  +++A +E F  T ++
Sbjct: 481 HQDLLDEINKNPNYSEKIIEKIKAVVEEFVKTQSY 515


>ATPA_COXBN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  734 bits (1894), Expect = 0.0
 Identities = 364/515 (70%), Positives = 426/515 (82%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  QL AAEIS++I  RIE F    E RTEGT++++ DGIVR++GL DVMFGEM+EFP N
Sbjct: 1   MSTQLRAAEISDIIESRIEKFGIKAEERTEGTILNIKDGIVRVYGLRDVMFGEMVEFPEN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TYGLA NLERDSVGAV++GPY+H+ EG  A+CTGRILEVPVGEALLGRVVD LG PIDG 
Sbjct: 61  TYGLAFNLERDSVGAVVMGPYEHLEEGMTARCTGRILEVPVGEALLGRVVDGLGKPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPI+   TSPIEKVAPGVITR+SV   + TGLKSID+MVP+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPIDTSETSPIEKVAPGVITRKSVDTSLPTGLKSIDAMVPIGRGQRELIIGDRQTGKTAI 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQK TG+KCIYVAIGQK SSVA VVRKLEEHGA+EHTIVV         LQ++A
Sbjct: 181 AIDTIINQKHTGVKCIYVAIGQKQSSVAAVVRKLEEHGAMEHTIVVNASASEAAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLL
Sbjct: 241 PYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A VN  +V++ T+GKV GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQI+L+ +
Sbjct: 301 ERAAHVNEAYVKEFTKGKVTGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIYLDVN 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAINAGLSVSRVGGAAQT          R+ LAQYREL AF+QFASDLDEATR
Sbjct: 361 LFNAGIRPAINAGLSVSRVGGAAQTXXXXXXXXXXRIALAQYRELEAFSQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLE GQRV E++KQ QY P+SVG+MA+  +  N  +LD VE+ K+ DFE +L  ++R  
Sbjct: 421 KQLEHGQRVMEILKQPQYQPLSVGEMAIIWYVVNNNYLDQVELKKVVDFERSLLSFLRDQ 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           H +LLD+I K  +YS++I  +++A +E F  T ++
Sbjct: 481 HQDLLDEINKNPNYSEKIIEKIKAVVEEFVKTQSY 515


>ATPA_COXB2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  734 bits (1894), Expect = 0.0
 Identities = 364/515 (70%), Positives = 426/515 (82%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  QL AAEIS++I  RIE F    E RTEGT++++ DGIVR++GL DVMFGEM+EFP N
Sbjct: 1   MSTQLRAAEISDIIESRIEKFGIKAEERTEGTILNIKDGIVRVYGLRDVMFGEMVEFPEN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TYGLA NLERDSVGAV++GPY+H+ EG  A+CTGRILEVPVGEALLGRVVD LG PIDG 
Sbjct: 61  TYGLAFNLERDSVGAVVMGPYEHLEEGMTARCTGRILEVPVGEALLGRVVDGLGKPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPI+   TSPIEKVAPGVITR+SV   + TGLKSID+MVP+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPIDTSETSPIEKVAPGVITRKSVDTSLPTGLKSIDAMVPIGRGQRELIIGDRQTGKTAI 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQK TG+KCIYVAIGQK SSVA VVRKLEEHGA+EHTIVV         LQ++A
Sbjct: 181 AIDTIINQKHTGVKCIYVAIGQKQSSVAAVVRKLEEHGAMEHTIVVNASASEAAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLL
Sbjct: 241 PYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A VN  +V++ T+GKV GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQI+L+ +
Sbjct: 301 ERAAHVNEAYVKEFTKGKVTGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIYLDVN 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAINAGLSVSRVGGAAQT          R+ LAQYREL AF+QFASDLDEATR
Sbjct: 361 LFNAGIRPAINAGLSVSRVGGAAQTXXXXXXXXXXRIALAQYRELEAFSQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLE GQRV E++KQ QY P+SVG+MA+  +  N  +LD VE+ K+ DFE +L  ++R  
Sbjct: 421 KQLEHGQRVMEILKQPQYQPLSVGEMAIIWYVVNNNYLDQVELKKVVDFERSLLSFLRDQ 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           H +LLD+I K  +YS++I  +++A +E F  T ++
Sbjct: 481 HQDLLDEINKNPNYSEKIIEKIKAVVEEFVKTQSY 515


>ATPA_COXB1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  734 bits (1894), Expect = 0.0
 Identities = 364/515 (70%), Positives = 426/515 (82%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  QL AAEIS++I  RIE F    E RTEGT++++ DGIVR++GL DVMFGEM+EFP N
Sbjct: 1   MSTQLRAAEISDIIESRIEKFGIKAEERTEGTILNIKDGIVRVYGLRDVMFGEMVEFPEN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TYGLA NLERDSVGAV++GPY+H+ EG  A+CTGRILEVPVGEALLGRVVD LG PIDG 
Sbjct: 61  TYGLAFNLERDSVGAVVMGPYEHLEEGMTARCTGRILEVPVGEALLGRVVDGLGKPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPI+   TSPIEKVAPGVITR+SV   + TGLKSID+MVP+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPIDTSETSPIEKVAPGVITRKSVDTSLPTGLKSIDAMVPIGRGQRELIIGDRQTGKTAI 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQK TG+KCIYVAIGQK SSVA VVRKLEEHGA+EHTIVV         LQ++A
Sbjct: 181 AIDTIINQKHTGVKCIYVAIGQKQSSVAAVVRKLEEHGAMEHTIVVNASASEAAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYFRDRG+DALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLL
Sbjct: 241 PYAGCTMGEYFRDRGQDALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDIFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A VN  +V++ T+GKV GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQI+L+ +
Sbjct: 301 ERAAHVNEAYVKEFTKGKVTGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIYLDVN 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAINAGLSVSRVGGAAQT          R+ LAQYREL AF+QFASDLDEATR
Sbjct: 361 LFNAGIRPAINAGLSVSRVGGAAQTXXXXXXXXXXRIALAQYRELEAFSQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLE GQRV E++KQ QY P+SVG+MA+  +  N  +LD VE+ K+ DFE +L  ++R  
Sbjct: 421 KQLEHGQRVMEILKQPQYQPLSVGEMAIIWYVVNNNYLDQVELKKVVDFERSLLSFLRDQ 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           H +LLD+I K  +YS++I  +++A +E F  T ++
Sbjct: 481 HQDLLDEINKNPNYSEKIIEKIKAVVEEFVKTQSY 515


>ATPA_HAEI8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  733 bits (1892), Expect = 0.0
 Identities = 370/513 (72%), Positives = 443/513 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL+DVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRILEVPVG  LLGRVV+ LG PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGSGLLGRVVNTLGQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDDFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRNSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN ++VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNEDYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G++VTEL+KQ Q++P+SV + AV LFA   G+LDDVE+ KI  FE+AL  Y   +H 
Sbjct: 421 LSHGEKVTELLKQKQFAPLSVAEQAVILFAVEFGYLDDVELSKIASFETALLDYSNRNHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E + ++ KTG+Y+DEI   L++ ++ FK  + W
Sbjct: 481 EFMQELNKTGNYNDEIKDTLKSILDGFKANSAW 513


>ATPA_AERS4 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  732 bits (1890), Expect = 0.0
 Identities = 374/513 (72%), Positives = 440/513 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI++RI  F+  +EAR EGT+VS++DGI+RIHGLAD M GEMIE PGN +
Sbjct: 1   MQLNSTEIAELIKQRIAQFDVKSEARNEGTIVSVSDGIIRIHGLADAMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAVI+G Y  +SEG + K TGRILEVPVG  LLGRV++ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVIMGSYDGLSEGMKVKGTGRILEVPVGRGLLGRVLNTLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    SPIE +APGVI R+SV QPVQTGLK+ID+M+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 VENDGFSPIEVIAPGVIERKSVDQPVQTGLKAIDAMIPIGRGQRELIIGDRQVGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DTIINQKDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEK T G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL + LF
Sbjct: 301 AARVNAEYVEKFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLTSQLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA++ G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAFAQF+SDLDEATRKQ
Sbjct: 361 NSGIRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTALAQYRELAAFAQFSSDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G +VTELMKQ QYSPMSV Q ++ LFAA +G+L DVE++KI DFE+AL  Y  + H 
Sbjct: 421 LDHGVKVTELMKQKQYSPMSVAQQSLVLFAAEKGYLSDVELNKIVDFEAALLSYANTQHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+ +I    DY+D I  +L A +++FK T TW
Sbjct: 481 ELMAEINAKADYNDAIVGKLTALLDDFKATQTW 513


>ATPA_BORPA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  732 bits (1889), Expect = 0.0
 Identities = 375/508 (73%), Positives = 437/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISEL++ RIEG  A T+ RT+GTVVS+TDGI RIHGL+DVM GEM+EFP N +
Sbjct: 1   MQLNPSEISELLKSRIEGLGASTDVRTQGTVVSVTDGITRIHGLSDVMQGEMLEFPNNVF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAV+LG Y  +SEGD+ K TGRILEVPVG  L GRVV+ LG  IDG GP
Sbjct: 61  GVALNLERDSVGAVVLGDYTGVSEGDQVKTTGRILEVPVGPELKGRVVNTLGDAIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T  IEKVAPGVI R+SVSQP+QTG+K+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTQTDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+QKG G+ C+YVAIGQKAS++  VVRKLEEHGA+E+TIVV               Y
Sbjct: 181 DTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTIVVXXXXXXXXXXXXXXXY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLD+ATR+Q
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RV EL+KQ QY P+ V ++AVSL+A N G+LDDV+V +I  FE +L+ ++++ H 
Sbjct: 421 LERGKRVVELLKQPQYQPLQVWELAVSLYAVNNGYLDDVDVAQILAFEKSLKDHLKAKHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            L+ +I  T + S +  AEL AA+++FK
Sbjct: 481 ALIQRIEDTKELSKDDEAELAAAVQDFK 508


>ATPA_BORBR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  732 bits (1889), Expect = 0.0
 Identities = 375/508 (73%), Positives = 437/508 (86%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISEL++ RIEG  A T+ RT+GTVVS+TDGI RIHGL+DVM GEM+EFP N +
Sbjct: 1   MQLNPSEISELLKSRIEGLGASTDVRTQGTVVSVTDGITRIHGLSDVMQGEMLEFPNNVF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAV+LG Y  +SEGD+ K TGRILEVPVG  L GRVV+ LG  IDG GP
Sbjct: 61  GVALNLERDSVGAVVLGDYTGVSEGDQVKTTGRILEVPVGPELKGRVVNTLGDAIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T  IEKVAPGVI R+SVSQP+QTG+K+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTQTDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+QKG G+ C+YVAIGQKAS++  VVRKLEEHGA+E+TIVV               Y
Sbjct: 181 DTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTIVVXXXXXXXXXXXXXXXY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLD+ATR+Q
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RV EL+KQ QY P+ V ++AVSL+A N G+LDDV+V +I  FE +L+ ++++ H 
Sbjct: 421 LERGKRVVELLKQPQYQPLQVWELAVSLYAVNNGYLDDVDVAQILAFEKSLKDHLKAKHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            L+ +I  T + S +  AEL AA+++FK
Sbjct: 481 ALIQRIEDTKELSKDDEAELAAAVQDFK 508


>ATPA_XANOR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1887), Expect = 0.0
 Identities = 373/515 (72%), Positives = 438/515 (85%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+++ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ ++VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEDYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  I+ FKTT TW
Sbjct: 481 QGELVSKINSTGGWDNDIEASFKKGIQEFKTTGTW 515


>ATPA_XANOP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1887), Expect = 0.0
 Identities = 373/515 (72%), Positives = 438/515 (85%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+++ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ ++VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEDYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  I+ FKTT TW
Sbjct: 481 QGELVSKINSTGGWDNDIEASFKKGIQEFKTTGTW 515


>ATPA_XANOM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1887), Expect = 0.0
 Identities = 373/515 (72%), Positives = 438/515 (85%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+++ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ ++VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEDYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  I+ FKTT TW
Sbjct: 481 QGELVSKINSTGGWDNDIEASFKKGIQEFKTTGTW 515


>ATPA_XANC5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1887), Expect = 0.0
 Identities = 374/515 (72%), Positives = 437/515 (84%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+ + EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYESLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  IE FKTT +W
Sbjct: 481 QGELVSKINSTGGWDNDIEASFKKGIEEFKTTGSW 515


>ATPA_XANAC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1887), Expect = 0.0
 Identities = 374/515 (72%), Positives = 437/515 (84%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+ + EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYESLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  IE FKTT +W
Sbjct: 481 QGELVSKINSTGGWDNDIEASFKKGIEEFKTTGSW 515


>ATPA_AERHH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  731 bits (1887), Expect = 0.0
 Identities = 373/513 (72%), Positives = 440/513 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI++RI  F+  +EAR EGT+VS++DGI+RIHGLAD M GEMIE PGN Y
Sbjct: 1   MQLNSTEIAELIKQRIAQFDIKSEARNEGTIVSVSDGIIRIHGLADAMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAVI+G Y  +SEG + K TGRILEVPVG  LLGRV++ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVIMGSYDGLSEGMKVKGTGRILEVPVGRGLLGRVLNTLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI R+SV QPVQTGLK+ID+M+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IDNDGFSPIEVIAPGVIERKSVDQPVQTGLKAIDAMIPIGRGQRELIIGDRQVGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DTIINQKDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEK T G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL + LF
Sbjct: 301 AARVNAEYVEKFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLTSQLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA++ G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAFAQF+SDLD+ATRKQ
Sbjct: 361 NSGIRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTALAQYRELAAFAQFSSDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTELMKQ QYSP+SV   ++ LFAA +G+L DVE++KI DFE+AL  Y  + H 
Sbjct: 421 LDHGQKVTELMKQKQYSPLSVAHQSLVLFAAEKGYLSDVELNKIVDFEAALLSYANTQHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+ +I    DY+D I  +L A +++FK T TW
Sbjct: 481 ELMAEINAKADYNDAIVGKLTALLDDFKATQTW 513


>ATPA_XYLFT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1886), Expect = 0.0
 Identities = 365/515 (70%), Positives = 431/515 (83%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EISELI+ RIE  +   E+R EGTV S++DGIVRI GLAD M GEMIE P  
Sbjct: 1   MATTLNPSEISELIKTRIEQVKLSAESRNEGTVTSVSDGIVRIFGLADAMQGEMIELPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TY LA+NLERDSVGAV+LG Y+H+ EGD AK TGRILEVPVG++LLGRVV+ALG PIDG 
Sbjct: 61  TYALALNLERDSVGAVVLGDYEHLREGDVAKTTGRILEVPVGKSLLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G +    T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GTLGPTQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAM 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID +I+QK TGIKC+YVAIGQK+S++A +VRKLEE+ AL+HTIVV         LQ+I+
Sbjct: 181 AIDTVISQKHTGIKCVYVAIGQKSSTIANIVRKLEENDALDHTIVVAATASESAALQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
            YAGC MGEYF DRGEDALIIYDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 AYAGCTMGEYFMDRGEDALIIYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTQGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDE TR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDETTR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+ MSV   A+S++A +EG+LDD+ V K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYTSMSVANQALSIYAVSEGYLDDIPVHKVLTFEEGLHAHFSNT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            G L+DKI  +GD+ + I A  +  IE FKTT +W
Sbjct: 481 QGALIDKINNSGDWDNNIEAAFKQHIEEFKTTGSW 515


>ATPA_XYLF2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  731 bits (1886), Expect = 0.0
 Identities = 365/515 (70%), Positives = 431/515 (83%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EISELI+ RIE  +   E+R EGTV S++DGIVRI GLAD M GEMIE P  
Sbjct: 1   MATTLNPSEISELIKTRIEQVKLSAESRNEGTVTSVSDGIVRIFGLADAMQGEMIELPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           TY LA+NLERDSVGAV+LG Y+H+ EGD AK TGRILEVPVG++LLGRVV+ALG PIDG 
Sbjct: 61  TYALALNLERDSVGAVVLGDYEHLREGDVAKTTGRILEVPVGKSLLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G +    T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GTLGPTQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAM 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID +I+QK TGIKC+YVAIGQK+S++A +VRKLEE+ AL+HTIVV         LQ+I+
Sbjct: 181 AIDTVISQKHTGIKCVYVAIGQKSSTIANIVRKLEENDALDHTIVVAATASESAALQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
            YAGC MGEYF DRGEDALIIYDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 AYAGCTMGEYFMDRGEDALIIYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTQGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDE TR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDETTR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+ MSV   A+S++A +EG+LDD+ V K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYTSMSVANQALSIYAVSEGYLDDIPVHKVLTFEEGLHAHFSNT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            G L+DKI  +GD+ + I A  +  IE FKTT +W
Sbjct: 481 QGALIDKINNSGDWDNNIEAAFKQHIEEFKTTGSW 515


>ATPA_POLSJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 517

 Score =  730 bits (1885), Expect = 0.0
 Identities = 381/513 (74%), Positives = 434/513 (84%), Gaps = 5/513 (0%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG     + R +GTVVS+TDGIVRIHGL+DVM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLTVSADIRNQGTVVSVTDGIVRIHGLSDVMQGEMLEFPATAD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              TYGLA+NLERDSVG+VILG Y+HI+EGD  KCTGRILEVPVG  LLGRVV+ALG PI
Sbjct: 61  GTPTYGLALNLERDSVGSVILGEYEHIAEGDTVKCTGRILEVPVGPELLGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI R+SV QP+QTGLKSIDSMVPVGRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARKSVDQPLQTGLKSIDSMVPVGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG G+ C+YVAIGQKASS+  VVR LE+ GA+E+TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGKGVSCVYVAIGQKASSIKNVVRSLEQAGAMEYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVN ++VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNEKYVEDFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLIKNLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+S+  MA +LFA N+GF+DDVEV K+  FE  L  ++
Sbjct: 421 ATRKQLDRGARVTELLKQAQYSPLSISNMAATLFAVNKGFMDDVEVKKVLAFEHGLHAWL 480

Query: 478 RSSHGELLDKITKTGDYSDEIAAELRAAIENFK 510
           +  +  L+ K+        +  AEL  A+  FK
Sbjct: 481 KDKNAALMAKLEANKAMDKDAEAELNTAVAAFK 513


>ATPA_XANCP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  729 bits (1883), Expect = 0.0
 Identities = 373/515 (72%), Positives = 438/515 (85%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+++ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LD+V V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDEVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  IE FKTT +W
Sbjct: 481 QGELVSKINTTGGWDNDIEAAFKKGIEEFKTTGSW 515


>ATPA_XANCB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  729 bits (1883), Expect = 0.0
 Identities = 373/515 (72%), Positives = 438/515 (85%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+++ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LD+V V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDEVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  IE FKTT +W
Sbjct: 481 QGELVSKINTTGGWDNDIEAAFKKGIEEFKTTGSW 515


>ATPA_XANC8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  729 bits (1883), Expect = 0.0
 Identities = 373/515 (72%), Positives = 438/515 (85%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EIS+LI+ RIE  +   E+R EG+V S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T+ LA+NLERDSVGAV+LG Y+++ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  TFALALNLERDSVGAVVLGDYENLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+ A  T+P+E+VAPGVI R+SV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+
Sbjct: 121 GPLGATQTAPVERVAPGVIWRKSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTAL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS+VA +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTVANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAGC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LD+V V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDEVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL+ KI  TG + ++I A  +  IE FKTT +W
Sbjct: 481 QGELVSKINTTGGWDNDIEAAFKKGIEEFKTTGSW 515


>ATPA_ACIAC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 519

 Score =  729 bits (1883), Expect = 0.0
 Identities = 383/515 (74%), Positives = 442/515 (85%), Gaps = 7/515 (1%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG  A ++ R +GTVVS+TDGIVRIHGL++VM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVTDGIVRIHGLSEVMQGEMLEFPATKD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              +YGLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GQPSYGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPVGPELVGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI RQSV QP+QTG+KSID+MVPVGRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKLTDVIEKVAPGVIARQSVDQPLQTGIKSIDAMVPVGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAII QKG G+ CIYVAIGQKASS+  VVR LE+ GA+E+TIVV         +Q
Sbjct: 181 TAVAIDAIIAQKGQGVTCIYVAIGQKASSIKNVVRALEQAGAMEYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK++K L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLVKGLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QY+P+ +  M  +LFA N+GF+DDV+V K+  FES L  ++
Sbjct: 421 ATRKQLDRGARVTELLKQPQYTPLPISLMGATLFAVNKGFMDDVDVKKVLAFESGLHQFL 480

Query: 478 RSSHGELLDKITKTGDYSDE--IAAELRAAIENFK 510
           ++SHG LL+++ K   +  E    AEL  AI  FK
Sbjct: 481 KTSHGALLERLEKNRAFDKEGKDEAELTQAITAFK 515


>ATPA_STRM5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 515

 Score =  729 bits (1881), Expect = 0.0
 Identities = 372/515 (72%), Positives = 437/515 (84%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   LN +EISELI+ RIE  +   E+R EGTV S++DGIVRI GLADVM GEMIE P N
Sbjct: 1   MATTLNPSEISELIKNRIEKVKLAAESRNEGTVTSVSDGIVRIFGLADVMQGEMIELPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           ++ LA+NLERDSVGAV+LG Y+H+ EGD AK TGRILEVPVG  LLGRVV+ALG PIDG 
Sbjct: 61  SFALALNLERDSVGAVVLGGYEHLREGDVAKTTGRILEVPVGPELLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GP+    T+P+E+VAPGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+
Sbjct: 121 GPLGTDLTAPVERVAPGVIWRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAM 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AIDA+INQKGTGIKC+YVAIGQKAS++A +VRKLEE+G                 +Q+I+
Sbjct: 181 AIDAVINQKGTGIKCVYVAIGQKASTIANIVRKLEENGXXXXXXXXXXXXXXXXXMQYIS 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
            Y+GC MGEYF DRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLL
Sbjct: 241 AYSGCTMGEYFMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ARV+ E+VEK TEGKV GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETD
Sbjct: 301 ERAARVSEEYVEKFTEGKVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETD 360

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R+ LAQYRELAAFAQFASDLDEATR
Sbjct: 361 LFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRISLAQYRELAAFAQFASDLDEATR 420

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQRVTELMKQ QY+PMS+   A+S++A NEG+LDDV V+K+  FE  L  +  ++
Sbjct: 421 KQLERGQRVTELMKQKQYAPMSIANQALSIYAVNEGYLDDVPVNKLLAFEEGLHAHFANT 480

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            GEL++K+  TG + ++I    +  I  FKTT +W
Sbjct: 481 QGELINKVNATGGWDNDIEGAFKKGIAEFKTTGSW 515


>ATPA1_POLNA RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 517

 Score =  728 bits (1879), Expect = 0.0
 Identities = 378/513 (73%), Positives = 435/513 (84%), Gaps = 5/513 (0%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG  A ++ R +GTVVS+ DGIVRIHGL+DVM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVADGIVRIHGLSDVMQGEMLEFPATAD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              TYGLA+NLERDSVG+VILG Y+HI+EGD  KCTGRILEVP+G  LLGRVV+ALG PI
Sbjct: 61  GTPTYGLALNLERDSVGSVILGEYEHIAEGDTVKCTGRILEVPIGPELLGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ +  IEKVAPGVI R+SV QP+QTGLKSIDSMVP+GRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKLSDVIEKVAPGVIARKSVDQPLQTGLKSIDSMVPIGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG G+ C+YVAIGQKASS+  VVR LE+ GA+++TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGKGVSCVYVAIGQKASSIKNVVRSLEQAGAMDYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVN ++VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNEKYVEDFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLIKNLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+SV  M  +LFA N+GF+DDV+V K+  FES L  ++
Sbjct: 421 ATRKQLDRGARVTELLKQSQYSPLSVSTMGATLFAVNKGFMDDVDVKKVLAFESGLHAWL 480

Query: 478 RSSHGELLDKITKTGDYSDEIAAELRAAIENFK 510
           +  H  L+ K+        +  AEL  A+  FK
Sbjct: 481 KDKHAPLMAKLEANKAMDKDAEAELTTAVTAFK 513


>ATPA_SHEDO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  727 bits (1877), Expect = 0.0
 Identities = 358/513 (69%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+V+++DGI+RI+GLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSEARNEGTIVAVSDGIIRINGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++G Y  ++EG + K TGRILEVPVG  LLGRV++ LG PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGSYAGLAEGVKVKTTGRILEVPVGRGLLGRVLNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    SPIE +APGVI RQSV +PVQTG K++DSM+P+GRGQREL+IGDRQTGKTA+AI
Sbjct: 121 VDNDGYSPIEVIAPGVIERQSVDEPVQTGYKTVDSMIPIGRGQRELVIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKESGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNANYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV   AV ++AA +G+L  V ++K+  FE+AL  +M S + 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVAAQAVVIYAAEKGYLKSVALNKVGHFEAALLSFMNSEYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I  TGDY+ +I  E++AA++ F  T TW
Sbjct: 481 ALMTNINATGDYNADIEGEIKAALDKFVATQTW 513


>ATPA_PSEHT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  727 bits (1876), Expect = 0.0
 Identities = 367/513 (71%), Positives = 440/513 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+VS+TDGI+RIHGLAD M GEMIE PGN Y
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSEARNEGTIVSVTDGIIRIHGLADCMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDS+GAV++GPY  ++EG +   TGRILE            + LG PIDG G 
Sbjct: 61  AIALNLERDSIGAVVMGPYADLTEGVKVYTTGRILEXXXXXXXXXXXXNTLGAPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++     P+EK+APGVI R+SV +PVQTG KSID+M+PVGRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDNDGFEPVEKIAPGVIERKSVDEPVQTGYKSIDAMIPVGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKGTG+KC+YVAIGQKAS++A VVRKLEEHGAL +TI           LQ++AP+
Sbjct: 181 DAIINQKGTGVKCVYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPF 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGE+ALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGENALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T G+VKG TGSLTALPIIETQ GDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTNGEVKGTTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+NAG+SVSRVGGAAQTKI+KKLGGG+RL LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGIRPAVNAGISVSRVGGAAQTKIVKKLGGGIRLALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV +M++SLFAA +GFL D+E+ KI DFE+AL  Y  S++ 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVAEMSLSLFAAEKGFLQDIEIAKIMDFEAALLSYANSTYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+ +I +TG+Y+ EI A+L+  +  FK+T TW
Sbjct: 481 ELVAQINETGNYNAEIEAQLKELLTKFKSTQTW 513


>ATPA_BORPE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  727 bits (1876), Expect = 0.0
 Identities = 373/508 (73%), Positives = 435/508 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN +EISEL++ RIEG  A T+ RT+GTVVS+TDGI RIHGL+DVM GEM+EFP N +
Sbjct: 1   MQLNPSEISELLKSRIEGLGASTDVRTQGTVVSVTDGITRIHGLSDVMQGEMLEFPNNVF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLERDSVGAV+LG Y  +SEGD+ K TGRILEVPVG  L GRVV+ LG  IDG GP
Sbjct: 61  GVALNLERDSVGAVVLGDYTGVSEGDQVKTTGRILEVPVGPELKGRVVNTLGDAIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T  IEKVAPGVI R+SVSQP+QTG+K+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INTTQTDIIEKVAPGVIARRSVSQPLQTGIKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+QKG G+ C+YVAIGQKAS++  VVRKLEEHGA+E+TIVV                
Sbjct: 181 DTIISQKGKGVTCVYVAIGQKASTINNVVRKLEEHGAMEYTIVVXXXXXXXXXXXXXXXX 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            GC MGEYFRDRGEDALI+YDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 XGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNEEYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAINAG+SVSRVGGAAQTK+IKKL GG+R DLAQYRELAAFAQFASDLD+ATR+Q
Sbjct: 361 NAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQYRELAAFAQFASDLDDATRRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERG+RV EL+KQ QY P+ V ++AVSL+A N G+LDDV+V +I  FE +L+ ++++ H 
Sbjct: 421 LERGKRVVELLKQPQYQPLQVWELAVSLYAVNNGYLDDVDVAQILAFEKSLKDHLKAKHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            L+ +I  T + S +  AEL AA+++FK
Sbjct: 481 ALIQRIEDTKELSKDDEAELAAAVQDFK 508


>ATPA_METPP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 517

 Score =  726 bits (1875), Expect = 0.0
 Identities = 381/513 (74%), Positives = 438/513 (85%), Gaps = 5/513 (0%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG  A ++ R +GTVVS+TDGIVR+HGL++VM GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLGASSDIRNQGTVVSVTDGIVRVHGLSEVMAGEMLEFPATKD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              T+GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GQPTFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPVGPELIGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI R+SV QPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARKSVDQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG  + C+YVAIGQKASS+  VVR LE  GA+ +TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQNMTCVYVAIGQKASSIKNVVRSLEAAGAMSYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALIIYDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VEK T G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEKFTNGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET+LFNAGIRPAINAG+SVSRVGGAAQTK++K L GG+R DLAQYRELAAFAQFASDLD+
Sbjct: 361 ETNLFNAGIRPAINAGISVSRVGGAAQTKLVKGLSGGIRTDLAQYRELAAFAQFASDLDD 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QY P+ +  MA +L++ N+GFLDDV+V K+  FES L  ++
Sbjct: 421 ATRKQLDRGARVTELLKQQQYQPLPISLMAATLYSVNKGFLDDVDVKKVLAFESGLHQFL 480

Query: 478 RSSHGELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++S+  LL K+  +     +  AEL AAI  FK
Sbjct: 481 KTSYAALLKKLEDSKALDKDSEAELAAAIGAFK 513


>ATPA2_PSEA6 RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 513

 Score =  725 bits (1872), Expect = 0.0
 Identities = 368/513 (71%), Positives = 431/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI++RIE FE  +EAR EGT+V +TDGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEIAELIKQRIEQFEVVSEARNEGTIVGVTDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  + EG +   +GRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLQEGAKVTSSGRIXXXXXXXXXXXXXXXXXXAPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA    P+EK+APGVI RQSV QP+QTG KS+D+M+PVGRGQREL+IGDRQTGKTA+AI
Sbjct: 121 IEADGFEPVEKIAPGVIERQSVDQPIQTGYKSVDAMIPVGRGQRELVIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +G+KC+YVA+GQKAS++A VVRKLEEHGA+ HTIVV         LQ++APY
Sbjct: 181 DAIINQKDSGVKCVYVAVGQKASTIANVVRKLEEHGAMAHTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN  +VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARVNENYVENFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+NAG+SVSRVGGAAQTKI+KKLGGG+RL LAQYRELAAF+QFASDLDEATR Q
Sbjct: 361 NSGIRPAVNAGISVSRVGGAAQTKIVKKLGGGIRLALAQYRELAAFSQFASDLDEATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RV ELMKQ QY+P+SV  M+VSLFA  +G+L DVE+DKI DFE+AL  YM S + 
Sbjct: 421 LEHGERVMELMKQNQYAPLSVADMSVSLFAVEKGYLKDVELDKILDFEAALHSYMNSEYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+  I  TG+++ EI A L  A+E FK T TW
Sbjct: 481 ELIKTINDTGNFNGEIEATLAEALEKFKATQTW 513


>ATPA_HAEDU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  724 bits (1868), Expect = 0.0
 Identities = 367/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F   +EA++ GT+VS++DGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFNVVSEAQSTGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   KCTGRILEVPVG+ LLGRVV+ LG PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMTVKCTGRILEVPVGKGLLGRVVNTLGQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI RQSV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKT++ I
Sbjct: 121 IDNDGFSPVEVIAPGVIDRQSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTSLVI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAII Q+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIIAQRDSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE+ T G V G+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVERFTNGAVTGRTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQTK+IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTKVIKKLSGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ Q++PM V + A+ LFAA  G+LD VE+++I  FESAL  Y  S+H 
Sbjct: 421 LSHGQKVTELLKQKQFAPMPVSEQALVLFAAEFGYLDGVELERISSFESALLAYANSNHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + +  + K+G+++D I  EL+  +ENFK    W
Sbjct: 481 DFMKDLAKSGNFNDSIQQELKTIVENFKKNGAW 513


>ATPA2_PSYIN RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 513

 Score =  721 bits (1862), Expect = 0.0
 Identities = 359/513 (69%), Positives = 431/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RI  FEA +EAR EGT+VS++DGIVRI+GLA+ M GEMIE P   +
Sbjct: 1   MQLNSTEISDLIKQRIGKFEAVSEARNEGTIVSVSDGIVRINGLAECMQGEMIELPNGGF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GP++ + EG + K TGRILEVPVG+ LLGRVV+ LG PIDG GP
Sbjct: 61  AMALNLERDSVGAVVMGPFRDLREGQKVKSTGRILEVPVGKGLLGRVVNTLGAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SPIE +APGVI R+SV QPVQTG KSIDSMVP+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IENDGYSPIEVIAPGVIDRKSVDQPVQTGWKSIDSMVPIGRGQRELIIGDRQVGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK TG+  IYVAIGQKAS++A VV KLEEHGALE+TIVV         LQ++APY
Sbjct: 181 DAIINQKHTGLFSIYVAIGQKASTIANVVNKLEEHGALENTIVVVASASETAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+A +VE  T+G VKGKTGSLTALPIIETQ GDVSAF+PTNVISITDGQIFL T+LF
Sbjct: 301 ASRVSAAYVEAFTKGAVKGKTGSLTALPIIETQGGDVSAFVPTNVISITDGQIFLTTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA++ G+SVSRVGG+AQ K+IKKL GG+R  LAQYRELAAFAQFASDLDE TRKQ
Sbjct: 361 NSGIRPAVDPGISVSRVGGSAQCKVIKKLAGGIRTALAQYRELAAFAQFASDLDETTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G++VTELMKQ QY+PMSV + A+SLF+A +G+L DV+V+K+ DFES+L  Y ++ H 
Sbjct: 421 LDHGKKVTELMKQKQYAPMSVAEQALSLFSAEKGYLTDVDVEKVLDFESSLISYAKTEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E   ++ +TGDYS EI  +  A +E FK T TW
Sbjct: 481 EFYAQLNETGDYSKEIEGQFHAILETFKATQTW 513


>ATPA1_PHOPR RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 513

 Score =  721 bits (1861), Expect = 0.0
 Identities = 368/513 (71%), Positives = 441/513 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS LI++RIE F   +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  +
Sbjct: 1   MQLNSTEISALIKQRIEKFNVASEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY ++ EG +   TGRILEVPVG ALLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYANLQEGMKVTGTGRILEVPVGPALLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE +  SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IETETFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  +YVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQKQSGIYSVYVAIGQKASTIANVVRKLEEHGALDNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+  +VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 ASRVSENYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA++ G+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQF+SDLDEAT+KQ
Sbjct: 361 NAGIRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFSSDLDEATKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTELMKQ QY+PMSV + AV +F+A  G+L DVE+ K+ DFE+AL  Y +    
Sbjct: 421 LDHGQKVTELMKQKQYAPMSVFEQAVVIFSAERGYLVDVELAKLADFEAALLSYAKGQSA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+ +I +TG ++ EI A+    +E+FK T TW
Sbjct: 481 ELVSQIDETGAWNSEIEAQFVKLVEDFKATQTW 513


>ATPA_VIBVY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 523

 Score =  718 bits (1853), Expect = 0.0
 Identities = 367/513 (71%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  Y
Sbjct: 11  MQLNSTEISDLIKQRIESFNVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGRY 70

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 71  ALALNLERDSVGAVVMGPYADLKEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 130

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI RQSV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 131 IEAKLTSPVEVIAPGVIDRQSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAMAI 190

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 191 DAIINQKNSGIFSIYVAIGQKASTIANVVRKLEEHGALKNTIXXXXXXXXXXXLQYLAPY 250

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 251 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 310

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 311 AARVNAEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 370

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R             QF+SDLDEAT++Q
Sbjct: 371 NAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTXXXXXXXXXXXXQFSSDLDEATKRQ 430

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTELMKQ QY+PMSV   A+++FAA  G+L D+E+ K+ DFE+AL  Y R  + 
Sbjct: 431 LNHGQKVTELMKQKQYAPMSVFDQALTIFAAERGYLSDIELSKVLDFEAALLSYARGQYA 490

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL  +I KTG Y+DEI A+L+   ++FK T TW
Sbjct: 491 ELAAEIDKTGAYNDEIEAQLKKLTDDFKATQTW 523


>ATPA_VIBVU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  718 bits (1853), Expect = 0.0
 Identities = 367/513 (71%), Positives = 434/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  Y
Sbjct: 1   MQLNSTEISDLIKQRIESFNVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYADLKEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI RQSV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IEAKLTSPVEVIAPGVIDRQSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQKNSGIFSIYVAIGQKASTIANVVRKLEEHGALKNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVNAEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R             QF+SDLDEAT++Q
Sbjct: 361 NAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTXXXXXXXXXXXXQFSSDLDEATKRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTELMKQ QY+PMSV   A+++FAA  G+L D+E+ K+ DFE+AL  Y R  + 
Sbjct: 421 LNHGQKVTELMKQKQYAPMSVFDQALTIFAAERGYLSDIELSKVLDFEAALLSYARGQYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL  +I KTG Y+DEI A+L+   ++FK T TW
Sbjct: 481 ELAAEIDKTGAYNDEIEAQLKKLTDDFKATQTW 513


>ATPA_VIBPA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 523

 Score =  717 bits (1852), Expect = 0.0
 Identities = 367/513 (71%), Positives = 435/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  Y
Sbjct: 11  MQLNSTEISDLIKQRIESFEVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGRY 70

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 71  ALALNLERDSVGAVVMGPYADLKEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 130

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQREL+IGDRQTGKTA+AI
Sbjct: 131 IEAKLTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELVIGDRQTGKTAMAI 190

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 191 DAIINQKNSGIFSIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 250

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 251 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 310

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 311 AARVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 370

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R             QF+SDLDEAT+KQ
Sbjct: 371 NAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTXXXXXXXXXXXXQFSSDLDEATKKQ 430

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTELMKQ QY+PMSV   A+ +FAA  G+LDDVE++K+ DFE+AL  Y R  + 
Sbjct: 431 LDHGQKVTELMKQKQYAPMSVFDQALVIFAAERGYLDDVELNKVLDFEAALLSYARGQYA 490

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL  +I K+G Y+DEI A+L+   ++FK T TW
Sbjct: 491 ELAAEIDKSGAYNDEIEAQLKKLTDDFKATQTW 523


>ATPA_VIBAL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  717 bits (1852), Expect = 0.0
 Identities = 367/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  Y
Sbjct: 1   MQLNSTEISDLIKQRIESFEVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYADLKEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IEAKMTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQIGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQKDSGIFSIYVAIGQKASTIANVVRKLEEHGALQNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R             QF+SDLDEAT+KQ
Sbjct: 361 NAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTXXXXXXXXXXXXQFSSDLDEATKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTELMKQ QY+PMSV   A+++FAA  G+LDDVE++K+ DFE+AL  Y R  + 
Sbjct: 421 LDHGQKVTELMKQKQYAPMSVFDQALTIFAAERGYLDDVELNKVLDFEAALLSYARGQYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL  +I K+G Y+DEI A+L+   ++FK T TW
Sbjct: 481 ELAAEIDKSGAYNDEIEAQLKKLTDDFKATQTW 513


>ATPA_PSYA2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  717 bits (1851), Expect = 0.0
 Identities = 356/512 (69%), Positives = 425/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN AEIS LI++RI+  +A   A+ EGT+V ++DGIV+IHGL D M+GEMIEF G  YG
Sbjct: 3   QLNPAEISNLIKQRIQDLDAGATAKNEGTIVKVSDGIVQIHGLEDAMYGEMIEFEGEVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAV+LG +  + EG +A CTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLERDSVGAVVLGDFLKLQEGQKAYCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            A+ T  +EK+APGVI RQSV QPV TG KS+D+M+P+GRGQRELIIGDRQTGKTA+AID
Sbjct: 123 NAKMTDKVEKIAPGVIDRQSVDQPVMTGYKSVDTMIPIGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLE+ GALE+T VV         LQ+IAPY+
Sbjct: 183 AIIAQKASGIKCVYVAIGQKRSTIANVVRKLEQTGALEYTTVVVASASEPAALQYIAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI++DDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVFDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RVNA +VEK T G+V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LFN
Sbjct: 303 SRVNAAYVEKFTNGEVVGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLD+ATR+QL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDDATREQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           + G+RVTELMKQ QY PMS+ + A  ++A+NEGFL DV V+KI  FE A   YM     +
Sbjct: 423 DHGERVTELMKQKQYQPMSISEQAAVIYASNEGFLADVPVEKIGSFEEAYLRYMHDEQAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I  T +Y+D+IA  L+ ++E FK  +++
Sbjct: 483 LMKEIDDTANYNDDIAGRLKLSLETFKQNHSY 514


>ATPA_PSYCK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  716 bits (1849), Expect = 0.0
 Identities = 355/512 (69%), Positives = 425/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN AEIS LI++RI+  +A   A+ EGT+V ++DGIV+IHGL D M+GEMIEF G  YG
Sbjct: 3   QLNPAEISNLIKQRIQDLDAGATAKNEGTIVKVSDGIVQIHGLEDAMYGEMIEFEGEVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLERDSVGAV+LG +  + EG +A CTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLERDSVGAVVLGDFLKLQEGQKAYCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            A+ T  +EK+APGVI RQSV QPV TG KS+D+M+P+GRGQRELIIGDRQTGKTA+AID
Sbjct: 123 NAKMTDKVEKIAPGVIDRQSVDQPVMTGYKSVDTMIPIGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLE+ GALE+T VV         LQ+IAPY+
Sbjct: 183 AIIAQKSSGIKCVYVAIGQKRSTIANVVRKLEQTGALEYTTVVVASASEPAALQYIAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI++DDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVFDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RVNA +VEK T G+V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LFN
Sbjct: 303 SRVNAAYVEKFTNGEVVGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLD+ TR+QL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDDVTREQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           + G+RVTELMKQ QY PMS+ + A  ++A+NEGFL DV V+KI  FE A   YM     +
Sbjct: 423 DHGERVTELMKQKQYQPMSISEQAAVIYASNEGFLADVPVEKIGSFEEAYLRYMHDEQAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I  T +Y+D+IA  L++++E FK  +++
Sbjct: 483 LMKEIDDTANYNDDIAGRLKSSLETFKQNHSY 514


>ATPA_VIBCH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  716 bits (1847), Expect = 0.0
 Identities = 366/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   +EAR EGT+VS++DGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISDLIKQRIESFNVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYADLREGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IGAKQTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQKNSGIYSIYVAIGQKASTIANVVRKLEEHGALKNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVNEEYVERFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGGAAQTKI+KKL GG+R             QF+SDLDEAT++Q
Sbjct: 361 NAGVRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTXXXXXXXXXXXXQFSSDLDEATKRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTELMKQ QY+PMSV   A+ +FAA  G+L DVE++K+ DFE+AL  Y R+ + 
Sbjct: 421 LTHGQKVTELMKQKQYAPMSVFDQALVIFAAERGYLTDVELNKVLDFEAALLSYARAHYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL  +I KTG Y+DEI A+L+  +++FK T TW
Sbjct: 481 ELAAQIDKTGAYNDEIEAQLKKLVDDFKATQTW 513


>ATPA_VIBC3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  716 bits (1847), Expect = 0.0
 Identities = 366/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   +EAR EGT+VS++DGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISDLIKQRIESFNVVSEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYADLREGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IGAKQTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQKNSGIYSIYVAIGQKASTIANVVRKLEEHGALKNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVNEEYVERFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA++ G+SVSRVGGAAQTKI+KKL GG+R             QF+SDLDEAT++Q
Sbjct: 361 NAGVRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTXXXXXXXXXXXXQFSSDLDEATKRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTELMKQ QY+PMSV   A+ +FAA  G+L DVE++K+ DFE+AL  Y R+ + 
Sbjct: 421 LTHGQKVTELMKQKQYAPMSVFDQALVIFAAERGYLTDVELNKVLDFEAALLSYARAHYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL  +I KTG Y+DEI A+L+  +++FK T TW
Sbjct: 481 ELAAQIDKTGAYNDEIEAQLKKLVDDFKATQTW 513


>ATPA_ALISL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  716 bits (1847), Expect = 0.0
 Identities = 366/513 (71%), Positives = 436/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   +EAR EGT+VS++DGI+RIHGLADVM GEMIE PG  Y
Sbjct: 1   MQLNSTEISDLIKQRIEKFNVASEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGGHY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLERDSVGAV++GPY  + EG +   TGRILEVPVG  +LGRVV+ LG PIDG GP
Sbjct: 61  ALALNLERDSVGAVVMGPYADLQEGMKVTGTGRILEVPVGPEMLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A+ TSP+E +APGVI R+SV QP+QTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDAKLTSPVEVIAPGVIDRKSVDQPLQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKNSGIFAIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+  +VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVSVAYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AG+RPA++ G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQF+SDLDEAT+KQ
Sbjct: 361 TAGVRPAVDPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFSSDLDEATKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G++VTELMKQ QY+PMSV   A+ +F A +G+L+DVE+ K+ DFE AL  Y R    
Sbjct: 421 LDHGEKVTELMKQKQYAPMSVFDQALVIFTAEKGYLNDVELKKLADFEEALLSYARGQFA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L  +I  +G ++ EI  +    +E+FK T TW
Sbjct: 481 DLAKEIDSSGAWNKEIEDQFVKLVEDFKATQTW 513


>ATPA1_RHOFD RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 517

 Score =  715 bits (1846), Expect = 0.0
 Identities = 366/479 (76%), Positives = 410/479 (85%), Gaps = 5/479 (1%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG  A    R +GTVVS+TDGIVRIHGL+DVM GEM+EFP +  
Sbjct: 1   MQLNPAEISELIKSRIEGLTAGANIRNQGTVVSVTDGIVRIHGLSDVMQGEMLEFPADAE 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              +YGLA+NLERDSVGAVILG Y+HISEG+  KCTGRILEVPVG  L GRVV+ALG PI
Sbjct: 61  GQPSYGLALNLERDSVGAVILGAYEHISEGNTVKCTGRILEVPVGPELKGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI+A+ T  IEKVAPGVI RQSVSQP+QTGLKSIDSMVPVGRGQRELIIGDRQTGK
Sbjct: 121 DGKGPIDAKMTDVIEKVAPGVIARQSVSQPMQTGLKSIDSMVPVGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG  + C+YVAIGQKASSV  VVR LE+ GA+E+TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQNMTCVYVAIGQKASSVKNVVRSLEQAGAMEYTIVVAATASESAAMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           ++A Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVAAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVN ++VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNEKYVEDFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVGGAAQTK+IK L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGGAAQTKLIKNLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGY 476
           ATRKQLERG RVTEL+KQ QYSP+ +  M  +LFA N+G+LDD+ V+K+  FE  L GY
Sbjct: 421 ATRKQLERGARVTELLKQAQYSPLPISLMGATLFAVNKGYLDDIAVNKLLSFEHGLHGY 479


>ATPA_PHOLL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  714 bits (1844), Expect = 0.0
 Identities = 351/513 (68%), Positives = 424/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS+ DGI+RIHGLA+VM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVNDGIIRIHGLAEVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+AI
Sbjct: 121 VEHDGFSAVEMIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIVKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++SLF+A  G+L+D+E+ K+ DFESAL  Y    H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLSLFSAERGYLEDIEIAKVIDFESALLAYANREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +LL +I ++G Y++EI A+L+A +++FK T +W
Sbjct: 481 DLLKEIDQSGGYNEEIEAKLKALLDSFKATQSW 513


>ATPA_ACIBY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1841), Expect = 0.0
 Identities = 369/512 (72%), Positives = 430/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS LI++RI   +    A+ EGT+V ++DGIVRIHGLAD M+GEMIEF G  +G
Sbjct: 3   QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A+CTGR+LEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+ T  +EKVAPGVI RQSV QPVQTG KS+D+M+PVGRGQRELIIGDRQTGKTA+AID
Sbjct: 123 DAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE G                       Y+
Sbjct: 183 AIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGXXXXXXXXXXXXXXXXXXXXXXXYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+AE+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 303 SRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+P S+   AVS++A+NEG++ DVEV KI DF++AL  Y RS +  
Sbjct: 423 EHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAP 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I +TGDY+ +I A ++A IE+FK T T+
Sbjct: 483 LMKQIDETGDYNKDIEAAIKAGIESFKATQTY 514


>ATPA_ACIBT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1841), Expect = 0.0
 Identities = 369/512 (72%), Positives = 430/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS LI++RI   +    A+ EGT+V ++DGIVRIHGLAD M+GEMIEF G  +G
Sbjct: 3   QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A+CTGR+LEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+ T  +EKVAPGVI RQSV QPVQTG KS+D+M+PVGRGQRELIIGDRQTGKTA+AID
Sbjct: 123 DAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE G                       Y+
Sbjct: 183 AIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGXXXXXXXXXXXXXXXXXXXXXXXYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+AE+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 303 SRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+P S+   AVS++A+NEG++ DVEV KI DF++AL  Y RS +  
Sbjct: 423 EHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAP 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I +TGDY+ +I A ++A IE+FK T T+
Sbjct: 483 LMKQIDETGDYNKDIEAAIKAGIESFKATQTY 514


>ATPA_ACIBC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1841), Expect = 0.0
 Identities = 369/512 (72%), Positives = 430/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS LI++RI   +    A+ EGT+V ++DGIVRIHGLAD M+GEMIEF G  +G
Sbjct: 3   QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A+CTGR+LEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+ T  +EKVAPGVI RQSV QPVQTG KS+D+M+PVGRGQRELIIGDRQTGKTA+AID
Sbjct: 123 DAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE G                       Y+
Sbjct: 183 AIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGXXXXXXXXXXXXXXXXXXXXXXXYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+AE+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 303 SRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+P S+   AVS++A+NEG++ DVEV KI DF++AL  Y RS +  
Sbjct: 423 EHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAP 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I +TGDY+ +I A ++A IE+FK T T+
Sbjct: 483 LMKQIDETGDYNKDIEAAIKAGIESFKATQTY 514


>ATPA_ACIB5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1841), Expect = 0.0
 Identities = 369/512 (72%), Positives = 430/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS LI++RI   +    A+ EGT+V ++DGIVRIHGLAD M+GEMIEF G  +G
Sbjct: 3   QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A+CTGR+LEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+ T  +EKVAPGVI RQSV QPVQTG KS+D+M+PVGRGQRELIIGDRQTGKTA+AID
Sbjct: 123 DAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE G                       Y+
Sbjct: 183 AIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGXXXXXXXXXXXXXXXXXXXXXXXYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+AE+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 303 SRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+P S+   AVS++A+NEG++ DVEV KI DF++AL  Y RS +  
Sbjct: 423 EHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAP 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I +TGDY+ +I A ++A IE+FK T T+
Sbjct: 483 LMKQIDETGDYNKDIEAAIKAGIESFKATQTY 514


>ATPA_ACIB3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1841), Expect = 0.0
 Identities = 369/512 (72%), Positives = 430/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS LI++RI   +    A+ EGT+V ++DGIVRIHGLAD M+GEMIEF G  +G
Sbjct: 3   QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A+CTGR+LEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+ T  +EKVAPGVI RQSV QPVQTG KS+D+M+PVGRGQRELIIGDRQTGKTA+AID
Sbjct: 123 DAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE G                       Y+
Sbjct: 183 AIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGXXXXXXXXXXXXXXXXXXXXXXXYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+AE+VEK T G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 303 SRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 363 AGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+P S+   AVS++A+NEG++ DVEV KI DF++AL  Y RS +  
Sbjct: 423 EHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALIAYFRSEYAP 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I +TGDY+ +I A ++A IE+FK T T+
Sbjct: 483 LMKQIDETGDYNKDIEAAIKAGIESFKATQTY 514


>ATPA_SHEWM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  713 bits (1840), Expect = 0.0
 Identities = 350/513 (68%), Positives = 427/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSEARNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EGD+ K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYASLAEGDKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IDNDGFSPVEMIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQIGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK TGIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKDTGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTKGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRSALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV   +VS+F+A +G+L  VE++KI DFE++L  YM S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVADQSVSIFSAEKGYLKSVELNKIGDFEASLLSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+  I +TG+Y+ +I  EL+A ++ F  T TW
Sbjct: 481 DLMKTINETGNYNADIEGELKAGLDKFVETQTW 513


>ATPA_ENTS8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  713 bits (1840), Expect = 0.0
 Identities = 355/513 (69%), Positives = 419/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    SPIE +APGVI RQSV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VEHDGFSPIEVIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTIANVVRKLEEHGALSNTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 ASRVNAEYVENFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q  + LFAA  G+L+DVE+ KI  FE+AL  Y    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQGLVLFAAERGYLEDVELAKIGSFEAALLAYADRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L++ +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKSLLDSFKATQSW 513


>ATPA_ACIF5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1840), Expect = 0.0
 Identities = 355/512 (69%), Positives = 426/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISELIR RI GFE   E R++GT++SL+DGI+RIHGL DVM+GEM+E PG  +G
Sbjct: 3   QLNPSEISELIRARIAGFEGRVETRSQGTIISLSDGILRIHGLEDVMYGEMLELPGGRFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           LAMNLE+D+VGAV+LG +  + EGD  KCTGR+++VP+G+ALLGRVV+ALG P+DG G I
Sbjct: 63  LAMNLEQDNVGAVVLGEFSGLQEGDVVKCTGRVMQVPIGKALLGRVVNALGQPVDGKGAI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+    +EK+APGVI RQSV +P+QTG+KSID+MVP+GRGQRELIIGDRQTGKTAVA+D
Sbjct: 123 DAEEFDVLEKIAPGVIDRQSVDEPMQTGIKSIDAMVPIGRGQRELIIGDRQTGKTAVAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AI+NQKG  ++CIYVAIGQKAS+VAGVVRKLEE+GA+E+T V+         +Q++APYA
Sbjct: 183 AILNQKGKDVQCIYVAIGQKASTVAGVVRKLEEYGAMEYTTVIAANASESAAMQYLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRG +ALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGMNALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           ARVNA+ VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQI+LETDLFN
Sbjct: 303 ARVNADFVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPAINAGLSVSRVGGAAQTKIIKKLGGG+RLDLAQYRELAAFAQFASDLDE TRKQ+
Sbjct: 363 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGIRLDLAQYRELAAFAQFASDLDEITRKQI 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           ERG+RVTEL+KQ Q+SPMSV +               VEV  ++ FE AL  Y+ S++ E
Sbjct: 423 ERGKRVTELLKQDQFSPMSVAEQXXXXXXXXXXXXXXVEVANVRPFEKALLAYLNSNNKE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+  I +             AA++ FK+ +T+
Sbjct: 483 LMAGIEEXXXXXXXXXXXXXAAVKQFKSGSTY 514


>ATPA_ACIF2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  713 bits (1840), Expect = 0.0
 Identities = 355/512 (69%), Positives = 426/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISELIR RI GFE   E R++GT++SL+DGI+RIHGL DVM+GEM+E PG  +G
Sbjct: 3   QLNPSEISELIRARIAGFEGRVETRSQGTIISLSDGILRIHGLEDVMYGEMLELPGGRFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           LAMNLE+D+VGAV+LG +  + EGD  KCTGR+++VP+G+ALLGRVV+ALG P+DG G I
Sbjct: 63  LAMNLEQDNVGAVVLGEFSGLQEGDVVKCTGRVMQVPIGKALLGRVVNALGQPVDGKGAI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+    +EK+APGVI RQSV +P+QTG+KSID+MVP+GRGQRELIIGDRQTGKTAVA+D
Sbjct: 123 DAEEFDVLEKIAPGVIDRQSVDEPMQTGIKSIDAMVPIGRGQRELIIGDRQTGKTAVAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AI+NQKG  ++CIYVAIGQKAS+VAGVVRKLEE+GA+E+T V+         +Q++APYA
Sbjct: 183 AILNQKGKDVQCIYVAIGQKASTVAGVVRKLEEYGAMEYTTVIAANASESAAMQYLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRG +ALI+YDDLTKQAWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGMNALIVYDDLTKQAWAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           ARVNA+ VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQI+LETDLFN
Sbjct: 303 ARVNADFVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPAINAGLSVSRVGGAAQTKIIKKLGGG+RLDLAQYRELAAFAQFASDLDE TRKQ+
Sbjct: 363 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGIRLDLAQYRELAAFAQFASDLDEITRKQI 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           ERG+RVTEL+KQ Q+SPMSV +               VEV  ++ FE AL  Y+ S++ E
Sbjct: 423 ERGKRVTELLKQDQFSPMSVAEQXXXXXXXXXXXXXXVEVANVRPFEKALLAYLNSNNKE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+  I +             AA++ FK+ +T+
Sbjct: 483 LMAGIEEXXXXXXXXXXXXXAAVKQFKSGSTY 514


>ATPA_SHEPW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  712 bits (1839), Expect = 0.0
 Identities = 349/513 (68%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSEARNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EGD+ K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYATLAEGDKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I++   SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IDSDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQIGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           S+RVNAE+VEK T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 SSRVNAEYVEKFTKGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMS+   +VS+FAA +G+L  VE++KI DFE++L  +M S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSIADQSVSIFAAEKGYLKSVELNKIGDFEASLLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+  I +TG+Y+ +I  EL+A+++ F  T TW
Sbjct: 481 DLMKTINETGNYNADIEGELKASLDKFVETQTW 513


>ATPA2_VIBHB RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 512

 Score =  712 bits (1839), Expect = 0.0
 Identities = 361/507 (71%), Positives = 436/507 (85%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELIR+RI  F  ++EAR EGT+VS++DGI+ IHGLADVM GEM+E P N +
Sbjct: 1   MQLNSNEISELIRERIVNFNLESEARNEGTIVSVSDGIITIHGLADVMQGEMLELPNNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLER SVGAV++GPY  +SEG + K TGRILEVPVG  LLGRVV+ LG PIDG G 
Sbjct: 61  ALALNLERHSVGAVVMGPYADLSEGMKVKGTGRILEVPVGNGLLGRVVNTLGQPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +      P+E +APGVI R+SV QP+QTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VSFDRMDPVEVIAPGVIDRKSVDQPIQTGYKAVDSMVPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK  G+KCIYVAIGQKAS++A VVRKLEEHGALE+TI           LQ++APY
Sbjct: 181 DAIINQKELGVKCIYVAIGQKASTIANVVRKLEEHGALENTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T LF
Sbjct: 301 AARVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTQLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA++ G+SVSRVGGAAQTK+IKKL GG+R  LAQYRELAAFAQF+SDLDEATR+Q
Sbjct: 361 NSGLRPAVDPGISVSRVGGAAQTKVIKKLSGGIRTALAQYRELAAFAQFSSDLDEATRRQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G++VTELMKQ QY+PM+V + A+++FAA +G+L DV +++I  FE  L  + R++  
Sbjct: 421 LDHGEKVTELMKQKQYAPMTVAEQALAIFAAEKGYLTDVALNQISRFEEELMAFGRTNAQ 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENF 509
            LLDKI ++GDY+DEI +EL + ++ F
Sbjct: 481 PLLDKINQSGDYNDEIESELHSLLKEF 507


>ATPA_DICNV RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  712 bits (1837), Expect = 0.0
 Identities = 366/507 (72%), Positives = 429/507 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLNA+EIS  I+ +I  ++   E + EGT+V+++DGIV+I GL+  M GEMIE P   +
Sbjct: 1   MQLNASEISSFIKDKIADYDNKVENKAEGTIVNVSDGIVQIQGLSQAMLGEMIELPNGNF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LAMNLERDSVGAV+LG Y+H+ EGD+  CTGRI                   PIDG G 
Sbjct: 61  ALAMNLERDSVGAVVLGAYEHLREGDKVHCTGRIXXXXXXXXXXXXXXXXXXNPIDGKGK 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A+ +SP+EK+APGVI RQSV QP+QTGLK+IDSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDAEGSSPVEKIAPGVIERQSVDQPLQTGLKAIDSMVPLGRGQRELIIGDRQTGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK TG+ CIYVAIGQKASS+A VVRKLEE  AL+HTIVV         +Q+IAPY
Sbjct: 181 DAIINQKNTGVICIYVAIGQKASSIASVVRKLEEADALKHTIVVXXXXXXXXXMQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGE+FRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEFFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +AR+NA+ VE+LT GKVKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 AARINAKEVERLTAGKVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAINAGLSVSRVGGAAQT+IIKKLGGG+RL LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NSGIRPAINAGLSVSRVGGAAQTQIIKKLGGGIRLALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE GQRVTELMKQ QY+P+SV +MA+SLFAA++G+LD V V+ I  +E+AL  +MR +H 
Sbjct: 421 LEHGQRVTELMKQKQYAPLSVAEMAISLFAADKGYLDTVAVEDIMAYETALLSFMRENHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENF 509
           +L++ I  TG Y + +   L+ A++ F
Sbjct: 481 DLMNTINTTGKYDEAVQTGLKEALDAF 507


>ATPA_VIBFM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  711 bits (1836), Expect = 0.0
 Identities = 365/513 (71%), Positives = 435/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   TEAR EGT+VS++DGI+ IHGLADVM GEMIE PG  Y
Sbjct: 1   MQLNSTEISDLIKQRIEKFNVVTEARNEGTIVSVSDGIINIHGLADVMQGEMIELPGGRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NL RDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLNRDSVGAVVMGPYADLQEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IEAKLTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKDSGIFSIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+  +VE+ T G+V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVSEAYVERFTNGEVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQF+SDLD+AT+KQ
Sbjct: 361 TAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFSSDLDDATKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G++VTELMKQ QY+PMSV   A+ +FAA +G+L DVE+ K+ DFE AL  Y R    
Sbjct: 421 LDHGEKVTELMKQKQYAPMSVFDQALVIFAAEKGYLKDVELAKLADFEEALLSYARGQFA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L  +I  +G +++EI A+    +E+FK T TW
Sbjct: 481 DLAKEIDTSGAWNNEIEAQFVKLVEDFKATQTW 513


>ATPA_VIBF1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  711 bits (1836), Expect = 0.0
 Identities = 365/513 (71%), Positives = 435/513 (84%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   TEAR EGT+VS++DGI+ IHGLADVM GEMIE PG  Y
Sbjct: 1   MQLNSTEISDLIKQRIEKFNVVTEARNEGTIVSVSDGIINIHGLADVMQGEMIELPGGRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NL RDSVGAV++GPY  + EG +   TGRILEVPVG  LLGRVV+ LG PIDG GP
Sbjct: 61  ALALNLNRDSVGAVVMGPYADLQEGMKVTGTGRILEVPVGPELLGRVVNTLGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA+ TSP+E +APGVI R+SV QPVQTG KS+DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IEAKLTSPVEVIAPGVIDRKSVDQPVQTGYKSVDSMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GI  IYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKDSGIFSIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+  +VE+ T G+V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T+LF
Sbjct: 301 AARVSEAYVERFTNGEVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTELF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AG+RPA++ G+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQF+SDLD+AT+KQ
Sbjct: 361 TAGVRPAVDPGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFSSDLDDATKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G++VTELMKQ QY+PMSV   A+ +FAA +G+L DVE+ K+ DFE AL  Y R    
Sbjct: 421 LDHGEKVTELMKQKQYAPMSVFDQALVIFAAEKGYLKDVELAKLADFEEALLSYARGQFA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L  +I  +G +++EI A+    +E+FK T TW
Sbjct: 481 DLAKEIDTSGAWNNEIEAQFVKLVEDFKATQTW 513


>ATPA_SHEHH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  711 bits (1836), Expect = 0.0
 Identities = 349/513 (68%), Positives = 426/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F   +EAR EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFNVVSEARNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY +++EGD+ K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYANLAEGDKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 LEHDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQIGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK TGIKC+YVA+GQKAS++A VVRKL+EHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKDTGIKCVYVAVGQKASTIANVVRKLDEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTKGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRSALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV   AVS+F+A +G+L  VE++KI DFE++L  +M S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVANQAVSIFSAEKGYLKSVELNKIGDFEASLLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+  I  TGDY+ +I  EL+A ++ F  T TW
Sbjct: 481 DLMKTINDTGDYNADIEGELKAGLDKFVETQTW 513


>ATPA_ENT38 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  711 bits (1834), Expect = 0.0
 Identities = 352/513 (68%), Positives = 421/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFSVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    SPIE +APGVI RQSV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSPIEVIAPGVIERQSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALSNTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 ASRVNAEYVENFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q  + LFAA  G+L+DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQGLVLFAAERGYLEDVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L++ +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKSILDSFKATQSW 513


>ATPA_SHEPA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  710 bits (1832), Expect = 0.0
 Identities = 347/513 (67%), Positives = 426/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSEARNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EGD+ K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYATLAEGDKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I++   SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQRELIIGDRQ GKTA+AI
Sbjct: 121 IDSDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQIGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTKGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMS+   +VS+FAA +G+L  V ++K+ DFE++L  +M S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSIADQSVSIFAAEKGYLKSVALNKVGDFEASLLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+  I  TGDY+ +I  EL+A+++ F  T TW
Sbjct: 481 DLMKTINDTGDYNADIEGELKASLDKFVETQTW 513


>ATPA_THIFE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  709 bits (1831), Expect = 0.0
 Identities = 354/512 (69%), Positives = 424/512 (82%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EISELIR RI GFE   E R++GT++SL+DGI+RIHGL DVM+GEM+E PG  +G
Sbjct: 3   QLNPSEISELIRARIAGFEGRVETRSQGTIISLSDGILRIHGLEDVMYGEMLELPGGRFG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           LAMNLE+D+VGAV+LG +  + EGD  KCTGR+++VP+G+ALLGRVV+ALG P+DG G I
Sbjct: 63  LAMNLEQDNVGAVVLGEFSGLQEGDVVKCTGRVMQVPIGKALLGRVVNALGQPVDGKGAI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+    +EK+APGVI RQSV +P+QTG+KSID+MVP+GRGQRELIIGDRQTGKTAVA+D
Sbjct: 123 DAEEFDVLEKIAPGVIDRQSVDEPMQTGIKSIDAMVPIGRGQRELIIGDRQTGKTAVAVD 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AI+NQKG  ++CIYVAIGQKAS+VAGVVRKLEE+GA+E+T V+         +Q++APYA
Sbjct: 183 AILNQKGKDVQCIYVAIGQKASTVAGVVRKLEEYGAMEYTTVIAANASESAAMQYLAPYA 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRG +ALI+YDDLTKQAWAYR +SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGMNALIVYDDLTKQAWAYRHISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           ARVNA+ VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQI+LETDLFN
Sbjct: 303 ARVNADFVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIYLETDLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPAINAGLSVSRVGGAAQTKIIKKLGGG+RLDLAQYRELAAFAQFASDLDE TRKQ+
Sbjct: 363 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGIRLDLAQYRELAAFAQFASDLDEITRKQI 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           ERG+RVTEL+KQ Q+SPMSV                 VEV  ++ FE AL  Y+ S++ E
Sbjct: 423 ERGKRVTELLKQDQFSPMSVADEXXXXXXXXXXXXXXVEVANVRPFEKALLAYLNSNNKE 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+  I +             AA++ FK+ +T+
Sbjct: 483 LMAGIEEXXXXXXXXXXXXXAAVKQFKSGSTY 514


>ATPA_SERP5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  709 bits (1831), Expect = 0.0
 Identities = 350/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLA+VM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLAEVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    SP+E +APGVI RQSV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+AI
Sbjct: 121 VDNDGFSPVEAIAPGVIERQSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  GFL+DVEV K+  FE+AL  Y    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGFLNDVEVAKVVSFEAALVAYADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL+ I +TG+++DEI  +L+  +E FK T +W
Sbjct: 481 ELLNHINQTGNFNDEIEGKLKGILETFKKTQSW 513


>ATPA_VARPS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 517

 Score =  709 bits (1830), Expect = 0.0
 Identities = 371/513 (72%), Positives = 427/513 (83%), Gaps = 5/513 (0%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG       R EGTVVS+TDGIVR+HGL+D M GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLGVSANIRNEGTVVSVTDGIVRVHGLSDAMQGEMLEFPPTAD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              ++GLA+NLERDSVGAVILG Y+HISEGD  KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GTPSFGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPVGPELIGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI R+SV QP+QTGLKSIDSMVP+GRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARKSVDQPMQTGLKSIDSMVPIGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG  + C+YVAIGQKASS+  VVR LE+ GA+++TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQNMTCVYVAIGQKASSIKNVVRALEQAGAMDYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET+LFNAGIRPAINAG+SVSRVG +AQTK+IK L GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETNLFNAGIRPAINAGISVSRVGSSAQTKVIKGLSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+ +  M  +LFA N+GF+DD+E+ K+  FE  L  ++
Sbjct: 421 ATRKQLDRGARVTELLKQAQYSPLPISLMGATLFAVNKGFMDDLEIKKVLPFEHGLHQFL 480

Query: 478 RSSHGELLDKITKTGDYSDEIAAELRAAIENFK 510
           +SSH                      AAI +FK
Sbjct: 481 KSSHXXXXXXXXXXXXXXXXXXXXXTAAITSFK 513


>ATPA_SHISS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHIFL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHIF8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHIDS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHIBS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHESW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 353/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI RQSVSQPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERQSVSQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQF+APY
Sbjct: 181 DAIINQKDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN  +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNEIYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   +VS+FAA +G+L  VE+ K+ DFE+AL  +M S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQSVSIFAAEKGYLKSVELKKVGDFEAALLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I +TGDY+ EI AEL+A ++ F  T TW
Sbjct: 481 ALMKLINETGDYNAEIEAELKAGLDKFVATQTW 513


>ATPA_SHEPC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 353/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI RQSVSQPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERQSVSQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQF+APY
Sbjct: 181 DAIINQKDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN  +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNEIYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   +VS+FAA +G+L  VE+ K+ DFE+AL  +M S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQSVSIFAAEKGYLKSVELKKVGDFEAALLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I +TGDY+ EI AEL+A ++ F  T TW
Sbjct: 481 ALMKLINETGDYNAEIEAELKAGLDKFVATQTW 513


>ATPA_ESCF3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOUT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOSM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOSE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOLU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOLI RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOLC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOL6 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOL5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOHS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECODH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECOBW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO8A RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO81 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO7I RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO5E RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO57 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO55 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO45 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO27 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_ECO24 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  708 bits (1828), Expect = 0.0
 Identities = 352/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_PSYWF RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  708 bits (1827), Expect = 0.0
 Identities = 349/512 (68%), Positives = 425/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN AEIS+LI++RI+  +    A+ EGT+V ++DGIV+IHGL D M+GEMIEF G+ YG
Sbjct: 3   QLNPAEISQLIKQRIQDLDTSATAKNEGTIVKVSDGIVQIHGLEDAMYGEMIEFEGDVYG 62

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A CTGRILEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 63  MALNLEQDSVGAVVLGDYLGLQEGQKAYCTGRILEVPVGPELLGRVVDALGNPIDGKGPI 122

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
            A+ T  +EK+APGVI RQSV +PV TG K++D+M+P+GRGQRELIIGDRQTGKTA+AID
Sbjct: 123 NAKLTDKVEKIAPGVIARQSVDEPVMTGYKAVDTMIPIGRGQRELIIGDRQTGKTAMAID 182

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE GAL +T VV         LQ+IAPY+
Sbjct: 183 AIIAQKNSGIKCVYVAIGQKRSTIANVVRKLEETGALAYTTVVVASASEPAALQYIAPYS 242

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 243 GCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 302

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RVNA +VE+ T G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LFN
Sbjct: 303 SRVNAAYVEEFTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLFN 362

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           +GIRPA+NAG+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQFASDLD+AT++QL
Sbjct: 363 SGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDDATKQQL 422

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           + G+RVTELMKQ QY PMS+ + A  +FA+NEG+L  + V+KI  +E A   YM     +
Sbjct: 423 DHGERVTELMKQKQYQPMSIAEQAAVIFASNEGYLSAIPVEKIGAWEEAYLRYMYDEQAD 482

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I  T +Y+D+IA  L++++E F   +T+
Sbjct: 483 LMQEINDTANYNDDIAGRLKSSVETFLQNHTF 514


>ATPA_TOLAT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  707 bits (1826), Expect = 0.0
 Identities = 362/513 (70%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI+KRI  F   TEAR EGT+VS++DGI+RIHGLADVM GEMIE PGN+Y
Sbjct: 1   MQLNSTEIAELIKKRIAQFNVVTEARNEGTIVSVSDGIIRIHGLADVMQGEMIELPGNSY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLERDSVGA+++GPY  ++EG +   TGRI                   PIDG GP
Sbjct: 61  GLALNLERDSVGAIVMGPYTDLAEGQKVTGTGRIXXXXXXXXXXXXXXXXXXQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    +P+E +APGVI RQSVSQPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFAPVEVIAPGVIERQSVSQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKDSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGEDALIIYDDL+K A AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDALIIYDDLSKHAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN ++VE  T+G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL T LF
Sbjct: 301 ASRVNTDYVEAFTKGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLTTQLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA++ G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAFAQF+SDLD+ATRKQ
Sbjct: 361 NAGIRPAVDPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFAQFSSDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTELMKQ QY+PMSV Q A+ LFAA  G+L+DVE++KI DFE+AL  Y  + H 
Sbjct: 421 LNHGQKVTELMKQKQYAPMSVAQQALVLFAAERGYLEDVELNKIGDFEAALLSYANNEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I    DY+D+I A L A I++FK T+TW
Sbjct: 481 DLMAEINAKADYNDDIVARLSALIDSFKATHTW 513


>ATPA_PROMH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  707 bits (1826), Expect = 0.0
 Identities = 359/513 (69%), Positives = 429/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+RIHGLA+VM GEMI  PGN +
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRIHGLAEVMQGEMIALPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    SP+E +APGVI RQSV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+A+
Sbjct: 121 VEHDGFSPVEMIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGALE+TI           LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALENTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+AE+VE  T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVSAEYVENFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY PMSV Q ++SLFAA  G+L+DVE+ K+  FE+AL  Y    H 
Sbjct: 421 LNHGQKVTELLKQKQYEPMSVAQQSLSLFAAERGYLEDVEISKVVPFEAALLAYASREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +LL +I +TG Y++EI A+L+  ++NFK T +W
Sbjct: 481 DLLKEINQTGTYNEEIEAKLKGVLDNFKATQSW 513


>ATPA_ACIAD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 519

 Score =  707 bits (1826), Expect = 0.0
 Identities = 365/512 (71%), Positives = 430/512 (83%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYG 63
           QLN +EIS LI++RI   +    A+ EGT+V ++DGIVRIHGLAD M+GEMIEF G  +G
Sbjct: 8   QLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGLADAMYGEMIEFDGGLFG 67

Query: 64  LAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPI 123
           +A+NLE+DSVGAV+LG Y  + EG +A+CTGR+LEVPVG  LLGRVVDALG PIDG GPI
Sbjct: 68  MALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPELLGRVVDALGNPIDGKGPI 127

Query: 124 EAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
           +A+ T  +EKVAPGVI RQSV +PVQTG KS+D+M+PVGRGQRELIIGDRQTGKTA+AID
Sbjct: 128 DAKLTDAVEKVAPGVIWRQSVDEPVQTGYKSVDTMIPVGRGQRELIIGDRQTGKTAMAID 187

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
           AII QK +GIKC+YVAIGQK S++A VVRKLEE G                       Y+
Sbjct: 188 AIIAQKHSGIKCVYVAIGQKQSTIANVVRKLEETGXXXXXXXXXXXXXXXXXXXXXXXYS 247

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC MGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 248 GCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLERA 307

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           +RV+A++VEK T G V G+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET LFN
Sbjct: 308 SRVSADYVEKFTNGAVTGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSLFN 367

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
           AGIRPA+NAG+SVSRVGG+AQTKIIKKL GG+R  LAQYRELAAFAQFASDLDEATRKQL
Sbjct: 368 AGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALAQYRELAAFAQFASDLDEATRKQL 427

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
           E GQRVTELMKQ QY+P S+   AVS++A+NEG++ DVEV KI DF++AL  Y RS +  
Sbjct: 428 EHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMADVEVKKIVDFDAALISYFRSEYAP 487

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           L+ +I +TGDY+ +I A +++ IE+FK T T+
Sbjct: 488 LMKQIDETGDYNKDIEAAIKSGIESFKATQTY 519


>ATPA_SHIB3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  706 bits (1823), Expect = 0.0
 Identities = 351/513 (68%), Positives = 419/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGK GSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKNGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELSKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I +TG Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQTGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_CITK8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  706 bits (1821), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VEHDGFSAVEAIAPGVIERQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+++ VVRKLEEHGAL++TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALQNTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNVEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHEB9 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1820), Expect = 0.0
 Identities = 351/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI RQSV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGYSPIEVIAPGVIERQSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKNSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAIYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+F+A +G+L  VE++K+ +FE+AL  +M S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFSAEKGYLKSVELNKVGNFEAALLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I  TGDYS +I AEL+A ++ F  T TW
Sbjct: 481 PLMKLINDTGDYSADIEAELKAGLDKFVATQTW 513


>ATPA_SHEB8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1820), Expect = 0.0
 Identities = 351/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI RQSV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGYSPIEVIAPGVIERQSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKNSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAIYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+F+A +G+L  VE++K+ +FE+AL  +M S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFSAEKGYLKSVELNKVGNFEAALLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I  TGDYS +I AEL+A ++ F  T TW
Sbjct: 481 PLMKLINDTGDYSADIEAELKAGLDKFVATQTW 513


>ATPA_SHEB5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1820), Expect = 0.0
 Identities = 351/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI RQSV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGYSPIEVIAPGVIERQSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKNSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAIYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+F+A +G+L  VE++K+ +FE+AL  +M S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFSAEKGYLKSVELNKVGNFEAALLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I  TGDYS +I AEL+A ++ F  T TW
Sbjct: 481 PLMKLINDTGDYSADIEAELKAGLDKFVATQTW 513


>ATPA_SHEB2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1820), Expect = 0.0
 Identities = 351/513 (68%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PGN +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI RQSV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGYSPIEVIAPGVIERQSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQKNSGIKCVYVAIGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA +VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAIYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+F+A +G+L  VE++K+ +FE+AL  +M S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFSAEKGYLKSVELNKVGNFEAALLSFMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I  TGDYS +I AEL+A ++ F  T TW
Sbjct: 481 PLMKLINDTGDYSADIEAELKAGLDKFVATQTW 513


>ATPA_PECCP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1820), Expect = 0.0
 Identities = 348/513 (67%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+++ VVRKLEEHGALE+TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALENTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L+DVE+ K+  FE+AL  Y    HG
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLEDVELSKVGSFEAALLAYADREHG 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI  + +  ++ FK T +W
Sbjct: 481 ELLQQIDQTGAYNDEIEGKFKGILDTFKATQSW 513


>ATPA_KLEP3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1820), Expect = 0.0
 Identities = 350/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLA+ M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLAECMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LENDGFSAVEAIAPGVIERQSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_KLEP7 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  705 bits (1819), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLA+ M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLAECMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LENDGFSAVEAIAPGVIERQSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_YERE8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1818), Expect = 0.0
 Identities = 349/513 (68%), Positives = 419/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   P+DG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPVDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L D+E+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDIELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_ERWCT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1817), Expect = 0.0
 Identities = 347/513 (67%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 LDHDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+++ VVRKLEEHGALE+TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTISNVVRKLEEHGALENTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L+DV++ K+  FE+AL  Y    HG
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLEDVDLSKVGSFEAALLAYADREHG 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI  + +  ++ FK T +W
Sbjct: 481 ELLQQIDQTGAYNDEIEGKFKGILDTFKATQSW 513


>ATPA_EDWI9 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1817), Expect = 0.0
 Identities = 356/513 (69%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F+  +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFDVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV QPVQTG KS+D+M+P+GRGQREL+IGDRQTGKTA+A+
Sbjct: 121 VEHDGFSAVEAIAPGVIERQSVDQPVQTGYKSVDAMIPIGRGQRELVIGDRQTGKTALAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVA+GQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAVGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNAEYVETFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV   ++ LFAA  G+L+DVE+ K+  FE+AL  Y+   H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVATQSLVLFAAERGYLEDVELAKVGGFEAALMAYVDREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+ +I +TG Y+DEI  +L+  ++ FK T +W
Sbjct: 481 DLMQQINQTGAYNDEIEGKLKGILDTFKATQSW 513


>ATPA_SALTY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALTI RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALSV RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALPK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALPB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALPA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALNS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALHS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALG2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALEP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALDC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALA4 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  704 bits (1816), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALAR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  703 bits (1815), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAYTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHEON RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  703 bits (1814), Expect = 0.0
 Identities = 349/513 (68%), Positives = 421/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PG+ +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGSRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN E+VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNEEYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+FAA +G+L  VE+ K+ DFE+AL  YM S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFAAEKGYLKGVELKKVGDFEAALLSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I +TGDY+ +I AEL+A ++ F  T TW
Sbjct: 481 ALIKLINETGDYNADIEAELKAGLDKFVATQTW 513


>ATPA_SALPC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  702 bits (1813), Expect = 0.0
 Identities = 348/513 (67%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGRTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SALCH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  702 bits (1813), Expect = 0.0
 Identities = 348/513 (67%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DG++RIHGLAD M GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGVIRIHGLADCMQGEMISLPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           ++    S +E +APGVI RQSV QPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 VDNDGFSAVEAIAPGVIDRQSVDQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE  T+G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNADYVEAFTKGEVKGRTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ KI  FE+AL  Y+   H 
Sbjct: 421 LDHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLADVELAKIGSFEAALLAYVDRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+ +I ++G Y+DEI  +L+  +++FK T +W
Sbjct: 481 PLMQEINQSGGYNDEIEGKLKGILDSFKATQSW 513


>ATPA_SHESR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  702 bits (1812), Expect = 0.0
 Identities = 348/513 (67%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PG+ +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGSRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN E+VEK T+G V G+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNEEYVEKFTKGAVTGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+FAA +G+L  VE++K+ DFE+AL  YM S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFAAEKGYLKGVELNKVGDFEAALLSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I +TGDY+ +I AEL+A ++ F  T TW
Sbjct: 481 ALIKLINETGDYNADIEAELKAGLDKFVATQTW 513


>ATPA_SHESM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  702 bits (1812), Expect = 0.0
 Identities = 348/513 (67%), Positives = 422/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PG+ +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGSRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN E+VEK T+G V G+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNEEYVEKFTKGAVTGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+FAA +G+L  VE++K+ DFE+AL  YM S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFAAEKGYLKGVELNKVGDFEAALLSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I +TGDY+ +I AEL+A ++ F  T TW
Sbjct: 481 ALIKLINETGDYNADIEAELKAGLDKFVATQTW 513


>ATPA_VEREI RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 537

 Score =  701 bits (1810), Expect = 0.0
 Identities = 364/495 (73%), Positives = 420/495 (84%), Gaps = 5/495 (1%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN-- 60
           +QLN AEISELI+ RIEG     + R +GTVVS+TDGIVR+HGL+D M GEM+EFP    
Sbjct: 1   MQLNPAEISELIKSRIEGLGVSADIRNQGTVVSVTDGIVRVHGLSDAMQGEMLEFPPTAD 60

Query: 61  ---TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPI 117
              ++GLA+NLERDSVGAVILG Y+HISEG   KCTGRILEVPVG  L+GRVV+ALG PI
Sbjct: 61  GTPSFGLALNLERDSVGAVILGEYEHISEGGTVKCTGRILEVPVGPELIGRVVNALGQPI 120

Query: 118 DGGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGK 177
           DG GPI A+ T  IEKVAPGVI R+SV QP+QTGLKSIDSMVPVGRGQRELIIGDRQTGK
Sbjct: 121 DGKGPINAKMTDVIEKVAPGVIARKSVDQPMQTGLKSIDSMVPVGRGQRELIIGDRQTGK 180

Query: 178 TAVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQ 237
           TAVAIDAIINQKG  + C+YVAIGQKASS+  VVR LE+ GA+++TIVV         +Q
Sbjct: 181 TAVAIDAIINQKGQNMTCVYVAIGQKASSIKNVVRSLEQAGAMDYTIVVXXXXXXXXXMQ 240

Query: 238 FIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHS 297
           +++ Y+GC MGEYFRDRG+DALI+YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHS
Sbjct: 241 YVSAYSGCTMGEYFRDRGQDALIVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHS 300

Query: 298 RLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFL 357
           RLLER+ARVNA++VE  T+G VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL
Sbjct: 301 RLLERAARVNADYVEAFTKGAVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFL 360

Query: 358 ETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDE 417
           ET LFNAGIRPAINAG+SVSRVG +AQT +IK   GG+R DLAQYRELAAFAQFASDLDE
Sbjct: 361 ETSLFNAGIRPAINAGISVSRVGSSAQTNLIKNQSGGIRTDLAQYRELAAFAQFASDLDE 420

Query: 418 ATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           ATRKQL+RG RVTEL+KQ QYSP+ +  M  +LFA N+GF DD++V K+  FE      +
Sbjct: 421 ATRKQLDRGARVTELLKQTQYSPLPISLMNATLFAVNKGFTDDIDVKKVLPFEHGFHQLL 480

Query: 478 RSSHGELLDKITKTG 492
           ++SH  LL+ + K G
Sbjct: 481 KTSHAALLETMEKNG 495


>ATPA_SODGM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1810), Expect = 0.0
 Identities = 349/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLA+VM GEMI  PGN +
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLAEVMQGEMIALPGNRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG  P
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKVP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGK+A+AI
Sbjct: 121 LEHDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKSALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNAEYVENYTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q A+ LFAA  G+L+DVE+ KI DFE+AL  Y+    G
Sbjct: 421 LNHGQKVTELLKQKQYAPMSVAQQALVLFAAERGYLEDVELAKIGDFEAALMAYVDREQG 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+ +I +TG Y+D I  +L+  ++ FK T +W
Sbjct: 481 ELMQQINQTGAYNDYIEGKLKGILDTFKATQSW 513


>ATPA_SHESA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1810), Expect = 0.0
 Identities = 348/513 (67%), Positives = 421/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +E+R EGT+V+++DGI+RIHGLADVM GEMIE PG+ +
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSESRNEGTIVAVSDGIIRIHGLADVMQGEMIELPGSRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVA+GQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGALANTIVVVATASEAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN E+VEK T+G V G+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNEEYVEKFTKGAVTGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G RVTELMKQ QY+PMSV   AVS+FAA +G+L  VE+ K+ DFE+AL  YM S H 
Sbjct: 421 LEHGVRVTELMKQKQYAPMSVAAQAVSIFAAEKGYLKGVELKKVGDFEAALLSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I +TGDY+ +I AEL+A ++ F  T TW
Sbjct: 481 ALIKLINETGDYNADIEAELKAGLDKFVATQTW 513


>ATPA_YERPY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPG RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERPA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_YERP3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1809), Expect = 0.0
 Identities = 351/513 (68%), Positives = 417/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMKVKCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    S +E +APGVI RQSV +PVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSAVEAIAPGVIERQSVDEPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS+VA VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTVANVVRKLEEHDALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNAE+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVNAEYVEAFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAF+QFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGAAQTKIMKKLSGGIRTALAQYRELAAFSQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q ++ LFAA  G+L DVE+ K+  FE+AL  +    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQSLVLFAAERGYLGDVELAKVGSFEAALLAFADREHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           ELL +I +TG Y+DEI A+L+  ++ FK T +W
Sbjct: 481 ELLQQINQTGAYNDEIEAKLKGILDTFKATQSW 513


>ATPA_HAEIN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1808), Expect = 0.0
 Identities = 356/513 (69%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL+DVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRNSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN ++VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNEDYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G++VTEL+KQ Q++P+SV + AV LFA   G+LDDVE+ KI  FE+AL  Y   +H 
Sbjct: 421 LSHGEKVTELLKQKQFTPLSVAEQAVILFAVEFGYLDDVELSKIASFETALLDYSNRNHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E + ++ KTG+Y+DEI   L++ ++ FK  + W
Sbjct: 481 EFMQELNKTGNYNDEIKDTLKSILDGFKANSAW 513


>ATPA_HAEIE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  701 bits (1808), Expect = 0.0
 Identities = 356/513 (69%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL+DVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRNSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN ++VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNEDYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G++VTEL+KQ Q++P+SV + AV LFA   G+LDDVE+ KI  FE+AL  Y   +H 
Sbjct: 421 LSHGEKVTELLKQKQFAPLSVAEQAVVLFAVEFGYLDDVELSKIASFETALLDYSNRNHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E + ++ KTG+Y+DEI   L+  +++FK  + W
Sbjct: 481 EFMQELNKTGNYNDEIKDTLKGILDSFKANSAW 513


>ATPA_HAEIG RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  699 bits (1805), Expect = 0.0
 Identities = 355/513 (69%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL+DVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRNSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN ++VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNEDYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G++VTEL+KQ Q++P+SV + AV LFA   G+LDDVE+ KI  FE+AL  Y   +H 
Sbjct: 421 LSHGEKVTELLKQKQFAPLSVAEQAVILFAVEFGYLDDVELSKIASFETALLDYSNRNHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E + ++ KTG+Y+DEI   L++ ++ FK  + W
Sbjct: 481 EFMQELNKTGNYNDEIKDTLKSILDGFKANSAW 513


>ATPA_SHELP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  698 bits (1802), Expect = 0.0
 Identities = 352/513 (68%), Positives = 426/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE FE  +EAR EGT+V+++DGI+R+HGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISDLIKQRIEQFEVVSEARNEGTIVAVSDGIIRVHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGQKVKTTGRIXXXXXXXXXXXXXXXXXXQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSM+P+GRGQREL+IGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMIPIGRGQRELVIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVA+GQKAS++A VVRKLEEHG                  Q++APY
Sbjct: 181 DAIINQKDSGIKCVYVAVGQKASTIANVVRKLEEHGXXXXXXXXXXXXXXXXXXQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVNAE+VEK T G+VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNAEYVEKFTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV   +VS+FAA +G+L  VE++KI DFE++L  YM S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVADQSVSIFAAEKGYLKGVELNKIGDFEASLLSYMNSEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L+  I +TGDY+ +I   L+A ++ F  T TW
Sbjct: 481 DLMKTINETGDYNADIEGGLKAGLDKFVETQTW 513


>ATPA_ACTSZ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  697 bits (1799), Expect = 0.0
 Identities = 355/513 (69%), Positives = 425/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL++VM GEMI  P N Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSEVMQGEMIALPDNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYIDLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IKNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GIKCIYVAIGQKAS++A VVRKLEE+GAL +TI+V         LQ++APY
Sbjct: 181 DTIINQKDSGIKCIYVAIGQKASTIANVVRKLEENGALANTIIVVXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNEEYVENFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA+N G+SVSRVGGAAQTK++KKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGVRPAVNPGISVSRVGGAAQTKVVKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G++VTE++KQ QY+P+SV + AV LFA   G+LDDVE++KI DFE+ L  Y   ++ 
Sbjct: 421 LSHGEKVTEMLKQKQYAPLSVAEQAVLLFAVEFGYLDDVELNKIADFETTLLDYANRTNA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E + ++T++GDY+DEI   L   + NFK  NTW
Sbjct: 481 EFMRELTQSGDYNDEIKNTLEGILNNFKANNTW 513


>ATPA_MANSM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  696 bits (1796), Expect = 0.0
 Identities = 354/513 (69%), Positives = 428/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL++VM GEMI  P   +
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSEVMQGEMIALPTGRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYTDLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IKNDGFSPVEVIAPGVIDRKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +G+KCIYVA+GQKAS++A VVRKLEE+GAL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGVKCIYVAVGQKASTIANVVRKLEENGALANTIVVXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN E+VE  T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 AARVNEEYVENFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPA+N G+SVSRVGGAAQTK +KKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGVRPAVNPGISVSRVGGAAQTKAVKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G++VTEL+KQ QY+P+SV + AV LFA   G+LDDVE++KI DFE+AL  Y   ++ 
Sbjct: 421 LSHGEKVTELLKQKQYAPLSVAEQAVILFAVEFGYLDDVELNKIADFETALLDYANRTNT 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E + ++TK+GDY+DEI   L+  ++NFK  NTW
Sbjct: 481 EFMQELTKSGDYNDEIKNTLKGILDNFKANNTW 513


>ATPA_ACTP2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  695 bits (1794), Expect = 0.0
 Identities = 357/513 (69%), Positives = 424/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EA++ GT+VS++DGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEAQSTGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMSVKCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI RQSV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIDRQSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAII QK +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIIAQKDSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+A++VE+ T G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVSADYVERFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQTK IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTKAIKKLSGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ Q++PM V + A+ LFAA  G+LDDVE+++I  FESAL  Y  S+H 
Sbjct: 421 LSHGQKVTELLKQKQFAPMPVSEQALVLFAAEFGYLDDVELERIGSFESALLAYANSNHT 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + +  + K+GDY+D I  +L+A +E+FK    W
Sbjct: 481 DFMKNLAKSGDYNDSIKDQLKAIVEDFKKNGAW 513


>ATPA_HAES2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  694 bits (1792), Expect = 0.0
 Identities = 355/513 (69%), Positives = 425/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  FE   EAR  GT+VS++DGI+RIHGL+DVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFEVINEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYSDLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IKNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHGALQNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+ E+VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVSEEYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTK++KKL GG+R  LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKVVKKLAGGIRTALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QYSP+SV + A+ LFA   G+LDDVE+++I  FE+AL  Y   ++ 
Sbjct: 421 LSHGQKVTELLKQKQYSPLSVAEQALVLFAVEFGYLDDVELNRIGTFETALLEYANYNYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + + ++TKTG+Y DEI   L+  ++ FK    W
Sbjct: 481 DFMAELTKTGNYDDEIKNTLKTVLDQFKANVAW 513


>ATPA_HAES1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  694 bits (1792), Expect = 0.0
 Identities = 355/513 (69%), Positives = 425/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  FE   EAR  GT+VS++DGI+RIHGL+DVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFEVINEARNTGTIVSVSDGIIRIHGLSDVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYSDLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IKNDGFSPVEVIAPGVIERKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHGALQNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+ E+VEK T+G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVSEEYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTK++KKL GG+R  LAQYRELAAFAQFASDLDEATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKVVKKLAGGIRTALAQYRELAAFAQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QYSP+SV + A+ LFA   G+LDDVE+++I  FE+AL  Y   ++ 
Sbjct: 421 LSHGQKVTELLKQKQYSPLSVAEQALVLFAVEFGYLDDVELNRIGTFETALLEYANYNYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + + ++TKTG+Y DEI   L+  ++ FK    W
Sbjct: 481 DFMAELTKTGNYDDEIKNTLKTVLDQFKANVAW 513


>ATPA_ACTP7 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  694 bits (1792), Expect = 0.0
 Identities = 357/513 (69%), Positives = 423/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EA++ GT+VS++DGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEAQSTGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMSVKCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI RQSV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIDRQSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAII QK +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIIAQKDSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+A++VE  T G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVSADYVESFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQTK IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTKAIKKLSGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ Q++PM V + A+ LFAA  G+LDDVE+++I  FESAL  Y  S+H 
Sbjct: 421 LSHGQKVTELLKQKQFAPMPVSEQALVLFAAEFGYLDDVELERIGSFESALLAYANSNHT 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + +  + K+GDY+D I  +L+A +E+FK    W
Sbjct: 481 DFMKNLAKSGDYNDSIKDQLKAIVEDFKKNGAW 513


>ATPA_ACTPJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  694 bits (1790), Expect = 0.0
 Identities = 356/513 (69%), Positives = 423/513 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EA++ GT+VS++DGI+RIHGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEAQSTGTIVSVSDGIIRIHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMSVKCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI RQSV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIDRQSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAII QK +GIKCIYVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIIAQKDSGIKCIYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+A++VE+ T G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE+ LF
Sbjct: 301 AARVSADYVERFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQTK IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTKAIKKLSGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ Q++PM V + A+ LFAA  G+LDDVE+++I  FESAL  Y  S+H 
Sbjct: 421 LSHGQKVTELLKQKQFAPMPVSEQALVLFAAEFGYLDDVELERIGSFESALLAYANSNHT 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + +  + K+GDY+D I  +L+  +E+FK    W
Sbjct: 481 DFMKNLAKSGDYNDSIKDQLKTIVEDFKKNGAW 513


>ATPA_ERWT9 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  691 bits (1783), Expect = 0.0
 Identities = 349/513 (68%), Positives = 409/513 (79%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F   +EA  EGT+VS++DGI+R+HGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKQRIAQFNVVSEAHNEGTIVSVSDGIIRVHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMTVKCTGRIXXXXXXXXXXXXXXXXXXAPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI RQSV QPVQTG KS+D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPIEVIAPGVIDRQSVDQPVQTGYKSVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVAIGQKAS++A VVRKLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRDSGIKCVYVAIGQKASTIANVVRKLEEHNALANTIVVVATASESAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQVSLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+A++VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 ASRVSADYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLDEATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDEATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QY+PMSV Q  + LFAA  GFL+DVE+ KI  FE+AL  Y    H 
Sbjct: 421 LSHGQKVTELLKQKQYAPMSVAQQGLVLFAAERGFLNDVELAKIGSFEAALLAYADRDHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+  I ++G+Y+             FK T +W
Sbjct: 481 ELMADINQSGNYNXXXXXXXXXXXXTFKATQSW 513


>ATPA_PASMU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  690 bits (1781), Expect = 0.0
 Identities = 351/513 (68%), Positives = 427/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F+  +EAR  GT+VS++DGI+RIHGL++VM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLSEVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   +CTGRI                   PIDG G 
Sbjct: 61  AMALNLERDSVGAVVMGPYADLAEGMEVQCTGRIXXXXXXXXXXXXXXXXXXEPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI R+SV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGFSPVEVIAPGVIDRKSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS++A VVRKLEEH AL++TI           LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTIANVVRKLEEHSALQNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRGEDALIIYDDL+KQA AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN E+VE+ T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVNEEYVERFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGG+AQTK+IKKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ QYSP+SV Q A+ LFA   G+L++V++D+I  FESAL  Y   ++ 
Sbjct: 421 LSHGQKVTELLKQKQYSPLSVAQQALVLFAVEFGYLEEVDLDRIGSFESALLEYANHNYA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           + + ++T++G+Y+DEI   L+  +++FK  + W
Sbjct: 481 DFMRELTQSGNYNDEIKESLKGILDSFKANSAW 513


>ATPA2_SHEFN RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 513

 Score =  689 bits (1779), Expect = 0.0
 Identities = 348/513 (67%), Positives = 430/513 (83%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RI+ F+  +EAR EGT+V+++DGI+RI+GLADVM GEMIE PG  +
Sbjct: 1   MQLNSTEISDLIKQRIQQFDVVSEARNEGTIVAVSDGIIRINGLADVMQGEMIELPGGCF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY +++EGD+ + TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYANLAEGDKVRTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SP+E +APGVI R+SVSQP+QTG K++D+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPVEVIAPGVIERKSVSQPIQTGYKAVDAMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKESGIKCVYVAIGQKASTIANVVRKLEEHGALANTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCSMGEYFRDRGEDSLIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN  +VEK T+G V G+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLETDLF
Sbjct: 301 ASRVNVNYVEKFTKGAVTGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV   +VS+FAA +G+L  V +++I  FE++L  YM S H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVAAQSVSIFAAEKGYLKGVALNEIGRFEASLLSYMNSQHT 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           +L++ I  TGDY+ +I  EL+A ++ F  T TW
Sbjct: 481 DLMNTINATGDYNADIEGELKAGMDKFIETQTW 513


>ATPA2_PHOPR RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 513

 Score =  689 bits (1779), Expect = 0.0
 Identities = 343/513 (66%), Positives = 414/513 (80%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LIR+RI  F   ++AR EGT+VS++DGI+ I+GLADVM GEMIE PGN Y
Sbjct: 1   MQLNSNEISDLIRQRIATFNVTSQARNEGTIVSVSDGIISINGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            LA+NLER SVGAV++GPY  ++EG + K TGRI                   PIDG G 
Sbjct: 61  ALALNLERHSVGAVVMGPYSDLAEGLKVKGTGRIXXXXXXXXXXXXXXXXXXQPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI RQSV QP+QTG K++D+MVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IENDGYSPVEIIAPGVIERQSVDQPIQTGYKAVDAMVPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK +GIKC+YVAIGQKAS++A VVRKLEEH AL++TIVV         LQ++APY
Sbjct: 181 DAIINQKDSGIKCVYVAIGQKASTIANVVRKLEEHDALKNTIVVVATASDAAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLL+RPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN  +VE+ T+GKVKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL+T LF
Sbjct: 301 ASRVNVSYVERFTKGKVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQTHLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA++ G+SVSRVGGAAQTKI+KKL GG+R  LAQYRELAAFAQF+SDLD+ATRKQ
Sbjct: 361 NSGLRPAVDPGISVSRVGGAAQTKIVKKLSGGIRTALAQYRELAAFAQFSSDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G++VTELMKQ QY+PMSV + A+++F+A +G+L DV +  I DFESAL  Y +S H 
Sbjct: 421 LDHGEKVTELMKQKQYAPMSVAEQALAIFSAEKGYLGDVPLASIGDFESALMAYAKSEHS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            LLD I KTG Y D+I   L   ++ F  T +W
Sbjct: 481 ALLDTINKTGQYDDDIEQSLHKLLKTFTATQSW 513


>ATPA_HAEPS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  684 bits (1766), Expect = 0.0
 Identities = 351/513 (68%), Positives = 420/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI+KRI  F   +EA++ GT+VS++DG++RIHGLADVM GEMI  PGN Y
Sbjct: 1   MQLNSTEISELIKKRIAQFNVVSEAQSTGTIVSVSDGVIRIHGLADVMQGEMIALPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG   KCTGRI                   PIDG G 
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGMEVKCTGRIXXXXXXXXXXXXXXXXXXQPIDGKGE 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    SPIE +APGVI RQSV QPVQTG K++DSMVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFSPIEVIAPGVIDRQSVDQPVQTGYKAVDSMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKCIYVAIGQKAS+++ VVRKLEEHGAL++TI           LQ++APY
Sbjct: 181 DAIINQRDSGIKCIYVAIGQKASTISNVVRKLEEHGALQNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVNA++VE+ T G VKG+TGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET  F
Sbjct: 301 AARVNADYVERFTNGAVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETSFF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVGG+AQTK++KKL GG+R  LAQYRELAAFAQFASDLD+ATRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGGSAQTKLVKKLAGGIRTALAQYRELAAFAQFASDLDDATRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ+VTEL+KQ Q+ PMSV Q+ +SL AA  G+LDDVEV+++  FES           
Sbjct: 421 LSHGQKVTELLKQKQFEPMSVAQLGLSLAAAEFGYLDDVEVERVGSFESXXXXXXXXXXX 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           E +  ++K+GD++D I A+L   +++FK  + W
Sbjct: 481 EFMKDLSKSGDFNDTIKAKLIEILDSFKKNSAW 513


>ATPA_SHEAM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  684 bits (1764), Expect = 0.0
 Identities = 348/513 (67%), Positives = 418/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RIE F+  +EAR EGT+V+++DGI+R+HGLADVM GEMIE PGN Y
Sbjct: 1   MQLNSTEISDLIKQRIEQFDVVSEARNEGTIVAVSDGIIRVHGLADVMQGEMIELPGNRY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLERDSVGAVVMGPYADLAEGVKVKTTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    +P+E +APGVI R+SVSQPVQTG K++DSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IDNDGFAPVEVIAPGVIDRKSVSQPVQTGYKAVDSMIPIGRGQRELIIGDRQTGKTAMAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +GIKC+YVA+GQKAS++A VVRKLEEHG                      PY
Sbjct: 181 DAIINQRDSGIKCVYVAVGQKASTIANVVRKLEEHGXXXXXXXXXXXXXXXXXXXXXXPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RVN E+VEK T+G V GKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFLET+LF
Sbjct: 301 ASRVNEEYVEKFTKGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G+RPA+N G+SVSRVGGAAQTKIIKKL GG+R  LAQYRELAAF+QFASDLD+ATR Q
Sbjct: 361 NSGLRPAVNPGISVSRVGGAAQTKIIKKLSGGIRTALAQYRELAAFSQFASDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE G+RVTELMKQ QY+PMSV + AV +FAA +GFL  + + K+ DFE+AL  +M + H 
Sbjct: 421 LEHGERVTELMKQKQYAPMSVAEQAVVIFAAEKGFLKGIALKKVGDFEAALLAFMNAEHA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I  TGDY+ EI AEL+A ++ F  T TW
Sbjct: 481 NLMKLINDTGDYNAEIEAELKAGLDKFVATQTW 513


>ATPA_COLP3 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  679 bits (1753), Expect = 0.0
 Identities = 350/513 (68%), Positives = 416/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EI+ELI+ RIE F   +EAR EGT+VS+TDGI+RI+GLADVM GEMIE PG+ +
Sbjct: 1   MQLNSTEIAELIKNRIEQFNVVSEARNEGTIVSVTDGIIRINGLADVMQGEMIELPGSRF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NL+RDSVGAV++GPY  ++EG + K TGRI                   PIDG GP
Sbjct: 61  AIALNLDRDSVGAVVMGPYADLAEGQKVKGTGRIXXXXXXXXXXXXXXXXXXEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE    SP+E +APGVI R+SV +PVQTG+KSID+M+P+GRGQRELIIGDRQ GK+A+A+
Sbjct: 121 IENDGFSPVEVIAPGVIDRKSVDEPVQTGIKSIDAMIPIGRGQRELIIGDRQIGKSAIAL 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQK TGIK IYVAIGQKAS+VA VVR LEEHGAL +TI           LQ++APY
Sbjct: 181 DAIINQKNTGIKSIYVAIGQKASTVANVVRSLEEHGALSNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRDRGEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARVN  +VEK T G+VKGKTGSLTALPIIETQAGDVSAF+PTNVISITDGQIFL++DLF
Sbjct: 301 AARVNEAYVEKFTNGEVKGKTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLQSDLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+NAG+SVSRVGGAAQTKIIKKLGGG+R                SDLD+ATR Q
Sbjct: 361 NSGIRPAVNAGISVSRVGGAAQTKIIKKLGGGIRXXXXXXXXXXXXXXXXSDLDDATRAQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE GQRVTELMKQ QYSP+S+ + AVSLFAA +GFL+DV ++K+ DFE AL  YM +   
Sbjct: 421 LEHGQRVTELMKQKQYSPLSIAETAVSLFAAEKGFLNDVAINKVVDFEEALHAYMSNEQA 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
            L+  I + GDY+ +I A L+ A+ENFK+T TW
Sbjct: 481 ALMATINEKGDYNKDIEASLKTALENFKSTQTW 513


>ATPA_BLOPB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  670 bits (1728), Expect = 0.0
 Identities = 328/513 (63%), Positives = 419/513 (81%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RI  F+   E R EGT+ ++ DG++ IHGL +VM GEMI  P + +
Sbjct: 1   MQLNSNEISKLIKRRIAQFDITCEIRNEGTITAVGDGVIHIHGLTNVMQGEMIALPSDQF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERDSVGAV++G Y ++SEG  AKCTG IL VPVG ALLGRVV+ALG+P+D  G 
Sbjct: 61  AVALNLERDSVGAVVMGSYLNLSEGMVAKCTGNILRVPVGTALLGRVVNALGVPVDNKGV 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+     P+E VAP VI R+S+ +P+QTG KS+DSM+P+GRGQRELIIGDRQTGK+A+AI
Sbjct: 121 IQCSCYFPVEAVAPSVIDRKSIDEPIQTGYKSVDSMIPIGRGQRELIIGDRQTGKSALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+ +G+KCIYVA+GQKA++VA VV+KLEEH AL +TIVV         LQ++APY
Sbjct: 181 DAIINQRYSGVKCIYVAVGQKATTVANVVKKLEEHRALSNTIVVIASASESAVLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRD GEDALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGD+FYLHSRLLER
Sbjct: 241 SGCAMGEYFRDLGEDALIVYDDLSKQAIAYRQISLLLRRPPGREAYPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV++++VE+ T GK+ G+TGSLTA+PI+ETQAGDVS+FIPTNVISITDGQIFLE+ LF
Sbjct: 301 ASRVSSDYVERCTHGKITGRTGSLTAIPIVETQAGDVSSFIPTNVISITDGQIFLESHLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVGG+AQT I+K L GG+R  LAQYRELAAF+QFAS+LD+ TRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGGSAQTNIMKVLSGGIRTALAQYRELAAFSQFASELDDVTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QY+PM+V   ++ LFAA  G+L+DVEV KI DFESAL  YM  +  
Sbjct: 421 LQHGQKVTELLKQKQYAPMAVSCQSIILFAAVHGYLEDVEVSKISDFESALILYMTYTEK 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+  I   G Y+ +I  + ++ +E FK+  +W
Sbjct: 481 ELIKIIDHDGVYNIDIENKFKSILETFKSNQSW 513


>ATPA_BUCAP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 510

 Score =  664 bits (1712), Expect = 0.0
 Identities = 332/510 (65%), Positives = 419/510 (82%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EIS+LI++RI  FE   ++  EGT++S+ DGI++I+GL+DVM GEMI  P N Y
Sbjct: 1   MQLNSTEISQLIKERIAQFEVFNQSYNEGTIISVNDGIIKIYGLSDVMLGEMILLPDNEY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+N+ERD++GAV++GPY HI+EG + +CTG+ILEVPVG ALLGR+V+ALG PIDG G 
Sbjct: 61  AIALNIERDTIGAVVMGPYIHITEGTKVRCTGKILEVPVGVALLGRIVNALGFPIDGKGS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE     P+E  APGVI R+S+++P+QTG K+ID+MVP+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IEHDIYLPVEADAPGVIERESINEPIQTGYKAIDAMVPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK   + C+YVAIGQK S++  VV+KL+EH AL +TI           LQ++APY
Sbjct: 181 DTIINQKKINLPCVYVAIGQKLSTIINVVKKLDEHDALLNTIXXXXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFRDRG+DALI+YDDL+K A AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEYFRDRGKDALIVYDDLSKHAVAYRQISLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+ EHV+ +T+GK+ GKTGSLTALPIIETQ+GDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVSKEHVKNVTKGKITGKTGSLTALPIIETQSGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+NAG+SVSRVG AAQTKIIKKL  G+R  LAQY ELAAF+QFASDLD+ TRKQ
Sbjct: 361 NSGIRPAVNAGISVSRVGSAAQTKIIKKLSSGIRTALAQYHELAAFSQFASDLDQTTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ++TEL+KQ QY PMS+ +  +  F A   FLDD+ V+ I  FE  +  Y  + H 
Sbjct: 421 LIYGQKITELLKQKQYRPMSISEQGLMFFIAENNFLDDISVENIIQFEKEILTYAYNYHL 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           +L+++I K G+++D I  +    I NFK +
Sbjct: 481 DLMEEINKDGNFNDIIKKKFIELINNFKNS 510


>ATPA_BAUCH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  651 bits (1679), Expect = 0.0
 Identities = 324/509 (63%), Positives = 405/509 (79%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QLN+ EISELI++RI  F+  +    EG ++S+ DGI+RIHGL++VM GEMI  PGN++
Sbjct: 1   MQLNSTEISELIKQRIVEFDLTSIIYNEGIILSVIDGIIRIHGLSEVMQGEMIALPGNSF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLERD VGAV++GPY H++EG + KCTGRILEVPVG +LLGR+V+ LGIPIDG G 
Sbjct: 61  AIALNLERDEVGAVVMGPYSHLTEGMKVKCTGRILEVPVGHSLLGRIVNTLGIPIDGKGK 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E +  SPIE  AP VI RQS+S+P+QTG KSID+M+P+GRGQRELIIGDRQTGK+ +AI
Sbjct: 121 LENKLFSPIETNAPNVIERQSISEPIQTGYKSIDAMIPIGRGQRELIIGDRQTGKSTLAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQ+ + IKCIYVAIGQKAS++  VV+KLEEH AL +TI+V         LQ++APY
Sbjct: 181 DTIINQRNSDIKCIYVAIGQKASTINNVVQKLEEHNALINTIIVTATASDSVALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC MGEYFR+ GE+AL+IYDDL+KQA AYRQ+SLLLRRPPGREA+PGD+FYLHSRLLER
Sbjct: 241 AGCVMGEYFRNIGENALVIYDDLSKQAIAYRQISLLLRRPPGREAYPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +ARV+A +VE            SLTALPIIETQAGDVS+FIPTNVISITDGQIFLE+ LF
Sbjct: 301 AARVSANYVEXXXXXXXXXXXXSLTALPIIETQAGDVSSFIPTNVISITDGQIFLESSLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAGIRPA+N G+SVSRVG AAQTKIIK +  G+R  LAQYREL AF+QFASDLDE TRKQ
Sbjct: 361 NAGIRPAVNPGISVSRVGSAAQTKIIKTVSSGIRTTLAQYRELEAFSQFASDLDEVTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           +  G++VTEL+KQ Q+ PMSV Q A+ LFAA +G+L+D+ + KI DFE+ L  Y++  + 
Sbjct: 421 INYGKKVTELLKQKQHMPMSVSQQALVLFAAEQGYLEDINLKKINDFETQLLLYVKHQYH 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKT 511
           + +  I + G+Y+D+I   L   I  FKT
Sbjct: 481 DFMKIIDQEGNYNDDIEKTLTEIISKFKT 509


>ATPA_BLOFL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 513

 Score =  648 bits (1671), Expect = 0.0
 Identities = 324/508 (63%), Positives = 404/508 (79%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++LN  EIS++IR RI+  +   E R EGT+ S+ DG++ IHGL++VM GEMI  P N +
Sbjct: 1   MRLNVNEISDIIRNRIKQLDIGCETRNEGTITSVADGVIYIHGLSNVMQGEMIALPYNKF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLE  + GA+++G Y++ISEG   KCTG IL VPVG  LLGRVV+ALG+PID  G 
Sbjct: 61  AIALNLESSATGAIVMGSYENISEGMVVKCTGDILRVPVGPELLGRVVNALGVPIDNKGL 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I      PIE  APGVI RQS+++P+QTG KSIDSMVP+GRGQRELIIGDRQTGK+A+AI
Sbjct: 121 INCSNYYPIESDAPGVIDRQSINEPIQTGYKSIDSMVPIGRGQRELIIGDRQTGKSALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQ  +G+KCIYVAIGQKA++V  VV+KLEE+ AL++TIV+         LQ++APY
Sbjct: 181 DTIINQSCSGVKCIYVAIGQKATTVVNVVKKLEEYHALDNTIVILASASESAILQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGEYFR+ G+DALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGD+FYLHSRLLER
Sbjct: 241 SGCAMGEYFRNNGQDALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SA+V +E++E+ T+GK+ GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLE+ LF
Sbjct: 301 SAKVRSEYIERCTQGKITGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLESQLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAIN G+SVSRVGG+AQTKI+K L GG+R  LAQYRELAAF+QF+S+LD  TRKQ
Sbjct: 361 NAGVRPAINPGISVSRVGGSAQTKIMKVLSGGIRTALAQYRELAAFSQFSSELDNVTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ GQ+VTEL+KQ QYS MSV   A+ LFA + G+L+D+E+ KI DFE+ L  Y+     
Sbjct: 421 LQHGQKVTELLKQKQYSCMSVACQAIILFAVSYGYLEDIELSKIGDFEAKLISYLTYHEL 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           EL+  I   G Y   I  +L+  +E FK
Sbjct: 481 ELVKHINIYGSYDSNIENKLKNILEMFK 508


>ATPA_BUCAI RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  628 bits (1620), Expect = 0.0
 Identities = 318/508 (62%), Positives = 408/508 (80%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++LN+ EIS+LI++RI  FE   ++  EG+++S++DGI++I+GL++VM GEMI  P N Y
Sbjct: 1   MRLNSTEISKLIKERIAQFEVFNQSYNEGSIISVSDGIIKINGLSNVMLGEMILLPNNEY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+N+ERD+VGAV++GPY HISEG + +CTG+ILEVPVG+  LGRVV+ALG PIDG   
Sbjct: 61  AIALNIERDTVGAVVMGPYIHISEGAKVRCTGKILEVPVGDNFLGRVVNALGFPIDGKDS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+     P+E  APGVI R+SV+QP+QTG K IDSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IQNDGFFPVEADAPGVIDRKSVNQPIQTGYKVIDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GIKCIYVAIGQK S++  VV+KLEE+ AL +TI+V         LQ++APY
Sbjct: 181 DTIINQKQSGIKCIYVAIGQKLSTIINVVKKLEENNALFNTIIVVXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAM E+FR++GED+LIIYDDL+K A AYRQ+SLLLRRPPGREAFPGD+FYLHSRLLER
Sbjct: 241 SGCAMAEFFRNKGEDSLIIYDDLSKHAVAYRQISLLLRRPPGREAFPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+ E+V+               ALPIIETQ+GDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVSMEYVQXXXXXXXXXXXXXXXALPIIETQSGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQT IIKKL  G+R  LAQY+ELAAF+QF+SDLD+ TRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTTIIKKLSSGIRTALAQYQELAAFSQFSSDLDDTTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ++TEL+KQ QYSP+S+ + A+ LF A   FLDD+ +DKI  FE  +  Y  + + 
Sbjct: 421 LNHGQKITELLKQKQYSPISIAEQALILFVAENNFLDDISIDKITKFEKEILIYAHNYYF 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I KTGD++  I  +    I  FK
Sbjct: 481 DLMEEINKTGDFNIVIKDKFIKLITEFK 508


>ATPA_BUCA5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  628 bits (1620), Expect = 0.0
 Identities = 318/508 (62%), Positives = 408/508 (80%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++LN+ EIS+LI++RI  FE   ++  EG+++S++DGI++I+GL++VM GEMI  P N Y
Sbjct: 1   MRLNSTEISKLIKERIAQFEVFNQSYNEGSIISVSDGIIKINGLSNVMLGEMILLPNNEY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+N+ERD+VGAV++GPY HISEG + +CTG+ILEVPVG+  LGRVV+ALG PIDG   
Sbjct: 61  AIALNIERDTVGAVVMGPYIHISEGAKVRCTGKILEVPVGDNFLGRVVNALGFPIDGKDS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+     P+E  APGVI R+SV+QP+QTG K IDSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IQNDGFFPVEADAPGVIDRKSVNQPIQTGYKVIDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GIKCIYVAIGQK S++  VV+KLEE+ AL +TI+V         LQ++APY
Sbjct: 181 DTIINQKQSGIKCIYVAIGQKLSTIINVVKKLEENNALFNTIIVVXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAM E+FR++GED+LIIYDDL+K A AYRQ+SLLLRRPPGREAFPGD+FYLHSRLLER
Sbjct: 241 SGCAMAEFFRNKGEDSLIIYDDLSKHAVAYRQISLLLRRPPGREAFPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+ E+V+               ALPIIETQ+GDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVSMEYVQXXXXXXXXXXXXXXXALPIIETQSGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQT IIKKL  G+R  LAQY+ELAAF+QF+SDLD+ TRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTTIIKKLSSGIRTALAQYQELAAFSQFSSDLDDTTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ++TEL+KQ QYSP+S+ + A+ LF A   FLDD+ +DKI  FE  +  Y  + + 
Sbjct: 421 LNHGQKITELLKQKQYSPISIAEQALILFVAENNFLDDISIDKITKFEKEILIYAHNYYF 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I KTGD++  I  +    I  FK
Sbjct: 481 DLMEEINKTGDFNIVIKDKFIKLITEFK 508


>ATPA_BUCAT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  626 bits (1614), Expect = 0.0
 Identities = 317/508 (62%), Positives = 407/508 (80%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++LN+ EIS+LI++RI  FE   ++  EG+++S++DGI++I+GL++VM GEMI  P N Y
Sbjct: 1   MRLNSTEISKLIKERIAQFEVFNQSYNEGSIISVSDGIIKINGLSNVMLGEMILLPNNEY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+N+ERD+VGAV++GPY HISEG + +CTG+ILEVPVG+  LGRVV+ALG PIDG   
Sbjct: 61  AIALNIERDTVGAVVMGPYIHISEGAKVRCTGKILEVPVGDNFLGRVVNALGFPIDGKDS 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+     P+E  APGVI R+SV+QP+QTG K IDSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IQNDGFFPVEADAPGVIDRKSVNQPIQTGYKVIDSMIPIGRGQRELIIGDRQTGKTALAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK +GIKCIYVAIGQK S++  VV+KLEE+ AL +TI+V         LQ++APY
Sbjct: 181 DTIINQKQSGIKCIYVAIGQKLSTIINVVKKLEENNALFNTIIVVXXXXXXXXLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAM E+FR++GED+LIIYDDL+K A AYRQ+SLLLRRPPGREAFPGD+FYLHSRLLER
Sbjct: 241 SGCAMAEFFRNKGEDSLIIYDDLSKHAVAYRQISLLLRRPPGREAFPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++RV+ E+V+               ALPIIETQ+GDVSAF+PTNVISITDGQIFLE++LF
Sbjct: 301 ASRVSMEYVQXXXXXXXXXXXXXXXALPIIETQSGDVSAFVPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPA+N G+SVSRVG AAQT IIKKL  G+R  LAQY+ELAAF+QF+SDLD+ TRKQ
Sbjct: 361 NSGIRPAVNPGISVSRVGSAAQTTIIKKLSSGIRTALAQYQELAAFSQFSSDLDDTTRKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  GQ++TEL+KQ QYSP+S+ + A+ LF A   FLDD+ +DKI  FE  +  Y  + + 
Sbjct: 421 LNHGQKITELLKQKQYSPISIAEQALILFVAENNFLDDISIDKITKFEKEILIYAHNYYF 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+++I K GD++  I  +    I  FK
Sbjct: 481 DLMEEINKIGDFNIVIKDKFIKLITEFK 508


>ATPA_DESRM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  620 bits (1598), Expect = e-179
 Identities = 318/510 (62%), Positives = 392/510 (76%), Gaps = 11/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + L   EIS +IR++I+ +EA  E    GTV+ + DGI R++GL D M  E++EFPG T 
Sbjct: 1   MNLRPEEISSIIRQQIDKYEAQVEVSDVGTVIQVGDGIARVYGLEDCMAAELLEFPGGTL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D++G VI+GPY HI EGD  K TGRI+ VPVG+AL+GRVV+ LG PIDG GP
Sbjct: 61  GMALNLEEDNIGCVIMGPYTHIKEGDPVKRTGRIISVPVGDALIGRVVNPLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+ +   P E++APGVITR+SV+ P+QTGLK+ID+MVPVGRGQRELIIGDRQTGKTAVA+
Sbjct: 121 IKTEKYRPTERIAPGVITRKSVTVPLQTGLKAIDAMVPVGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQKG  + CIYVA+GQKAS+VAGVV+ LE HGA+E++IVV         L ++APY
Sbjct: 181 DAIINQKGQDVICIYVAVGQKASTVAGVVQTLEAHGAMEYSIVVAANASEPAPLLYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCAMGE F D G+D LIIYDDL+KQA AYR++SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 SGCAMGEEFMDNGKDVLIIYDDLSKQATAYREMSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +AR+  E              GS+TALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 AARLAPEF-----------GGGSITALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+G RPAI+ GLSVSRVGGAAQ K +K++ G +RLDLAQYRELAAFAQF SDLD+AT+ +
Sbjct: 350 NSGQRPAISVGLSVSRVGGAAQIKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDKATQAR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R  +++KQ QY P  V +  V ++ A +GFLDDVE++KI  FE     +MRS+  
Sbjct: 410 LNRGARTVQILKQGQYKPYPVEEQVVVIYTAVKGFLDDVELNKIGAFEDGFINFMRSNKA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           ++L  I +  +   E  A+L AAIE FK T
Sbjct: 470 DILKAIREQKEIKPETDAKLVAAIEEFKKT 499


>ATPA_HELMI RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  615 bits (1587), Expect = e-178
 Identities = 317/510 (62%), Positives = 389/510 (76%), Gaps = 11/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + L   EIS +I+++IE +E   EA   GTV+ + DGI RI+GL   M GE++EFPG  Y
Sbjct: 1   MSLRPEEISAIIKQQIERYEKPLEAADSGTVIQVGDGIARIYGLEKAMAGELLEFPGQVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D++G VILGPY  I EGD  K TGRI+EVPVG  L+GRVV+ LG P+DG GP
Sbjct: 61  GMVLNLEEDNIGCVILGPYTGIKEGDTVKRTGRIVEVPVGPELIGRVVNPLGQPLDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+   PIE  APGVI R+SV +P+QTGLK+ID+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INAKQFRPIESPAPGVIKRKSVHEPLQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKAS+VAGVV+ LEEHGA+++TIVV         L +IAPY
Sbjct: 181 DTIINQKGQNVICIYVAIGQKASTVAGVVKTLEEHGAMDYTIVVSATASEPAPLLYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYF  +G+ AL IYDDL+KQA AYR++SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFLYKGQHALCIYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A+++ EH             GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLE+DLF
Sbjct: 301 AAKLSDEH-----------GGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +GIRPAINAG+SVSRVGGAAQ K +K++ G +RL+LAQYRELAAFAQF SDLD+AT+ +
Sbjct: 350 FSGIRPAINAGISVSRVGGAAQIKAMKQVAGRLRLELAQYRELAAFAQFGSDLDKATQAR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQR+ E++KQ QY PM V +    +FAA  G+LDD+ V  +  FE     Y+R+   
Sbjct: 410 LNRGQRLVEILKQDQYKPMVVEEQVAVIFAAVNGYLDDIAVADVLKFEEGFLKYLRTEKA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           E+L +I +    SD++ A L+ AI  FK T
Sbjct: 470 EILKEIREKKALSDDLTARLKEAIGAFKKT 499


>ATPA_CARHZ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  615 bits (1587), Expect = e-178
 Identities = 304/510 (59%), Positives = 398/510 (78%), Gaps = 11/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + L   EI  +I+++IE ++   E  + GTV+ + DGI R++GL D M  E++EFPG   
Sbjct: 1   MNLRPEEIGSIIKQQIENYQVQVEVSSVGTVIQVGDGIARVYGLEDCMASELLEFPGGVL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VILGPY HI EGD  K TGR++ VPVGEAL+GRVV+ LG P+DG GP
Sbjct: 61  GMALNLEEDNVGCVILGPYTHIKEGDTVKRTGRVVSVPVGEALIGRVVNPLGQPLDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I      P+E++APGVITR+SV +P+QTG+K+IDSM+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IVTDKFRPVERIAPGVITRKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK T + CIYVAIGQKAS+VA VV+ L++HGA+++TIVV         L ++APY
Sbjct: 181 DTIINQKNTDVICIYVAIGQKASTVAKVVQTLKDHGAMDYTIVVSATASDPAPLLYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGE F ++G+  L++YDDL+KQA AYR++SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEEFMEQGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A+++ E+             GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LE+DLF
Sbjct: 301 AAKLSDEY-----------GGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AG+RPA+N GLSVSRVGGAAQ K +K++ G +RLDLAQYRELAAFAQF SDLD+AT  +
Sbjct: 350 YAGVRPAVNVGLSVSRVGGAAQIKAMKQVAGSLRLDLAQYRELAAFAQFGSDLDKATLAR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG+R+ EL+KQ QY PM V +  +++FAA  G+LDD+ V+K++ FE+    +MR+++ 
Sbjct: 410 LTRGERLVELLKQDQYKPMPVEEQVMAIFAAVNGYLDDLPVEKVRPFEAEFLKFMRANYP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           ++ ++I   G  +DE+ + L++AIE FK T
Sbjct: 470 QIGEEIRTKGVLTDELTSRLKSAIEEFKKT 499


>ATPA_SYMTH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 506

 Score =  603 bits (1555), Expect = e-174
 Identities = 305/508 (60%), Positives = 387/508 (76%), Gaps = 13/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EIS ++++ IE F  + E    G V+ + DGI R++GL   M  E++EFP    
Sbjct: 1   MSIRPEEISSILKQEIERFSTEIETSNVGRVIQVGDGIARVYGLQSCMASELLEFPNGIM 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A NLE D++G VILGP + I EG   + TGR++EVPVG AL+GRVV+ALG P+DG GP
Sbjct: 61  GMAFNLEEDNIGVVILGPDEDIKEGMEVRRTGRVVEVPVGPALIGRVVNALGEPLDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE     P+E+ APGVITR+SV +P+QTGLK+IDSM P+GRGQRELIIGDR TGKTA+A+
Sbjct: 121 IETDMYLPVERKAPGVITRKSVHEPLQTGLKAIDSMTPIGRGQRELIIGDRGTGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG    CIYV IGQKAS++AGVV+KL+E GA+E+TIVV         LQF+APY
Sbjct: 181 DTIINQKGQNCICIYVGIGQKASTIAGVVKKLQETGAMEYTIVVSATASDPAPLQFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGCAMGEYFRD G  ALI+YDDL+K A AYR++SLL+RRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCAMGEYFRDNGMHALIVYDDLSKHAVAYREMSLLMRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A+++ E+             GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 AAKMSDEY-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG+RPAIN G+SVSRVGGAAQ   +K++ G ++LDLAQYRELAAFAQF SDLD+AT+ +
Sbjct: 350 NAGVRPAINVGISVSRVGGAAQIDSMKRVSGTLKLDLAQYRELAAFAQFGSDLDKATQAR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           + RGQR TE++KQ QY P+ V    +S+FAA  G+LDD+E++++  FE  L  Y +++H 
Sbjct: 410 IIRGQRTTEILKQPQYHPLPVELQVLSIFAATNGYLDDLELEEVAAFEQELHTYFKANHP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ELL +I K  +   +I  E+RAA++ FK
Sbjct: 470 ELLARIPK--EKWKDIEPEVRAAVDAFK 495


>ATPA_BUCBP RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 514

 Score =  603 bits (1555), Expect = e-174
 Identities = 304/513 (59%), Positives = 403/513 (78%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +Q++++EI ELI K+I  F+  +    EG V+S++DGI++I+GL+DVM GEM+  PG+ Y
Sbjct: 1   MQISSSEICELISKKIAKFDIISSMHNEGRVISVSDGIIQIYGLSDVMQGEMLSLPGDKY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLE++ VGA+++G Y HI+EG +   TGRI E+PVG   LGRV++ALG+PIDG G 
Sbjct: 61  AIALNLEKNVVGAIVMGEYTHITEGTKIISTGRIFEIPVGSKFLGRVINALGVPIDGKGR 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+ +   P+E  APGVI RQ +S+P+QTG KSID+MVP+G+GQRELIIGDRQTGKT++AI
Sbjct: 121 IQEEKFLPVEINAPGVIDRQKISEPLQTGYKSIDAMVPIGKGQRELIIGDRQTGKTSLAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQ+ T IKCIYVAIGQK S++  +VR+LE++ AL HTIV+         LQ++ PY
Sbjct: 181 DTIINQRNTKIKCIYVAIGQKFSTIVNLVRQLEDNQALNHTIVIVXXXXXXXXLQYLVPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC++GE+FRD+G+DALI+YDDL+K A AYRQ+SLLLRRPPGREAFPGD+FYLH+RLLER
Sbjct: 241 SGCSLGEFFRDQGKDALIVYDDLSKHAIAYRQISLLLRRPPGREAFPGDIFYLHARLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           + RVN+ +++ +     K  TGSLTALPIIETQ GDVS+FIPTNVISITDGQIFLE++LF
Sbjct: 301 ACRVNSNYLKNILGTVNKFSTGSLTALPIIETQDGDVSSFIPTNVISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN G+SVSRVGGAAQ +II+KL  G+R  LAQY+EL AF+QF+S+LDE TR Q
Sbjct: 361 NSGIRPAINPGISVSRVGGAAQCQIIRKLSSGIRTSLAQYQELIAFSQFSSELDEITRNQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L  G+++ E++KQ QY PMS+ + A+ LFAA   FL+DV V++I  FE  L  +  +++ 
Sbjct: 421 LIHGKKLIEILKQKQYHPMSIAEQAIILFAAENNFLNDVSVEQIIKFEKMLLLFFNTNNS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTNTW 515
           EL+  I      +D +  +L   I  FK T  W
Sbjct: 481 ELVLSINNYKRINDVVENQLSDVINAFKLTKCW 513


>ATPA_ZYMMO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 509

 Score =  599 bits (1545), Expect = e-173
 Identities = 310/515 (60%), Positives = 389/515 (75%), Gaps = 19/515 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ AAEIS++IR++IEGF AD E    G V+S+ DGI R++GL  V  GEM+ F     
Sbjct: 1   MEIRAAEISKVIREQIEGFGADAEVSEVGRVISVGDGIARVYGLDKVEAGEMVTFSSGVQ 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VI G    + EGD  + TG+I++VPVG  LLGRVVDALG PIDG GP
Sbjct: 61  GMALNLEADNVGVVIFGSDLEVGEGDTVRRTGQIVDVPVGPELLGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A+     E++APG+I R+SV + VQTG+K++D++VPVGRGQRELIIGDRQTGKTA+AI
Sbjct: 121 INAKLRRRSEEMAPGIIPRKSVHEAVQTGIKALDALVPVGRGQRELIIGDRQTGKTAIAI 180

Query: 183 DAIINQKGTG--------IKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXX 234
           DA INQK           + CIYVAIGQK S+VA +VR+LEE GA+E++IVV        
Sbjct: 181 DAFINQKQVNSGSDNTKKLFCIYVAIGQKRSTVAQIVRQLEEMGAMEYSIVVAATASEPA 240

Query: 235 XLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFY 294
            LQ++ PY+ C+MGEYFRD  + ALI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFY
Sbjct: 241 PLQYLVPYSACSMGEYFRDNKQHALIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY 300

Query: 295 LHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQ 354
           LHSRLLER+A+++            K   GSLTALPIIETQAGDVSA+IPTNVISITDGQ
Sbjct: 301 LHSRLLERAAKMSD-----------KMGAGSLTALPIIETQAGDVSAYIPTNVISITDGQ 349

Query: 355 IFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASD 414
           IFLETDLF  GIRPAIN GLSVSRVG AAQTK +KK+ G ++L+LAQYRE+AAFAQF SD
Sbjct: 350 IFLETDLFYQGIRPAINVGLSVSRVGSAAQTKAMKKVAGSIKLELAQYREMAAFAQFGSD 409

Query: 415 LDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQ 474
           LD +T+K L RG+R+TEL+KQ Q+ PM   +  VSLFA   G++D +EV  +  +E A+ 
Sbjct: 410 LDASTQKLLNRGKRLTELLKQPQFHPMPFEEQVVSLFAGTNGYIDGIEVSDVNRYEEAML 469

Query: 475 GYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
            YMRSSH +LL  I +TGD+SDE  ++L AA++NF
Sbjct: 470 SYMRSSHNDLLATIRETGDFSDETKSKLTAALDNF 504


>ATPA_WIGBR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 510

 Score =  599 bits (1545), Expect = e-173
 Identities = 293/508 (57%), Positives = 393/508 (77%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +QL ++EISELI+ RI  F A++E + E             +GL ++M  EMI+ P  T+
Sbjct: 1   MQLRSSEISELIKYRISKFNAESEMQDEXXXXXXXXXXXXXYGLNNIMQNEMIKLPEKTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLE++ VGAV++G Y H+SEG +   TGRILEVP G  LLGRV++ALG P+D  G 
Sbjct: 61  AIALNLEKEIVGAVVMGSYFHLSEGMKVYSTGRILEVPTGNNLLGRVLNALGEPLDSKGD 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I     SPIE +APGVI R S+++P+QTG KSIDSMVP+G+GQRELIIGDRQTGK+++AI
Sbjct: 121 ILHDCFSPIETIAPGVIDRLSINEPLQTGYKSIDSMVPIGKGQRELIIGDRQTGKSSLAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK + IKCIYV+IGQK S+V   V KL+EH AL +TI+V         LQ++APY
Sbjct: 181 DTIINQKDSNIKCIYVSIGQKFSTVVKTVEKLKEHDALSNTIIVCATASDSAVLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC MGEYFRDRGED+LI+YDDL+KQA AYRQ+SLLLRRPPGREA+PGD+FYLHSRLLER
Sbjct: 241 SGCTMGEYFRDRGEDSLIVYDDLSKQAIAYRQISLLLRRPPGREAYPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SARVN  +VE  T+GKVK K+GSLTALPI+ETQ GD+S+F+PTN+ISITDGQIFLE++LF
Sbjct: 301 SARVNEIYVENFTKGKVKNKSGSLTALPIVETQGGDISSFVPTNLISITDGQIFLESNLF 360

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN G+SVSRVGG+AQT+II+KL G +R  LAQY EL++FAQF+SDLD++T+KQ
Sbjct: 361 NSGIRPAINPGISVSRVGGSAQTEIIRKLSGNIRTSLAQYNELSSFAQFSSDLDDSTKKQ 420

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L+ G+++ E++KQ QYSPMS+ + A+ LFA    +LD ++  +++ +E++L  +    + 
Sbjct: 421 LQHGEKIIEILKQKQYSPMSLSKQALLLFAVQNKYLDKIKSSEVEKYENSLLKHAEKKYS 480

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
             ++KI K+  Y D +  +L+  +++F+
Sbjct: 481 NYMEKINKSYIYDDFVIKKLKKIMDSFE 508


>ATPA_MOOTA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 507

 Score =  599 bits (1545), Expect = e-173
 Identities = 309/513 (60%), Positives = 390/513 (76%), Gaps = 12/513 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +++ +IE ++ + E    GTV  + DGI RI+GL   M GE++EFPG+ Y
Sbjct: 1   MSIRPDEITSILKNQIEQYQLEVEMAEVGTVTQVGDGIARIYGLDRAMAGELLEFPGDIY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGAVILGPY HI EGD+ K TGRI+EVPVGEAL+GRVV+A+G PIDG GP
Sbjct: 61  GMVLNLEEDNVGAVILGPYTHIKEGDQVKRTGRIVEVPVGEALIGRVVNAMGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+     P+E  APGV+ RQ V+ P+QTGLK+IDSMVP+GRGQRELIIGDRQTGKTA+A+
Sbjct: 121 IQTDKFRPVESPAPGVVYRQPVNTPLQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQKAS+VAGVV++LEE GA+E+TIVV         + +IAPY
Sbjct: 181 DTIINQKGQNVICIYVAIGQKASTVAGVVQRLEEAGAMEYTIVVMATASEPAPMLYIAPY 240

Query: 243 AGCAMGEYFR-DRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           AGC MGEYF  ++  D L +YDDL+K A AYR++SLLLRRPPGREA+PGDVFYLHSRLLE
Sbjct: 241 AGCTMGEYFMYEQHRDVLCVYDDLSKHAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLE 300

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR+N           + G  GSLTALP+IETQAGDVSA+IPTNVISITDGQIFLE+DL
Sbjct: 301 RAARLN---------DSLGG--GSLTALPVIETQAGDVSAYIPTNVISITDGQIFLESDL 349

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           F AG RPAIN GLSVSRVGGAAQ K +K++ G +RLDLAQYRELAAFAQF SDLD+AT+ 
Sbjct: 350 FYAGQRPAINVGLSVSRVGGAAQIKAMKQVAGRLRLDLAQYRELAAFAQFGSDLDKATQA 409

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           +L RG+R+ E++KQ QY PM V +  V L+AA  GFLDD+ V +++ FE     ++R+  
Sbjct: 410 RLARGERMMEILKQDQYQPMPVEEQVVVLYAAVNGFLDDLPVARVRAFEKDFLRFLRNER 469

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKTTNT 514
            E+L  I +     D +  +L+ +IE+FK + T
Sbjct: 470 PEVLAGIREKRQLDDNLQEQLKKSIEDFKGSFT 502


>ATPA_CLOPH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  598 bits (1541), Expect = e-173
 Identities = 305/508 (60%), Positives = 388/508 (76%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + L   EIS +I+++I+ +    E    GTV+ + DGI RIHGL + M GE++EFPG+ Y
Sbjct: 1   MNLRPEEISSVIKEQIKNYSMQLEVSDVGTVIQVADGIARIHGLENAMQGELLEFPGDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGAV+LG  ++I+EGD  K TGR++EVPVG+ALLGRVV+ALG PIDG GP
Sbjct: 61  GMVLNLEEDNVGAVLLGDMKNINEGDTVKTTGRVVEVPVGDALLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE +    IE+VA GVI R+SV  P+QTG+K+IDSMVP+GRGQRELIIGD+QTGKTA+AI
Sbjct: 121 IETKKYRQIERVASGVIARKSVDTPLQTGIKAIDSMVPIGRGQRELIIGDKQTGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  +KCIYVAIGQKAS+VA +V+ LEE+GAL++T VV         LQ+IAPY
Sbjct: 181 DTIINQKGQNVKCIYVAIGQKASTVANIVKTLEEYGALDYTTVVASTASELAPLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GCA+GE + + G+D L+IYDDLTK A AYR +SLLL+RPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGCAIGEEWMESGQDVLVIYDDLTKHAAAYRTLSLLLKRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +AR+N E         + G  GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LETD+F
Sbjct: 301 AARLNDE---------LGG--GSLTALPIIETQAGDVSAYIPTNVISITDGQIYLETDMF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAGLSVSRVGG+AQ K +KK+ G +R++LAQYRELAAFAQF SDLD  T+++
Sbjct: 350 NAGFRPAVNAGLSVSRVGGSAQIKAMKKIAGPIRIELAQYRELAAFAQFGSDLDADTKEK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L +G+R+ E++KQ QY PM V    + +FAA + +L D+EV KI+ FE  L  ++ + + 
Sbjct: 410 LAQGERIREILKQPQYKPMPVEYQVIIIFAATKKYLLDIEVSKIRSFEKELFEFIDTKYP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           E+   I       +E    L  AIENFK
Sbjct: 470 EIPASIRDKKVMDEECEKALITAIENFK 497


>ATPA_SULDN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  595 bits (1535), Expect = e-172
 Identities = 306/512 (59%), Positives = 389/512 (75%), Gaps = 11/512 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  ++ A EIS +I++RI+ FE   +    G +VS  DG+ +++GL++VM GEM+EF   
Sbjct: 1   MVAKIQADEISSIIKERIDNFELSVDINETGKIVSYADGVAQVYGLSNVMAGEMVEFEEG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
           T GL MNLE  +VG VILGP   + EG   K  GR+L VPVG+ALLGRVV+ALG PIDG 
Sbjct: 61  TRGLVMNLEESTVGVVILGPGPLLKEGMSVKRLGRLLRVPVGDALLGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIE   T  +E+ APG++ R+SV +P+ TG+K+ID++VP+GRGQRELIIGDRQTGKT V
Sbjct: 121 GPIETTETRFVEEKAPGIMARKSVHEPLATGIKAIDALVPIGRGQRELIIGDRQTGKTTV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           A+DAIINQKG G+ CIYVA+GQK S+VA ++R+LE+HGA+E+TIVV         LQF+A
Sbjct: 181 ALDAIINQKGNGVVCIYVAVGQKESTVAQIIRRLEDHGAMEYTIVVSSTXXXXXXLQFLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PY G  MGEYFRD     LI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFY+HSRLL
Sbjct: 241 PYTGVTMGEYFRDNARHGLIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYIHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A+V+ E              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLET+
Sbjct: 301 ERAAKVSDER-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETE 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFN+G+RPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDE +R
Sbjct: 350 LFNSGVRPAINVGLSVSRVGGAAQIKATKQVAGTLRLDLAQYRELQAFAQFASDLDETSR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQR+ E++KQ  +SP+SV +  + +FA NEGF DD+    +  FE+ L  ++ +S
Sbjct: 410 KQLERGQRMVEVLKQPPFSPLSVEKQVLIIFAGNEGFFDDMAPSNVVRFEAELYPFIEAS 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           + ++ + I  T    D   A ++ A+E FK +
Sbjct: 470 YPQIFENIRSTSKVDDNTNALMKKALEEFKAS 501


>ATPA_GEOLS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  594 bits (1531), Expect = e-172
 Identities = 303/508 (59%), Positives = 385/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++L A EISE+I+K+I  +  + E    GT++S+ DGI RIHGLA  M GE++EFPG   
Sbjct: 1   MELRAEEISEIIKKQINEYGKEVEVSETGTIISIGDGIARIHGLAGAMAGELLEFPGGVS 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGA ILG +  I EGD  K TGRI EVPVG+AL+GRVV+A+G PIDG GP
Sbjct: 61  GMVLNLEEDNVGAAILGEFAEIKEGDTVKRTGRITEVPVGDALVGRVVNAIGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I +   S +E  APG++ R+SV QP+ TGLK+IDSMVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 INSSTFSKVEIKAPGIVARKSVHQPMATGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+VA VV KL EHGA+++TIVV         LQFIAPY
Sbjct: 181 DTIINQKGGDVICIYVAIGQKRSTVAQVVSKLTEHGAMDYTIVVAATASESAPLQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGEYFRD  + ALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEYFRDNKKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           + +++ E              GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LE+DLF
Sbjct: 301 ACKLSDE-----------CGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAIN GLSVSRVGG+AQTK +K++ G +RL+LAQYRE+AAFAQF SDLD+AT+ Q
Sbjct: 350 FSGVRPAINVGLSVSRVGGSAQTKSMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG+R+ E++KQ QY P+   +  + +FAAN G+LDD  V  ++ +E+ L  +  +   
Sbjct: 410 LARGERLVEILKQPQYRPIPNEKQVLVIFAANNGYLDDYPVSALKKYETELYAFFDNRQA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++L ++ +     D++ A+L +A++ FK
Sbjct: 470 DVLTELREKQAIGDDLKAKLVSALDQFK 497


>ATPA_DEHE1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 503

 Score =  594 bits (1531), Expect = e-172
 Identities = 295/503 (58%), Positives = 386/503 (76%), Gaps = 12/503 (2%)

Query: 9   EISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNL 68
           +I  +I+++I+ F A     + G+V+ + DGI RIHGL++  + E++EFPG   G+A+NL
Sbjct: 7   DIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGLSNAKYNELLEFPGGVMGIALNL 66

Query: 69  ERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQAT 128
           E DSV AVILG   +I EGD  K TGRI E+ VG+ ++GRVVD LG P+DG GPI+A+  
Sbjct: 67  EEDSVAAVILGDDANIKEGDEVKATGRISEITVGKGMIGRVVDPLGRPLDGKGPIKAETV 126

Query: 129 SPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQ 188
            P+E++AP V+ R+SV+ PVQTG+K+ID+M+P+GRGQRELIIGDR TGKTA+A+D IINQ
Sbjct: 127 RPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIGRGQRELIIGDRSTGKTAIALDTIINQ 186

Query: 189 KGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMG 248
           KG  + CIYVAIGQKAS VA  V  LE++GA+EHTIVV         LQ++APYAGCA+G
Sbjct: 187 KGGDLVCIYVAIGQKASKVARTVALLEQYGAMEHTIVVAANSSDAVALQYLAPYAGCAIG 246

Query: 249 EYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNA 308
           E F ++G+DAL++YDDLTK AWAYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+AR+N 
Sbjct: 247 EEFMEQGQDALVVYDDLTKHAWAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAARLN- 305

Query: 309 EHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRP 368
                    K+ G  GSLTALPIIETQAGDVSA++PTNVISITDGQI+LE D+FN+GIRP
Sbjct: 306 --------DKLGG--GSLTALPIIETQAGDVSAYVPTNVISITDGQIYLEPDMFNSGIRP 355

Query: 369 AINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQF-ASDLDEATRKQLERGQ 427
           A+N G+SVSRVG +AQTK +KK+   +++D+ QYRELAAFAQF  S+LD+ATR QLERGQ
Sbjct: 356 AVNVGISVSRVGSSAQTKAMKKVASKLKMDMGQYRELAAFAQFGTSELDKATRMQLERGQ 415

Query: 428 RVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDK 487
           R+TE++KQ QY P+ +      L+AA  G+LD VEV K++DFES L  ++ ++   +L+ 
Sbjct: 416 RITEVLKQGQYQPVPMANQVAILYAALNGYLDSVEVAKVRDFESGLYRFLEANFASVLNN 475

Query: 488 ITKTGDYSDEIAAELRAAIENFK 510
           ITK    S E    L+ A++++K
Sbjct: 476 ITKENAISAETETALKTALDDYK 498


>ATPA_ERYLH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 509

 Score =  593 bits (1530), Expect = e-172
 Identities = 305/515 (59%), Positives = 384/515 (74%), Gaps = 19/515 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + AAEIS++I+ +I  F  + +    G+V+S+ DGI RIHGL +V  GEM+EF     
Sbjct: 1   MDIRAAEISKVIKDQIANFGTEAQVSEVGSVLSVGDGIARIHGLDNVQAGEMVEFANGVQ 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VI G    I EGD  K T  I++VPVG+ALLGRVVDALG PIDG GP
Sbjct: 61  GMALNLEADNVGVVIFGSDAEIKEGDNVKRTETIVDVPVGKALLGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE      +E  APG+I R+SV +PVQ+GLK+ID++VPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IETTERRRVELKAPGIIPRKSVDEPVQSGLKAIDALVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTG--------IKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXX 234
           D  INQK           + C+YVA+GQK S+VA +V+ LEE+GA+E++IVV        
Sbjct: 181 DTFINQKTVNESDDESKKLYCVYVAVGQKRSTVAQIVKSLEENGAMEYSIVVAATASEPA 240

Query: 235 XLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFY 294
            LQ++APY GCAMGE+FRD G  A+I+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFY
Sbjct: 241 PLQYLAPYTGCAMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY 300

Query: 295 LHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQ 354
           LHSRLLER+A++N ++             GSLTALPIIETQAGDVSA+IPTNVISITDGQ
Sbjct: 301 LHSRLLERAAKMNDDN-----------GGGSLTALPIIETQAGDVSAYIPTNVISITDGQ 349

Query: 355 IFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASD 414
           IFLETDLF  G+RPAIN GLSVSRVGGAAQTK +KK+ G ++L+LAQYRE+AAFAQF SD
Sbjct: 350 IFLETDLFYQGVRPAINVGLSVSRVGGAAQTKAMKKVSGSIKLELAQYREMAAFAQFGSD 409

Query: 415 LDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQ 474
           LD +T+K L RG R+TEL+KQ Q+SPM   +  VS+FA   G++DDV VD++ ++ES + 
Sbjct: 410 LDASTQKLLNRGARLTELLKQPQFSPMPFEEQTVSIFAGTNGYIDDVAVDRVTEYESQML 469

Query: 475 GYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
            +MRS H ++L  I  TG + D+  A   AA++ F
Sbjct: 470 SFMRSEHADILKTIRDTGKFEDDTKAATVAALDAF 504


>ATPA_PELPD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  591 bits (1524), Expect = e-171
 Identities = 299/508 (58%), Positives = 384/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ A EISE+I+K+I  +  + E    GT++S+ DGI RIHGL+  M GE++EFPG   
Sbjct: 1   MKIRAEEISEIIKKQIREYGKEVEVSETGTIISIGDGIARIHGLSGAMAGELLEFPGGVS 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGA +LG +  I EG   K TGRI EVPVGEAL+GRVV+A+G PIDG GP
Sbjct: 61  GMVLNLEEDNVGAAVLGEFTAIKEGHTVKRTGRIAEVPVGEALIGRVVNAIGEPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+    S +E  APG++ R+SV QP+ +GLK++D+MVP+GRGQRELIIGDRQTGKTAVA+
Sbjct: 121 IKTDTFSKVEIKAPGIVARKSVDQPMASGLKAVDAMVPIGRGQRELIIGDRQTGKTAVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+VA VV KL +HGA+++TIVV         LQFIAPY
Sbjct: 181 DTIINQKGGDVICIYVAIGQKRSTVAQVVAKLSDHGAMDYTIVVAASASESAPLQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +G  MGEYFRD+G+ ALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 SGVTMGEYFRDKGQHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           + +++ E              GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LE+DLF
Sbjct: 301 ACKLSDE-----------CGGGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAIN GLSVSRVGG AQTK +K++ G +RL+LAQYRE+AAFAQF SDLD+AT+ Q
Sbjct: 350 FSGVRPAINVGLSVSRVGGKAQTKSMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG+R+ E++KQ QY P+S  +  + +FAAN GFLD++ V  ++ +E  +  +  +   
Sbjct: 410 LARGERLVEILKQPQYRPLSNEKQVLIIFAANNGFLDELPVSTLRRYEDEMYAFFDNRQA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +LL ++       DE+   + AA+E FK
Sbjct: 470 DLLSELRDKKAIDDELKKRIVAALEQFK 497


>ATPA_DEHSC RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 503

 Score =  591 bits (1524), Expect = e-171
 Identities = 292/503 (58%), Positives = 387/503 (76%), Gaps = 12/503 (2%)

Query: 9   EISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNL 68
           +I  +I+++I+ F A     + G+V+ + DGI RIHGL++  + E++EFPG   G+A+NL
Sbjct: 7   DIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGLSNAKYNELLEFPGGVLGIALNL 66

Query: 69  ERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQAT 128
           E DSV AVILG   +I EGD  K TGRI E+ VG+ ++GRVVD LG P+DG GPI+A++T
Sbjct: 67  EEDSVAAVILGEDSNIKEGDEVKATGRISEITVGKGMIGRVVDPLGRPLDGKGPIKAEST 126

Query: 129 SPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQ 188
            P+E++AP V+ R+SV+ PVQTG+K+ID+M+P+GRGQRELIIGDR TGKTA+A+D IINQ
Sbjct: 127 RPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIGRGQRELIIGDRSTGKTAIALDTIINQ 186

Query: 189 KGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMG 248
           KG  + CIYVAIGQKAS VA +V  LE++GA+EHTIVV         LQ++APYAGCA+G
Sbjct: 187 KGGDLVCIYVAIGQKASKVARIVALLEQYGAMEHTIVVAANSSDAVALQYLAPYAGCAIG 246

Query: 249 EYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNA 308
           E F ++G+DAL++YDDLTK AWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLLER+AR+N 
Sbjct: 247 EEFMEQGKDALVVYDDLTKHAWAYRQLSLLLRRPPGREAYPGDLFYLHSRLLERAARLN- 305

Query: 309 EHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRP 368
                    K+ G  GSLTALPIIETQAGDVSA++PTNVISITDGQI+LE D+FNAGIRP
Sbjct: 306 --------DKLGG--GSLTALPIIETQAGDVSAYVPTNVISITDGQIYLEPDMFNAGIRP 355

Query: 369 AINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQF-ASDLDEATRKQLERGQ 427
           A+N G+SVSRVG +AQTK +KK+ G +++D+ QYRELAAFAQF  S+LD++TR QLERGQ
Sbjct: 356 AVNVGISVSRVGSSAQTKAMKKVAGKLKMDMGQYRELAAFAQFGTSELDKSTRMQLERGQ 415

Query: 428 RVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDK 487
           RVTE++KQ QY P+   +    L+A   G+LD++EV K++D+ES L  ++ ++   +L  
Sbjct: 416 RVTEVLKQGQYQPVPAAKQVAILYATLNGYLDNIEVGKVRDYESGLYRFLEANFASVLTA 475

Query: 488 ITKTGDYSDEIAAELRAAIENFK 510
           I K    S +    L+ A++ +K
Sbjct: 476 IAKENVISADTEKTLKTALDEYK 498


>ATPA_DEHSB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 503

 Score =  591 bits (1524), Expect = e-171
 Identities = 292/503 (58%), Positives = 387/503 (76%), Gaps = 12/503 (2%)

Query: 9   EISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNL 68
           +I  +I+++I+ F A     + G+V+ + DGI RIHGL++  + E++EFPG   G+A+NL
Sbjct: 7   DIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGLSNAKYNELLEFPGGVLGIALNL 66

Query: 69  ERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQAT 128
           E DSV AVILG   +I EGD  K TGRI E+ VG+ ++GRVVD LG P+DG GPI+A++T
Sbjct: 67  EEDSVAAVILGEDSNIKEGDEVKATGRISEITVGKGMIGRVVDPLGRPLDGKGPIKAEST 126

Query: 129 SPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQ 188
            P+E++AP V+ R+SV+ PVQTG+K+ID+M+P+GRGQRELIIGDR TGKTA+A+D IINQ
Sbjct: 127 RPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIGRGQRELIIGDRSTGKTAIALDTIINQ 186

Query: 189 KGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMG 248
           KG  + CIYVAIGQKAS VA +V  LE++GA+EHTIVV         LQ++APYAGCA+G
Sbjct: 187 KGGDLVCIYVAIGQKASKVARIVALLEQYGAMEHTIVVAANSSDAVALQYLAPYAGCAIG 246

Query: 249 EYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNA 308
           E F ++G+DAL++YDDLTK AWAYRQ+SLLLRRPPGREA+PGD+FYLHSRLLER+AR+N 
Sbjct: 247 EEFMEQGKDALVVYDDLTKHAWAYRQLSLLLRRPPGREAYPGDLFYLHSRLLERAARLN- 305

Query: 309 EHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRP 368
                    K+ G  GSLTALPIIETQAGDVSA++PTNVISITDGQI+LE D+FNAGIRP
Sbjct: 306 --------DKLGG--GSLTALPIIETQAGDVSAYVPTNVISITDGQIYLEPDMFNAGIRP 355

Query: 369 AINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQF-ASDLDEATRKQLERGQ 427
           A+N G+SVSRVG +AQTK +KK+ G +++D+ QYRELAAFAQF  S+LD++TR QLERGQ
Sbjct: 356 AVNVGISVSRVGSSAQTKAMKKVAGKLKMDMGQYRELAAFAQFGTSELDKSTRMQLERGQ 415

Query: 428 RVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDK 487
           RVTE++KQ QY P+   +    L+A   G+LD++EV K++D+ES L  ++ ++   +L  
Sbjct: 416 RVTEVLKQGQYQPVPAAKQVAILYATLNGYLDNIEVGKVRDYESGLYRFLEANFASVLTA 475

Query: 488 ITKTGDYSDEIAAELRAAIENFK 510
           I K    S +    L+ A++ +K
Sbjct: 476 IAKENVISADTEKTLKTALDEYK 498


>ATPA_DESHD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  590 bits (1522), Expect = e-171
 Identities = 300/490 (61%), Positives = 377/490 (76%), Gaps = 11/490 (2%)

Query: 21  FEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDSVGAVILGP 80
           +++  E    GTV+ + DGI R+HGL   M GE++EFPG  YG+AMNLE D++G +ILG 
Sbjct: 19  YDSAVEVVDVGTVIQVGDGIARVHGLEKAMSGELLEFPGGIYGMAMNLEEDNIGCIILGK 78

Query: 81  YQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT 140
           +  I EGD+ K TGRI+EVPVGEA++GRVV+ALG PIDG G I+     PIE +APGV+ 
Sbjct: 79  FTEIREGDQVKRTGRIVEVPVGEAMIGRVVNALGQPIDGKGEIKTDKFRPIENIAPGVVY 138

Query: 141 RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAI 200
           R+SV +P+QTGLKSID++VP+GRGQRELIIGDRQTGKTAVA+D IINQKG  + CIYVA+
Sbjct: 139 RKSVHEPLQTGLKSIDAIVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGKDVICIYVAV 198

Query: 201 GQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALI 260
           GQKAS+VAGVV+ L +HGA++++IVV         + +IAPY+GCAMGE F   G+  LI
Sbjct: 199 GQKASTVAGVVKTLADHGAMDYSIVVSATASEPAPMLYIAPYSGCAMGEEFMYNGKHVLI 258

Query: 261 IYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVK 320
           IYDDLTKQA AYR++SLLL+RPPGREA+PGDVFYLHSRLLER+A+++ +           
Sbjct: 259 IYDDLTKQAAAYRELSLLLKRPPGREAYPGDVFYLHSRLLERAAKLSPDL---------- 308

Query: 321 GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRVG 380
             +GS+TALPIIETQAGDVSA+IPTNVISITDGQIFLETDLFNAG RPAIN G+SVSRVG
Sbjct: 309 -GSGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGFRPAINVGISVSRVG 367

Query: 381 GAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTELMKQLQYSP 440
           G+AQ K +K++ G +RLDLAQYRELAAFAQF SDLD+ T+ +L RG+R+ E++KQ QY P
Sbjct: 368 GSAQIKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDKITQMRLTRGERMMEILKQKQYEP 427

Query: 441 MSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITKTGDYSDEIAA 500
           M V +  V L+AA +GFLDD+ VDKI+ FE      MR++  +LL KI      +DE+ A
Sbjct: 428 MVVEEQVVVLYAAVKGFLDDIPVDKIKSFEEEYLRTMRTTKADLLAKIRTEKALNDELNA 487

Query: 501 ELRAAIENFK 510
           E+  AI   K
Sbjct: 488 EIEKAITEVK 497


>ATPA_NITSB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  589 bits (1519), Expect = e-170
 Identities = 304/512 (59%), Positives = 384/512 (75%), Gaps = 11/512 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  +L A EIS +I++RIE FE   +    G V+S  DG+ ++ GL +VM GEM+EF   
Sbjct: 1   MAQKLQADEISSIIKERIEDFELKIDVEETGKVISFGDGVAKVFGLNNVMAGEMLEFDNG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE  +VG V+LG  + I EG   K  G++L+ PVGEAL+GRV++A+G PIDG 
Sbjct: 61  DKGMALNLEETNVGVVVLGRGEGIREGSSVKRLGQLLKAPVGEALVGRVINAIGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIEA     +E+ APG++ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT V
Sbjct: 121 GPIEATEYRYVEEKAPGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG  + CIYVA+GQK S+VA VV+KLEEHGA+++TIVV         LQF+A
Sbjct: 181 AIDTIINQKGQDVVCIYVAVGQKQSTVAQVVKKLEEHGAMDYTIVVNAGASEPAALQFLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PY G  +GEYFRD G+ ALI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYTGVTIGEYFRDNGKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A++N    +KL         GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLE+D
Sbjct: 301 ERAAKLN----DKL-------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESD 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFNAGIRPAIN G+SVSRVGGAAQ K +K++ G +RLDLAQYREL AFAQFASDLDEA+R
Sbjct: 350 LFNAGIRPAINVGISVSRVGGAAQIKAMKQVAGTLRLDLAQYRELEAFAQFASDLDEASR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERG R+ E++KQ  YSP+ V +  V ++A   GFLDD+EV  I  FE  L  ++ + 
Sbjct: 410 KQLERGMRMVEILKQPPYSPLPVEKQVVIIYAGANGFLDDIEVSAIGKFEYELYSFIEAK 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           + ++ + I +     DEI   L  AIE FK +
Sbjct: 470 YPQIFELIRERKALDDEIKELLNKAIEEFKAS 501


>ATPA_DESHY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  589 bits (1518), Expect = e-170
 Identities = 300/490 (61%), Positives = 376/490 (76%), Gaps = 11/490 (2%)

Query: 21  FEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDSVGAVILGP 80
           +++  E    GTV+ + DGI R+HGL   M GE++EFPG  YG+AMNLE D++G +ILG 
Sbjct: 19  YDSAVEVVDVGTVIQVGDGIARVHGLEKAMSGELLEFPGGIYGMAMNLEEDNIGCIILGK 78

Query: 81  YQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT 140
           +  I EGD+ K TGRI+EVPVGEA++GRVV+ALG PIDG G I+     PIE  APGV+ 
Sbjct: 79  FTEIREGDQVKRTGRIVEVPVGEAMIGRVVNALGQPIDGKGEIKTDKFRPIENTAPGVVY 138

Query: 141 RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAI 200
           R+SV +P+QTGLKSID++VP+GRGQRELIIGDRQTGKTAVA+D IINQKG  + CIYVA+
Sbjct: 139 RKSVHEPLQTGLKSIDAIVPIGRGQRELIIGDRQTGKTAVAVDTIINQKGKDVICIYVAV 198

Query: 201 GQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALI 260
           GQKAS+VAGVV+ L +HGA++++IVV         + +IAPY+GCAMGE F   G+  LI
Sbjct: 199 GQKASTVAGVVKTLADHGAMDYSIVVSATASEPAPMLYIAPYSGCAMGEEFMYNGKHVLI 258

Query: 261 IYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVK 320
           IYDDLTKQA AYR++SLLL+RPPGREA+PGDVFYLHSRLLER+A+++ +           
Sbjct: 259 IYDDLTKQAAAYRELSLLLKRPPGREAYPGDVFYLHSRLLERAAKLSPDL---------- 308

Query: 321 GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRVG 380
             +GS+TALPIIETQAGDVSA+IPTNVISITDGQIFLETDLFNAG RPAIN G+SVSRVG
Sbjct: 309 -GSGSMTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLFNAGFRPAINVGISVSRVG 367

Query: 381 GAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTELMKQLQYSP 440
           G+AQ K +K++ G +RLDLAQYRELAAFAQF SDLD+ T+ +L RG+R+ E++KQ QY P
Sbjct: 368 GSAQIKAMKQVAGQLRLDLAQYRELAAFAQFGSDLDKITQMRLTRGERMMEILKQKQYEP 427

Query: 441 MSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITKTGDYSDEIAA 500
           M V +  V L+AA +GFLDD+ VDKI+ FE      MR++  +LL KI      +DE+ A
Sbjct: 428 MVVEEQVVVLYAAVKGFLDDIPVDKIKSFEEDYLRTMRTTKADLLAKIRTEKALNDELNA 487

Query: 501 ELRAAIENFK 510
           E+  AI   K
Sbjct: 488 EIEKAITEVK 497


>ATPA_SOLUE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 512

 Score =  588 bits (1516), Expect = e-170
 Identities = 295/506 (58%), Positives = 383/506 (75%), Gaps = 11/506 (2%)

Query: 5   LNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGL 64
           + A EI+ ++R+ IE +E   +    G+V+S+ DGI RIHGL  VM GE+IEFP +  G+
Sbjct: 4   IRADEITSILRQEIENYERAIDVSEVGSVISVGDGIARIHGLEKVMAGELIEFPHDVAGI 63

Query: 65  AMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIE 124
           AMNLE D VGAV+LG Y  I EGD  K T RI+ VPVGEAL+GRVV+ALG PIDG GPI 
Sbjct: 64  AMNLEEDQVGAVLLGDYTLIKEGDEVKRTKRIMSVPVGEALIGRVVNALGQPIDGKGPIN 123

Query: 125 AQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDA 184
           A   +PIE++APGV+ RQ V +P+ TG+K++D+M+P+GRGQRELIIGDRQTGKTA+A+DA
Sbjct: 124 ATQFNPIERLAPGVVARQPVKEPMMTGIKAVDAMIPIGRGQRELIIGDRQTGKTAIALDA 183

Query: 185 IINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAG 244
           IINQKG  + CIYVAIGQK S+VA VV+ LE++GA+E++IVV         +Q++AP++G
Sbjct: 184 IINQKGGDMICIYVAIGQKRSTVAQVVKTLEDNGAMEYSIVVVASASDPAPMQYLAPFSG 243

Query: 245 CAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSA 304
           CA+GEYFRD    AL IYDDL+K A AYR++SLLLRRPPGREAFPGDVFYLHSRLLER+A
Sbjct: 244 CAIGEYFRDSKRHALCIYDDLSKHAAAYREISLLLRRPPGREAFPGDVFYLHSRLLERAA 303

Query: 305 RVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNA 364
           ++N EH             GSLTALP IETQAGDVSA+IPTNVISITDGQIFLE DLFN+
Sbjct: 304 KLNNEH-----------GAGSLTALPFIETQAGDVSAYIPTNVISITDGQIFLEADLFNS 352

Query: 365 GIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLE 424
             RPAIN G+SVSRVGG AQTK +K + GG+RLDLAQYRELAAFAQF SDLD++++ QL 
Sbjct: 353 NQRPAINVGISVSRVGGNAQTKAMKSIAGGLRLDLAQYRELAAFAQFGSDLDKSSQAQLN 412

Query: 425 RGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGEL 484
           RG+ + E++KQ QY P+ + +  + ++A  +G+LDD+ V+  + FE+ L  +  ++H  +
Sbjct: 413 RGRHLVEILKQDQYQPLPLEKQIMIIWAGTKGYLDDIPVELCRKFEAELYRFSENAHRPV 472

Query: 485 LDKITKTGDYSDEIAAELRAAIENFK 510
           LD+I        ++ A+++  +E FK
Sbjct: 473 LDEIKTKKALDPDLTAKVKGIVEEFK 498


>ATPA_GEOBB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  587 bits (1514), Expect = e-170
 Identities = 301/508 (59%), Positives = 377/508 (74%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ A EISE+IRK+I+ +  +      GT++S+ DGI RIHGL   M GE++EFPG   
Sbjct: 1   MEIKAEEISEIIRKQIKEYGTEVAVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGIT 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGA ILG +  I EGD  K TG+I+EVPVG AL+GRVVDA+G PIDG GP
Sbjct: 61  GMVLNLEEDNVGAAILGEFSEIKEGDSVKLTGKIVEVPVGPALIGRVVDAIGNPIDGLGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I       +E  APG++ R+SV QP+QTGLK+IDSMVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 INTDTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+VA VV KL+EHGA+++TIVV         LQFIAPY
Sbjct: 181 DTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLKEHGAMDYTIVVAATASEPAPLQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGE+FRD G+ ALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEFFRDSGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           + +V+ +              GSLTALP+IETQAGDVSA+IPTNVISITDGQI+LE+DLF
Sbjct: 301 ACKVSDD-----------CGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIYLESDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAIN GLSVSRVGG+AQ K +K++ G +RL LAQYRE+AAFAQF SDLD+AT+ Q
Sbjct: 350 YSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLALAQYREMAAFAQFGSDLDKATQMQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R+ E++KQ QY P+   +  + +FAAN GF+DD  +  +  +E+ L  +  S   
Sbjct: 410 LARGARLVEILKQPQYRPIPNEKQVLIIFAANNGFVDDYPIGSLGRYETELYAFFDSRKA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            LL ++       D +  E+ A++E FK
Sbjct: 470 TLLGELRDKKAIDDAMKGEIIASLEEFK 497


>ATPA_SYNWW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  587 bits (1513), Expect = e-170
 Identities = 299/512 (58%), Positives = 385/512 (75%), Gaps = 13/512 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EIS +++++IE ++++ E    G+V+ + DGI R++GL   M GE++EF G T+
Sbjct: 1   MSIRPEEISAILKEQIERYQSEVEVSNVGSVIYVGDGIARVYGLQGAMAGELLEFTGGTF 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGAV+LG Y HI EGD  K TGRI+EVP G A+LGRVV+ALG PIDG GP
Sbjct: 61  GMVLNLEEDNVGAVLLGEYNHIKEGDVVKATGRIMEVPAGSAMLGRVVNALGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I   A  P+EKVA GV+TRQ V+ P+QTGLK+IDSMVP+GRGQRELIIGDRQ GKTA+A+
Sbjct: 121 INTTAFRPLEKVAHGVVTRQPVTTPMQTGLKAIDSMVPIGRGQRELIIGDRQIGKTAIAL 180

Query: 183 DAIINQK-GTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           D+IINQ+    + CIYVA+GQK +S+AG+  K EE GA+++TI+V         L ++AP
Sbjct: 181 DSIINQREKKDLICIYVAVGQKQASIAGIAAKFEEMGAMDYTIIVAATASEPAPLLYMAP 240

Query: 242 YAGCAMGEYFRD-RGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           YAG AM E F +  G+D LIIYDDL+K A AYR++SLLLRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 YAGVAMAEEFMEAEGKDVLIIYDDLSKHAVAYREMSLLLRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+ R+N +H             GS+TALPIIETQAGDVSA+IPTNVISITDGQI+LE D
Sbjct: 301 ERACRLNPDH-----------GGGSITALPIIETQAGDVSAYIPTNVISITDGQIYLEAD 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           +FNAG RPA+NAGLSVSRVGG+AQTK +K + G +RLDLAQYRELAAFAQF SDLD+AT 
Sbjct: 350 MFNAGQRPAVNAGLSVSRVGGSAQTKAMKSVAGQLRLDLAQYRELAAFAQFGSDLDKATL 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
            +L RG+RVTE++KQ QY PM V +  VS+++   G+LDD+  DK+ +FE     +MRS+
Sbjct: 410 ARLTRGERVTEILKQGQYQPMPVQEQVVSIYSGVNGYLDDIPRDKVGEFEVDFLKFMRSA 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           + ++L+ I  TG   D    +L  AI  FK+T
Sbjct: 470 NADVLNAIKDTGKIDDATEQKLIKAINEFKST 501


>ATPA_GEOSM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  586 bits (1510), Expect = e-169
 Identities = 300/508 (59%), Positives = 377/508 (74%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ A EISE+IRK+I+ +  +      GT++S+ DGI RIHGL   M GE++EFPG   
Sbjct: 1   MEIKAEEISEIIRKQIKEYGTEVAVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGIT 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+ +NLE D+VGA ILG +  I EGD  K TG+I+EVPVG AL+GRVVDA+G PIDG GP
Sbjct: 61  GMVLNLEEDNVGAAILGEFSEIKEGDSVKLTGKIVEVPVGPALIGRVVDAIGNPIDGLGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I       +E  APG++ R+SV QP+QTGLK+IDSMVP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 INTDTFGKVEVKAPGIVKRKSVHQPMQTGLKAIDSMVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+VA VV KL+EHGA+++TIVV         LQFIAPY
Sbjct: 181 DTIINQKGGDVVCIYVAIGQKRSTVAQVVSKLKEHGAMDYTIVVAATASEPAPLQFIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGE+FRD G+ ALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEFFRDSGKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           + +V+ +              GSLTALP+IETQAGDVSA+IPTNVISITDGQI+LE+DLF
Sbjct: 301 ACKVSDD-----------CGAGSLTALPVIETQAGDVSAYIPTNVISITDGQIYLESDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAIN GLSVSRVGG+AQ K +K++ G +RL LAQYRE+AAFAQF SDLD+AT+ Q
Sbjct: 350 YSGVRPAINVGLSVSRVGGSAQVKAMKQVAGTLRLALAQYREMAAFAQFGSDLDKATQMQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R+ E++KQ QY P+   +  + +FAAN GF+D+  +  +  +E+ L  +  S   
Sbjct: 410 LARGARLVEILKQPQYRPIPNEKQVLIIFAANNGFVDEYPIGSLGRYETELYAFFDSRKA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
            LL ++       D +  E+ A++E FK
Sbjct: 470 TLLGELRDKKAIDDAMKGEIIASLEEFK 497


>ATPA1_SYNAS RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 504

 Score =  586 bits (1510), Expect = e-169
 Identities = 298/505 (59%), Positives = 381/505 (75%), Gaps = 11/505 (2%)

Query: 5   LNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGL 64
           + A EIS++I K+I  +E   +    GTV+S+ DGI RI+G+ + M  E++EFPG   G+
Sbjct: 4   IKAEEISQIISKQIRDYEKKLDVSETGTVLSVGDGIARIYGVENAMAMELLEFPGGIMGM 63

Query: 65  AMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIE 124
            +NLE D+VG  +LG   HI EGD  K TG+I ++PVGEALLGRV+DA G PIDG GP+ 
Sbjct: 64  VLNLEADNVGVAVLGDVTHIKEGDIVKRTGKIAQIPVGEALLGRVIDATGEPIDGKGPLG 123

Query: 125 AQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDA 184
           A   S IE +APGVI RQ V++P+ TGLK+ID+M P+GRGQRELIIGDRQ GKTA+ IDA
Sbjct: 124 ATEFSRIEMIAPGVIKRQPVNEPMYTGLKAIDAMTPIGRGQRELIIGDRQIGKTAIGIDA 183

Query: 185 IINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAG 244
           II QK TG+KCIYVAIGQK S+V+ +V  L +H A+ +T VV         LQ+IA YAG
Sbjct: 184 IIRQKDTGVKCIYVAIGQKKSTVSQIVENLRKHDAMSYTCVVAGCASDPATLQYIAAYAG 243

Query: 245 CAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSA 304
           C++GEYFRDRG+DALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGD+FY HSRLLERSA
Sbjct: 244 CSIGEYFRDRGQDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDIFYNHSRLLERSA 303

Query: 305 RVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNA 364
           RV+A+         + G  GSLTALPIIETQAGDVSA+IPTNVISITDGQ++LE  LF +
Sbjct: 304 RVSAD---------LGG--GSLTALPIIETQAGDVSAYIPTNVISITDGQVYLEPSLFFS 352

Query: 365 GIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLE 424
           GIRPAIN GLSVSRVGGAAQ K +K++ G ++LDLAQYRELA+FAQF SDLD+AT+ QL+
Sbjct: 353 GIRPAINVGLSVSRVGGAAQVKAMKQVAGTLKLDLAQYRELASFAQFGSDLDKATQAQLD 412

Query: 425 RGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGEL 484
           RG R+ E++KQ Q+ PMS+ +  + LFA   GFLD  EV+KI+++E  +  YM+S H ++
Sbjct: 413 RGVRLVEILKQPQFQPMSLAEEVIVLFAGTRGFLDKYEVEKIKEYEPQVLAYMKSKHQDI 472

Query: 485 LDKITKTGDYSDEIAAELRAAIENF 509
           + +I      S E+  +++ A+  F
Sbjct: 473 MQEIDDKKVISPELEQKIKEALTAF 497


>ATPA_ALKOO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  581 bits (1498), Expect = e-168
 Identities = 298/490 (60%), Positives = 373/490 (76%), Gaps = 11/490 (2%)

Query: 21  FEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDSVGAVILGP 80
           +E   E +  GTV+ + DGI RIHGL   M GE++EFP   YG+A NLE D+VG V+LG 
Sbjct: 19  YENKLEVKDVGTVIQVGDGIARIHGLEKCMAGELLEFPNAVYGMAQNLEEDNVGCVLLGS 78

Query: 81  YQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT 140
              I EGD  K TGRI+EVPVGEALLGRVV+ALG PIDG GPI   A   +E+VAPG+I+
Sbjct: 79  DATIREGDIVKRTGRIVEVPVGEALLGRVVNALGQPIDGKGPINTDAYREVERVAPGIIS 138

Query: 141 RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAI 200
           R+SV +P+QTG+K+IDSM+P+GRGQRELIIGDRQTGKTA+AID IINQK T + CIYVAI
Sbjct: 139 RKSVHEPLQTGIKAIDSMIPIGRGQRELIIGDRQTGKTALAIDTIINQKNTDVICIYVAI 198

Query: 201 GQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALI 260
           GQK S+VA +   LE+ GA+E+TI+V         LQ++APYAGCAMGE F ++G+  LI
Sbjct: 199 GQKKSTVAQIKDSLEKAGAMEYTIIVSSTADELAPLQYLAPYAGCAMGEEFMEKGKHVLI 258

Query: 261 IYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVK 320
           IYDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER+A+++ E           
Sbjct: 259 IYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDER---------- 308

Query: 321 GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRVG 380
              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLET+LFNAGIRPA+N G+SVSRVG
Sbjct: 309 -GGGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETELFNAGIRPAVNPGISVSRVG 367

Query: 381 GAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTELMKQLQYSP 440
           G AQ K +KK+ G +RL+LAQYRELAAFAQF SDLD+ T+++L +G+R+ E++KQ QY P
Sbjct: 368 GNAQIKAMKKVAGTLRLELAQYRELAAFAQFGSDLDKETQERLSQGERILEILKQPQYDP 427

Query: 441 MSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITKTGDYSDEIAA 500
           M V +  + ++A  + +L D+ V+ I+DFES    +M + H E+   I  TG  S+E  A
Sbjct: 428 MPVEKQIMMIYATTKKYLTDIAVEDIRDFESGFLRFMDNEHPEVGKDIVATGSISEETEA 487

Query: 501 ELRAAIENFK 510
           +L+ AIE+FK
Sbjct: 488 KLKEAIESFK 497


>ATPA1_PELCD RecName: Full=ATP synthase subunit alpha 1;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           1;AltName: Full=ATP synthase F1 sector subunit alpha 1;
          Length = 502

 Score =  581 bits (1498), Expect = e-168
 Identities = 295/489 (60%), Positives = 371/489 (75%), Gaps = 11/489 (2%)

Query: 21  FEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDSVGAVILGP 80
           F+ + E    GT++S+ DGI RIHGL   M GE++EFPG+  G+ +NLE D+VGA ILG 
Sbjct: 19  FDREIEISEMGTIISVGDGIARIHGLNRAMAGELLEFPGDVIGMVLNLEEDNVGAAILGD 78

Query: 81  YQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT 140
             HI EGD  + TGRI+EVPVGEAL+GRVV+ +G PIDGGG +E      +E  APG++T
Sbjct: 79  THHIKEGDSVRRTGRIVEVPVGEALIGRVVNGIGQPIDGGGALEGAEARQVEIKAPGIVT 138

Query: 141 RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAI 200
           R+SV QPVQTGLK+ID++VP+GRGQRELIIGDRQTGKTA+AIDAIINQKG  + CIYVAI
Sbjct: 139 RKSVHQPVQTGLKAIDALVPIGRGQRELIIGDRQTGKTALAIDAIINQKGQDMVCIYVAI 198

Query: 201 GQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRGEDALI 260
           GQK S+VA VV KL++HGA+++TIVV         LQFIAPYAG  MGEYFRD G  ALI
Sbjct: 199 GQKQSTVAQVVDKLKQHGAMDYTIVVSAGASEPAPLQFIAPYAGVTMGEYFRDNGRHALI 258

Query: 261 IYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVK 320
           +YDDL+K A AYRQ+SLLLRRPPGREAFPGDVFYLHSRLLER+A++N E         + 
Sbjct: 259 VYDDLSKHAVAYRQLSLLLRRPPGREAFPGDVFYLHSRLLERAAKLNDE---------LG 309

Query: 321 GKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRVG 380
           G  GSLTALPIIETQAGD+S++IPTNVISITDGQIFLE DLF +G+RPAIN GLSVSRVG
Sbjct: 310 G--GSLTALPIIETQAGDLSSYIPTNVISITDGQIFLEADLFYSGVRPAINVGLSVSRVG 367

Query: 381 GAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTELMKQLQYSP 440
           G+AQ K +K++ G +RL LAQYRE+AAFAQF SDLD AT+KQL RG R+ E++KQ QY P
Sbjct: 368 GSAQVKAMKQVAGTLRLSLAQYREMAAFAQFGSDLDAATQKQLARGARLVEILKQPQYQP 427

Query: 441 MSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITKTGDYSDEIAA 500
           + V +  + ++AAN G++DD  +  ++ +E  L  ++   HG+LL  + +      ++ A
Sbjct: 428 LPVEKQILVIYAANNGYVDDYPLTVLRRYEEELYSFLEHRHGDLLKDLAEKKAIDTDLEA 487

Query: 501 ELRAAIENF 509
            ++A +  F
Sbjct: 488 RIKAVLAAF 496


>ATPA_CAMFF RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  580 bits (1496), Expect = e-168
 Identities = 299/512 (58%), Positives = 380/512 (74%), Gaps = 11/512 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M ++L A EIS +I++RIE +    +    G V+S+ DG+  ++GL +VM GEM+EF   
Sbjct: 1   MSVKLKADEISSIIKERIENYNLSVDIEETGKVISVADGVANVYGLKNVMAGEMVEFETG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE  SVG V+LG    I EG   K  G++L VPVG+AL+GRVV+ALG PID  
Sbjct: 61  EKGMALNLEESSVGIVVLGKSSSIKEGSSVKRLGKLLRVPVGDALIGRVVNALGEPIDAK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G IEA  T  IE+ A G++ R+SV +P+QTG+K+ID +VP+GRGQRELIIGDRQTGKT V
Sbjct: 121 GAIEATETRFIEEKAKGIMARKSVHEPLQTGIKAIDGLVPIGRGQRELIIGDRQTGKTTV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG  + CIYVAIGQK S+VA VV+KLEE+GA+++TIVV         LQ++A
Sbjct: 181 AIDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNASASDAPALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAG  MGEYFRD    ALIIYDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGVTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+++++    +KL         GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLE+D
Sbjct: 301 ERASKLS----DKL-------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESD 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFN+GIRPAIN GLSVSRVGG+AQ K IKK+ G +RLDLAQYREL AFAQFASDLDE++R
Sbjct: 350 LFNSGIRPAINVGLSVSRVGGSAQIKAIKKVSGTLRLDLAQYRELQAFAQFASDLDESSR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQR+ E++KQ  YSP+ V    + ++A ++G+LDD+ V  +  FE+ L  Y+ + 
Sbjct: 410 KQLERGQRMVEVLKQPPYSPLPVENQVIIIYAGSQGYLDDIPVSAVTKFEAELYPYIEAK 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           + E+ ++I        +I   L  A+  FK T
Sbjct: 470 YPEIFEQIRNKKALDKDIEEALSKALNEFKAT 501


>ATPA_BACHD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  580 bits (1495), Expect = e-168
 Identities = 303/508 (59%), Positives = 377/508 (74%), Gaps = 13/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EIS LI+++IE F++D + +  GTV+ + DGI   HGL  VM GE++EF     
Sbjct: 1   MSIKPEEISSLIKQQIENFQSDVQVQDVGTVIRVGDGIALAHGLESVMAGELLEFSNGVM 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A NLE ++VG +ILGPY  I EGD  K TGRI+EVPVGE LLGRVV+ LG PIDG GP
Sbjct: 61  GMAQNLEENNVGIIILGPYSEIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQPIDGRGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE   T PIE  APGV+ R+SV +P+QTG+KSIDSM+PVGRGQRELIIGDRQTGKT++AI
Sbjct: 121 IETSKTRPIESPAPGVMDRKSVHEPLQTGIKSIDSMIPVGRGQRELIIGDRQTGKTSIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK   + CIYVAIGQK S+VAGVV  L +HGAL++TIVV         L F+APY
Sbjct: 181 DTIINQKDQDMICIYVAIGQKESTVAGVVETLRQHGALDYTIVVSASASEPAPLLFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG +MGE F   G+  L++YDDLTKQA AYR++SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGVSMGEEFMYNGKHVLVVYDDLTKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GS+TALP IETQAGDVSA+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GGGSITALPFIETQAGDVSAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPA+NAGLSVSRVGG+AQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 350 YSGVRPAVNAGLSVSRVGGSAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQR  E++KQ  + P+ V +    ++A   GFLDD+ V  ++ FES L  ++  +  
Sbjct: 410 LNRGQRTVEVLKQGLHEPLPVEKQVAIIYALINGFLDDIPVGDVRRFESELFTFLDHNKK 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ELLD I  TG+  D+  +E +AAI  FK
Sbjct: 470 ELLDHIRTTGNLPDD--SEFKAAITEFK 495


>ATPA_CAMC5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  580 bits (1494), Expect = e-167
 Identities = 297/512 (58%), Positives = 380/512 (74%), Gaps = 11/512 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  ++ A EIS +I++RIE F+   +    G V+S+ DG+  ++GL ++M GEM+EF G 
Sbjct: 1   MSAKIKADEISAIIKERIENFDLSVDVEETGKVISVADGVANVYGLKNIMAGEMVEFEGG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE  SVG VILG    I+EG   K   ++L VPVG+AL+GRVV++LG PID  
Sbjct: 61  EKGMALNLEESSVGIVILGKTSGITEGSSVKRLKKLLRVPVGDALIGRVVNSLGEPIDAK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIEA  T  +E+ A G++ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT V
Sbjct: 121 GPIEATETRFVEEKAKGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG  + CIYVAIGQK S+VA VV+KLEE+GA+++TIVV         LQ++A
Sbjct: 181 AIDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNAGASDTAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAG  MGEYFRD    ALIIYDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGVTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER++++N                GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLE+D
Sbjct: 301 ERASKLNDAL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESD 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFN+GIRPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDE++R
Sbjct: 350 LFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGNLRLDLAQYRELQAFAQFASDLDESSR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQ++ E++KQ  YSP+ V    V +FA ++G+LDD+    +  FE+ L  Y+ + 
Sbjct: 410 KQLERGQKMVEVLKQPPYSPLPVENQVVIIFAGSKGYLDDIAAASVTKFEAELYPYIEAK 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           + E+ ++I        EI   L  A+++FK T
Sbjct: 470 YPEIFEQIRTKKVLDKEIEELLHKALKDFKAT 501


>ATPA_NOVAD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 509

 Score =  578 bits (1490), Expect = e-167
 Identities = 302/515 (58%), Positives = 379/515 (73%), Gaps = 19/515 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ AAEIS++I+ +I  F  + +    G+V+S+ DGI RIHGL  V  GEM+EF     
Sbjct: 1   MEIRAAEISKVIKDQIASFGTEAQVSEVGSVLSVGDGIARIHGLDKVQAGEMVEFSNGVK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VI G    I EGD  K TG I++VPVG+ LLGRVVDALG PIDG GP
Sbjct: 61  GMALNLEADNVGVVIFGSDSEIKEGDVVKRTGTIVDVPVGKGLLGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I       +E  APG+I R+SV +PVQTGLK+ID++VPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IVDATRQRVEVKAPGIIPRKSVHEPVQTGLKAIDALVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQK--------GTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXX 234
           D  INQK        G  + CIYVA+GQK S+VA +VR+LEE+GA+E++IVV        
Sbjct: 181 DTFINQKAVNAGTDEGKKLYCIYVAVGQKRSTVAQIVRQLEENGAMEYSIVVAATASEPA 240

Query: 235 XLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFY 294
            LQ++APY G  MGE+FRD G  A+I+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFY
Sbjct: 241 PLQYLAPYTGATMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY 300

Query: 295 LHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQ 354
           LHSRLLER+A++N E+             GSLTALPIIETQAGDVSA+IPTNVISITDGQ
Sbjct: 301 LHSRLLERAAKMNDEN-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQ 349

Query: 355 IFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASD 414
           IFLET LF  GIRPAIN GLSVSRVG +AQTK +KK+ G ++L+LAQYRE+AAFAQF SD
Sbjct: 350 IFLETGLFYQGIRPAINVGLSVSRVGSSAQTKAMKKVAGSIKLELAQYREMAAFAQFGSD 409

Query: 415 LDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQ 474
           LD +T+K L RG R+TEL+KQ Q+SP+   +    +FA  +G+LD V V+++ ++E+ L 
Sbjct: 410 LDASTQKLLNRGARLTELLKQPQFSPLGFEEQTCVIFAGTQGYLDAVPVNRVTEYEAELL 469

Query: 475 GYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
            ++RS H +LL  I  T D  DE   +L AA++ F
Sbjct: 470 SFLRSQHADLLGLIRDTKDLGDEAKGKLVAALDAF 504


>ATPA_CHLPD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 526

 Score =  577 bits (1487), Expect = e-167
 Identities = 294/517 (56%), Positives = 381/517 (73%), Gaps = 9/517 (1%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   +   E+S ++RK++ GFE++ +    GTV+ + DGI R++GL+    GE++EFP  
Sbjct: 1   MSTTVRPDEVSSILRKQLAGFESEADVYDVGTVLQVGDGIARVYGLSKAAAGELLEFPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE D+VGAV+ G    + EGD  K TG +  +PVGEA+LGRV++ LG PIDG 
Sbjct: 61  VMGMALNLEEDNVGAVLFGESNLVKEGDTVKRTGILASIPVGEAMLGRVINPLGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIE Q   P+E+ APGVI R+SV +P+QTGLK+IDSM+P+GRGQRELIIGDRQTGKTAV
Sbjct: 121 GPIETQIRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG G+ CIYVAIG K S+VA VV  LE+ GA+E+T V+         LQFIA
Sbjct: 181 AIDTIINQKGKGVFCIYVAIGLKGSTVAQVVNTLEKFGAMEYTTVITATASDPAPLQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           P+AG  +GEYFRD G  AL++YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PFAGATLGEYFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARV--NAEHVEKLTE------GKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITD 352
           ER+A++  + E   K+ +        VKG  GSLTALP+IETQAGDVSA+IPTNVISITD
Sbjct: 301 ERAAKITDDIEVARKMNDLPDALKSMVKG-GGSLTALPVIETQAGDVSAYIPTNVISITD 359

Query: 353 GQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFA 412
           GQIFLE++LFN+G RPAIN G+SVSRVGG+AQ K +KK+ G +RLDLAQ+REL AF++F 
Sbjct: 360 GQIFLESNLFNSGQRPAINVGISVSRVGGSAQIKAMKKVAGTLRLDLAQFRELEAFSKFG 419

Query: 413 SDLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESA 472
           SDLD+ T+ QL+RG R+ E++KQ QY PM+V +    +F   +G LD V+V +I+ FE  
Sbjct: 420 SDLDKTTKAQLDRGARLVEILKQGQYIPMAVEKQVAIIFLGTQGLLDAVDVTRIRKFEEE 479

Query: 473 LQGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
             G +   H E+L  I +TG    + A +++ A + F
Sbjct: 480 FLGLLEHKHPEVLKAIAETGTLETDTANKIKEAAQKF 516


>ATPA_CLOK1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  577 bits (1486), Expect = e-166
 Identities = 291/508 (57%), Positives = 387/508 (76%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +I+ +IE +E   E    GT++ + DGI R++GL   M GE++EFP + Y
Sbjct: 1   MNVKPEEITSIIKSQIEKYEKKIETVDSGTIIQIGDGIARVYGLNGCMAGELLEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLE+D+VG V+LG  + I EG+  K TG+++EVPVGE ++GRVV++LG PIDG G 
Sbjct: 61  AMALNLEQDNVGCVLLGSQEGIKEGNTVKRTGKVVEVPVGENIIGRVVNSLGHPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T  +E VAPGVITRQ+V QP+QTG+K+ID+M+P+GRGQRELIIGDRQTGKTA+A+
Sbjct: 121 ISTTETRAVELVAPGVITRQAVKQPLQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+VA +V  L E  A+++TIVV         LQ+IAPY
Sbjct: 181 DTIINQKGKDVICIYVAIGQKQSTVAHIVNNLIETNAMDYTIVVSAAASESAPLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF ++G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMNKGKDVLIVYDDLSKHAVAYRAMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A+++          K+ G  GSLTALPIIET AGDV+A+IPTNVISITDGQIFLET+LF
Sbjct: 301 AAKLS---------DKLGG--GSLTALPIIETLAGDVTAYIPTNVISITDGQIFLETELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G RPAINAG+SVSRVGG AQ K +K++ G +R+DLAQYRELA+FAQF SDLD+ +++ 
Sbjct: 350 YSGQRPAINAGISVSRVGGNAQIKAMKQVAGTLRIDLAQYRELASFAQFGSDLDKESKRT 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+TE++KQ QY PM+V +  + LFAA+  ++ D+ V++I +FE     YM + H 
Sbjct: 410 LEKGKRLTEILKQPQYKPMAVEKQVMILFAASRNYIMDIPVERISEFEEEFLDYMDTHHR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           E+ D+I +    SDE++ +LR AIE FK
Sbjct: 470 EIGDEIKEKQVISDELSDKLRNAIEEFK 497


>ATPA_SULNB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  576 bits (1485), Expect = e-166
 Identities = 298/512 (58%), Positives = 374/512 (73%), Gaps = 11/512 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M ++L A EIS +I++RIE FE D +    G VV + DGI  ++GL +VM GE++EF   
Sbjct: 1   MAVKLQADEISSIIKERIENFEIDVDINEIGKVVGIADGITTVYGLNNVMAGEVVEFDNG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             GL +NLE  +VG V+LG    I EG   K +G +L+ PVG+ L+GRVV+ LG PIDG 
Sbjct: 61  AKGLVLNLEEANVGVVVLGTSAGIKEGMSVKRSGALLKTPVGDGLMGRVVNPLGDPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G IE      IE+ APG++ R+SV +P+QTG+K+ID++VPVGRGQRELIIGDRQTGKT +
Sbjct: 121 GTIETAEYRFIEEKAPGIMARKSVHEPLQTGIKAIDALVPVGRGQRELIIGDRQTGKTTL 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG  + CIYVAIGQK S+VA  V+KLEEHGAL++TI+V         LQF+A
Sbjct: 181 AIDTIINQKGQDVVCIYVAIGQKQSTVAATVKKLEEHGALDYTIIVNAGASDSAALQFLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAG  M EYFRD G  A+I YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGVTMAEYFRDNGRHAVIFYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A+++ E              GS+TA PIIETQAGDV+A+IPTNVISITDGQIFLETD
Sbjct: 301 ERAAKLSDEL-----------GAGSITAFPIIETQAGDVAAYIPTNVISITDGQIFLETD 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFN+GIRPAIN GLSVSRVGGAAQ K IK++ G +RLDLA +REL AFAQFASDLD+ TR
Sbjct: 350 LFNSGIRPAINVGLSVSRVGGAAQIKAIKQVSGTLRLDLASFRELQAFAQFASDLDDYTR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
            QLERGQR+ E++KQ  Y P+ V +  V +FA   G+LDD+    +  FE+ L  +M + 
Sbjct: 410 SQLERGQRMVEVLKQGPYVPVPVEKQVVIIFAGANGYLDDIAASSVTKFEAELMPFMEAK 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           +  +LD I      SD+  A+LR AIE+FKT+
Sbjct: 470 YASVLDAIRNEKKISDDTDAQLRKAIEDFKTS 501


>ATPA_CAMC1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  576 bits (1485), Expect = e-166
 Identities = 297/512 (58%), Positives = 379/512 (74%), Gaps = 11/512 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  ++ A EIS +I++RIE F+   +    G V+S+ DG+  ++GL +VM GEM+EF   
Sbjct: 1   MSAKIKADEISTIIKERIENFDLSVDVEETGKVISVADGVANVYGLKNVMAGEMVEFESG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE  SVG VILG    I+EG   K   ++L VPVG+AL+GRVV++LG PID  
Sbjct: 61  EKGMALNLEESSVGIVILGKTSGITEGSSVKRLKKLLRVPVGDALIGRVVNSLGEPIDAK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIEA  +  +E+ A G++ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT V
Sbjct: 121 GPIEATESRFVEEKAKGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG  + CIYVAIGQK S+VA VV+KLEE+GA+++TIVV         LQ++A
Sbjct: 181 AIDTIINQKGQDVICIYVAIGQKQSTVAQVVKKLEEYGAMDYTIVVNAGASDAAALQYLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAG  MGEYFRD    ALIIYDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGVTMGEYFRDNSRHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER++++N                GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLE+D
Sbjct: 301 ERASKLNDAL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLESD 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFN+GIRPAIN GLSVSRVGGAAQ K IK++ G +RLDLAQYREL AFAQFASDLDE++R
Sbjct: 350 LFNSGIRPAINVGLSVSRVGGAAQIKAIKQVSGTLRLDLAQYRELQAFAQFASDLDESSR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           KQLERGQ++ E++KQ  YSP+ V    V +FA  +G+LDDV    +  FE+ L  Y+ + 
Sbjct: 410 KQLERGQKMVEVLKQPPYSPLPVENQVVIIFAGAKGYLDDVATANVTKFEAELYPYIEAK 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           + E+ ++I        E+   L  A+++FK T
Sbjct: 470 YPEIFEQIRTKKVIDKEVEEILHKALKDFKAT 501


>ATPA_CAMJJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  576 bits (1484), Expect = e-166
 Identities = 292/511 (57%), Positives = 378/511 (73%), Gaps = 11/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++  A EIS +I++RIE F+ + E    G ++S+ DG+ +++GL ++M GEM+EF     
Sbjct: 1   MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE  SVG VILG  + + EG   K       VPVGEAL+GRVV+ALG PID  G 
Sbjct: 61  GMALNLEESSVGIVILGKGEGLKEGASVKRXXXXXXVPVGEALIGRVVNALGEPIDAKGV 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A     +E+ A G++ R+SV +P+ TG+K+ID++VP+GRGQRELIIGDRQTGKT VA+
Sbjct: 121 INANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+Q+G G+ CIYVAIGQK S+VA VV++LEEHGA+E+TIVV         LQ++APY
Sbjct: 181 DTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGE+FRD  + ALI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++++N E              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 ASKLNDEL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDEA+RKQ
Sbjct: 350 NSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERGQR+ EL+KQ  YSP+SV +  V +FA  +GFLDD+ V +I++FE  +  ++ + H 
Sbjct: 410 LERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIEEFEDGIYPFIEAKHP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTN 513
           ++ ++I        ++  +L  AI  FK  +
Sbjct: 470 DIFEQIRSKKALDSDLEEKLAKAINEFKANH 500


>ATPA_WOLSU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 500

 Score =  575 bits (1483), Expect = e-166
 Identities = 294/507 (57%), Positives = 374/507 (73%), Gaps = 11/507 (2%)

Query: 5   LNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGL 64
           + A EIS +I++RI+ FE D      G V++  DG+ +++GL +VM  EM+EF     GL
Sbjct: 1   MQADEISSIIKERIDNFELDVNVAETGKVMAFADGVAKVYGLKNVMSYEMVEFDTGDRGL 60

Query: 65  AMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIE 124
           A NLE  SVG V+LG  ++I EG   K  G++++VP G+AL+GRVV+ +G P+DG G IE
Sbjct: 61  ASNLEESSVGVVVLGAGKNIKEGTSVKRLGKLMKVPAGDALMGRVVNGMGEPVDGKGAIE 120

Query: 125 AQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDA 184
                 +E+ APG++ R+SV +P+QTGLK+ID++VP+GRGQRELIIGDRQTGKT VAID 
Sbjct: 121 TTEYRFVEEKAPGIMQRKSVHEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTTVAIDT 180

Query: 185 IINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAG 244
           IINQKG  + CIYVAIGQK S+VA VVRKLEEHGA+E+TI+V         +QF+APY G
Sbjct: 181 IINQKGQDVVCIYVAIGQKESTVAQVVRKLEEHGAMEYTIIVNAPASDSAAMQFLAPYTG 240

Query: 245 CAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSA 304
             MGEYFRD    ALIIYDDL+K A AYR++SL+LRRPPGREAFPGDVFYLHSRLLER+A
Sbjct: 241 VTMGEYFRDNARHALIIYDDLSKHAVAYREMSLILRRPPGREAFPGDVFYLHSRLLERAA 300

Query: 305 RVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNA 364
           +V+ E              GSLTALPIIETQAGDV+A+IPTNVISITDGQIFLETDLFN+
Sbjct: 301 KVSDEL-----------GAGSLTALPIIETQAGDVAAYIPTNVISITDGQIFLETDLFNS 349

Query: 365 GIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLE 424
           G+RPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDE++RKQLE
Sbjct: 350 GVRPAINVGLSVSRVGGAAQIKATKQVAGTLRLDLAQYRELQAFAQFASDLDESSRKQLE 409

Query: 425 RGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGEL 484
           RGQR+ E++KQ  Y+P+ + +  V +FA  +G++DD+ V KI  FE+ L  ++ + + ++
Sbjct: 410 RGQRMVEILKQPPYAPLPIERQVVVIFAGAKGYMDDISVTKITKFEAELYPFIEAKYPQI 469

Query: 485 LDKITKTGDYSDEIAAELRAAIENFKT 511
            + I        E    L  A+E FKT
Sbjct: 470 FEDIRTKKMIDKETEETLSKALEEFKT 496


>ATPA_CAMJR RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  575 bits (1483), Expect = e-166
 Identities = 292/511 (57%), Positives = 378/511 (73%), Gaps = 11/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++  A EIS +I++RIE F+ + E    G ++S+ DG+ +++GL ++M GEM+EF     
Sbjct: 1   MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE  SVG VILG  + + EG   K       VPVGEAL+GRVV+ALG PID  G 
Sbjct: 61  GMALNLEESSVGIVILGKGEGLKEGASVKRXXXXXXVPVGEALIGRVVNALGEPIDAKGV 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A     +E+ A G++ R+SV +P+ TG+K+ID++VP+GRGQRELIIGDRQTGKT VA+
Sbjct: 121 INANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+Q+G G+ CIYVAIGQK S+VA VV++LEEHGA+E+TIVV         LQ++APY
Sbjct: 181 DTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGE+FRD  + ALI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++++N E              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 ASKLNDEL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDEA+RKQ
Sbjct: 350 NSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERGQR+ EL+KQ  YSP+SV +  V +FA  +GFLDD+ V +I++FE  +  ++ + H 
Sbjct: 410 LERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTN 513
           ++ ++I        ++  +L  AI  FK  +
Sbjct: 470 DIFEQIRSKKALDSDLEEKLAKAINEFKANH 500


>ATPA_CAMJE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  575 bits (1483), Expect = e-166
 Identities = 292/511 (57%), Positives = 378/511 (73%), Gaps = 11/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++  A EIS +I++RIE F+ + E    G ++S+ DG+ +++GL ++M GEM+EF     
Sbjct: 1   MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE  SVG VILG  + + EG   K       VPVGEAL+GRVV+ALG PID  G 
Sbjct: 61  GMALNLEESSVGIVILGKGEGLKEGASVKRXXXXXXVPVGEALIGRVVNALGEPIDAKGV 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A     +E+ A G++ R+SV +P+ TG+K+ID++VP+GRGQRELIIGDRQTGKT VA+
Sbjct: 121 INANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+Q+G G+ CIYVAIGQK S+VA VV++LEEHGA+E+TIVV         LQ++APY
Sbjct: 181 DTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGE+FRD  + ALI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++++N E              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 ASKLNDEL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDEA+RKQ
Sbjct: 350 NSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERGQR+ EL+KQ  YSP+SV +  V +FA  +GFLDD+ V +I++FE  +  ++ + H 
Sbjct: 410 LERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTN 513
           ++ ++I        ++  +L  AI  FK  +
Sbjct: 470 DIFEQIRSKKALDSDLEEKLAKAINEFKANH 500


>ATPA_CAMJ8 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  575 bits (1483), Expect = e-166
 Identities = 292/511 (57%), Positives = 378/511 (73%), Gaps = 11/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++  A EIS +I++RIE F+ + E    G ++S+ DG+ +++GL ++M GEM+EF     
Sbjct: 1   MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE  SVG VILG  + + EG   K       VPVGEAL+GRVV+ALG PID  G 
Sbjct: 61  GMALNLEESSVGIVILGKGEGLKEGASVKRXXXXXXVPVGEALIGRVVNALGEPIDAKGV 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A     +E+ A G++ R+SV +P+ TG+K+ID++VP+GRGQRELIIGDRQTGKT VA+
Sbjct: 121 INANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+Q+G G+ CIYVAIGQK S+VA VV++LEEHGA+E+TIVV         LQ++APY
Sbjct: 181 DTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
            G  MGE+FRD  + ALI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 TGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++++N E              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 ASKLNDEL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AFAQFASDLDEA+RKQ
Sbjct: 350 NSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFASDLDEASRKQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERGQR+ EL+KQ  YSP+SV +  V +FA  +GFLDD+ V +I++FE  +  ++ + H 
Sbjct: 410 LERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTN 513
           ++ ++I        ++  +L  AI  FK  +
Sbjct: 470 DIFEQIRSKKALDSDLEEKLAKAINEFKANH 500


>ATPA2_PELLD RecName: Full=ATP synthase subunit alpha 2;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit alpha
           2;AltName: Full=ATP synthase F1 sector subunit alpha 2;
          Length = 526

 Score =  575 bits (1483), Expect = e-166
 Identities = 294/520 (56%), Positives = 381/520 (73%), Gaps = 9/520 (1%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   +   E+S ++RK++ GFE++ E    GTV+ + DGI R++GL+    GE++EFP  
Sbjct: 1   MSTTVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSKAAAGELLEFPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE D+VGAV+ G    + EGD  K TG +  VPVGEA+LGRVV+ LG+PIDG 
Sbjct: 61  VMGMALNLEEDNVGAVLFGDSTEVKEGDTVKRTGILASVPVGEAMLGRVVNPLGVPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G I+     P+E+ APGVI R+SV +P+QTGLK+IDSM+P+GRGQRELIIGDRQTGKTAV
Sbjct: 121 GIIDTDIRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           A+D IINQKG G+ CIYVAIG K S+VA VV  LE+HGA+E+T V+         LQFIA
Sbjct: 181 ALDTIINQKGKGVYCIYVAIGLKGSTVAQVVNTLEKHGAMEYTTVITATASDPAPLQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           P+AG A+GEYFRD G  AL++YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVF+LHSRLL
Sbjct: 241 PFAGAALGEYFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFFLHSRLL 300

Query: 301 ERSARV--NAEHVEKLTE------GKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITD 352
           ER+A++  + E  +K+ +        V+G  GSLTALP+IETQAGDVSA+IPTNVISITD
Sbjct: 301 ERAAKITDDIEVAKKMNDLPDALRPMVQG-GGSLTALPVIETQAGDVSAYIPTNVISITD 359

Query: 353 GQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFA 412
           GQIFLE++LFN+G RPAIN G+SVSRVGGAAQ K +KK+ G +RLDLAQ+REL AF++F 
Sbjct: 360 GQIFLESNLFNSGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFG 419

Query: 413 SDLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESA 472
           SDLD+ T+ QL+RG R+ E++KQ QY PM V +    +F   +G LD V V  ++ FE  
Sbjct: 420 SDLDKTTKAQLDRGARLVEILKQGQYVPMPVERQVAIIFLGTQGLLDLVAVQHVKKFEEE 479

Query: 473 LQGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
               +   H ++L  I +TG    ++A  L+ A + F TT
Sbjct: 480 FLAMLDLKHSDILKSIAETGALEADVAGRLKEAAQKFVTT 519


>ATPA_CAMJD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 501

 Score =  575 bits (1482), Expect = e-166
 Identities = 291/511 (56%), Positives = 378/511 (73%), Gaps = 11/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++  A EIS +I++RIE F+ + E    G ++S+ DG+ +++GL ++M GEM+EF     
Sbjct: 1   MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLKNIMAGEMVEFENGDK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE  SVG VILG  + + EG   K       VPVGEAL+GRVV+ALG PID  G 
Sbjct: 61  GMALNLEESSVGIVILGKGEGLKEGASVKRXXXXXXVPVGEALIGRVVNALGEPIDAKGV 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + A     +E+ A G++ R+SV +P+ TG+K+ID++VP+GRGQRELIIGDRQTGKT VA+
Sbjct: 121 VNANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D II+Q+G G+ CIYVAIGQK S+VA VV++LEEHGA+E+TIVV         LQ++APY
Sbjct: 181 DTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTIVVNAGASDPAALQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG  MGE+FRD  + ALI+YDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           ++++N E              GSLTALPIIETQAGDVSA+IPTNVISITDGQIFLETDLF
Sbjct: 301 ASKLNDEL-----------GAGSLTALPIIETQAGDVSAYIPTNVISITDGQIFLETDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           N+GIRPAIN GLSVSRVGGAAQ K  K++ G +RLDLAQYREL AF QFASDLDEA+RKQ
Sbjct: 350 NSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFTQFASDLDEASRKQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LERGQR+ EL+KQ  YSP+SV +  V +FA  +GFLDD+ V +I++FE  +  ++ + H 
Sbjct: 410 LERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIKEFEDGIYPFIEAKHP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTTN 513
           ++ ++I        ++  +L  AI  FK  +
Sbjct: 470 DIFEQIRSKKALDSDLEEKLAKAINEFKANH 500


>ATPA_BACLD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  575 bits (1482), Expect = e-166
 Identities = 298/511 (58%), Positives = 379/511 (74%), Gaps = 15/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + A EIS LI+++IE ++++ E    GTV+ + DGI R+HGL + M GE++EF     
Sbjct: 1   MSIKAEEISTLIKQQIENYQSEIEVHDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA NLE  +VG VILGPY+ I EGD  K TGRI+EVPVGE LLGRVV+ LG P+DG GP
Sbjct: 61  GLAQNLEESNVGIVILGPYKDIREGDEVKRTGRIMEVPVGEELLGRVVNPLGQPVDGMGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T PIE  APGV+ R+SV +P+QTG+KSID+++P+GRGQRELIIGDRQTGKT++AI
Sbjct: 121 VLTSKTRPIESPAPGVMDRKSVHEPLQTGIKSIDALIPIGRGQRELIIGDRQTGKTSIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQK   + CIYVAIGQK S+V GVV  L +HGAL++TIVV         L ++APY
Sbjct: 181 DTILNQKDQDMICIYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG AMGE F   G+  L++YDDL+KQA AYR++SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGVAMGEEFMYNGKHVLVVYDDLSKQATAYRELSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GSLTALP +ETQAGD+SA+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPA+N GLSVSRVGG+AQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 350 FSGVRPAVNPGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDKATQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R  E++KQ  + P+ V +    L+A   GFLDDV V+ I+ FE  L  Y+  +H 
Sbjct: 410 LNRGARTVEVLKQDLHKPLRVEKQVAILYALTRGFLDDVPVEDIKRFEEELFMYLDQNHK 469

Query: 483 ELLDKITKTGDY-SDEIAAELRAAIENFKTT 512
           +LLD I +TG+  +DE   +++ AIE FK T
Sbjct: 470 DLLDSIAQTGNLPADE---DMKGAIEGFKRT 497


>ATPA_KOSOT RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  575 bits (1481), Expect = e-166
 Identities = 291/508 (57%), Positives = 380/508 (74%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           ++++ +EI+++I ++++  + + +    G ++ + DGI R +GL  VM  E+++F    Y
Sbjct: 1   MKISPSEITKIIEEQLKRSDREIDYFEAGRIIQVGDGIARAYGLKGVMSNELVQFENGEY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLE D+VG V+LG Y+ I EGD  K TGRI+EVP GEALLGRVV+ LGIP+DG GP
Sbjct: 61  GLALNLEEDNVGIVVLGDYREIKEGDLVKRTGRIIEVPAGEALLGRVVNPLGIPLDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA    P+E  APGV+ R+ V  P+QTG+K+ID+M+P+GRGQRELIIGDRQTGKTA+AI
Sbjct: 121 IEASEHRPVEIKAPGVVMRKPVDTPLQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK  G+ CIYVAIGQK + +A ++ KLEE GA+E+T +V         L ++APY
Sbjct: 181 DTIINQKDQGVYCIYVAIGQKTAVLARIIDKLEETGAMEYTTIVAATANDPATLAYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG AMGEYF   G+DAL+IYDDL+K A AYR++SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGAAMGEYFMYSGKDALVIYDDLSKHAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +AR+N EH             GSLTALPIIET A DVSA+IPTNVISITDGQI+L+ +LF
Sbjct: 301 AARLNEEH-----------GGGSLTALPIIETLANDVSAYIPTNVISITDGQIYLDPNLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AG RPAIN GLSVSRVGG+AQ K +KK+ G +RLDLAQYREL AFAQF+++LD+AT+ Q
Sbjct: 350 YAGNRPAINVGLSVSRVGGSAQIKAMKKIAGSLRLDLAQYRELLAFAQFSTELDKATQAQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG+++TEL+KQ QYSPM V +    L+A   G+LDD+  DKI+ FE  L   MR  + 
Sbjct: 410 LIRGEKLTELLKQEQYSPMPVEEQIAVLYAGTRGYLDDLPTDKIRQFEKQLLQTMRQKYA 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++L  I +  D ++EI A L+ A+E+ +
Sbjct: 470 DVLKAIREKKDMTEEIEAGLKKAVEDVR 497


>ATPA_BREBN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 503

 Score =  574 bits (1479), Expect = e-166
 Identities = 294/502 (58%), Positives = 373/502 (74%), Gaps = 13/502 (2%)

Query: 9   EISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNL 68
           EIS LI++RI  F+++ E    GTV+ + DGI R+HGL   M GE++EF     G+ +NL
Sbjct: 8   EISSLIKERIANFKSEIEVVDVGTVIQVGDGIARVHGLEKAMQGELLEFQNGVMGMVLNL 67

Query: 69  ERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQAT 128
           E D+VG VI+GP++ I EGD  K TGR++EVPVGEALLGRVV+ LG PIDG GPI     
Sbjct: 68  EEDNVGVVIMGPFRDIKEGDTVKRTGRVMEVPVGEALLGRVVNPLGQPIDGQGPIANNGF 127

Query: 129 SPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQ 188
            PIE  APGV+ R+SV +P+QTG+K+ID+M+PVGRGQRELIIGDRQTGKTAVA+D IINQ
Sbjct: 128 RPIESPAPGVMARKSVHEPLQTGIKAIDAMIPVGRGQRELIIGDRQTGKTAVALDTIINQ 187

Query: 189 KGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMG 248
           KG  + CIYVAIGQK S+VA +V  L + GALE+TI+V         + ++APY G  M 
Sbjct: 188 KGKDMICIYVAIGQKQSTVANIVETLRKAGALEYTIIVSATASDPAPMLYLAPYTGVTMA 247

Query: 249 EYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNA 308
           EYF  +G   L +YDDL+KQA AYR++SLLLRRPPGREA+PGDVFYLHSRLLER+A+++ 
Sbjct: 248 EYFMYKGGHVLCVYDDLSKQAAAYREMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSD 307

Query: 309 EHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRP 368
           +              GS+TALP IETQAGD+SA+IPTNVISITDGQIFLETDLFNAG RP
Sbjct: 308 DL-----------GAGSITALPFIETQAGDISAYIPTNVISITDGQIFLETDLFNAGQRP 356

Query: 369 AINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQR 428
           A+N GLSVSRVGG+AQ K +KK+ G ++L+LAQYRELAAFAQF SDLD+AT+ +L RG+R
Sbjct: 357 AVNTGLSVSRVGGSAQIKAMKKVAGPLKLELAQYRELAAFAQFGSDLDKATQARLTRGER 416

Query: 429 VTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKI 488
           + E+MKQ Q+ PM V +   S+++A  GFLDD+ V +++ FE  +  ++ S+  +LL+ I
Sbjct: 417 LMEIMKQGQFDPMPVEKQVASIYSATRGFLDDIPVAEVRRFEKEMLSFLDSNKPQLLEHI 476

Query: 489 TKTGDYSDEIAAELRAAIENFK 510
             T D  DE   E  AAIE FK
Sbjct: 477 RTTKDLPDE--KEFNAAIEEFK 496


>ATPA_CLOK5 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  573 bits (1478), Expect = e-166
 Identities = 290/508 (57%), Positives = 386/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +I+ +IE +E   E    GT++ + DGI R++GL   M GE++EFP + Y
Sbjct: 1   MNVKPEEITSIIKSQIEKYEKKIETVDSGTIIQIGDGIARVYGLNGCMAGELLEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
            +A+NLE+D+VG V+LG  + I EG+  K TG+++EVPVGE ++GRVV++LG PIDG G 
Sbjct: 61  AMALNLEQDNVGCVLLGSQEGIKEGNTVKRTGKVVEVPVGENIIGRVVNSLGHPIDGKGA 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T  +E VAPGVITRQ+V QP+QTG+K+ID+M+P+GRGQRELIIGDRQTGKTA+A+
Sbjct: 121 ISTTETRAVELVAPGVITRQAVKQPLQTGIKAIDAMIPIGRGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+VA +V  L E  A+++TIVV         LQ+IAPY
Sbjct: 181 DTIINQKGKDVICIYVAIGQKQSTVAHIVNNLIETNAMDYTIVVSAAASESAPLQYIAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF ++G+D LI+YDDL+K A AYR +SLLLRRPP REA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMNKGKDVLIVYDDLSKHAVAYRAMSLLLRRPPRREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A+++          K+ G  GSLTALPIIET AGDV+A+IPTNVISITDGQIFLET+LF
Sbjct: 301 AAKLS---------DKLGG--GSLTALPIIETLAGDVTAYIPTNVISITDGQIFLETELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G RPAINAG+SVSRVGG AQ K +K++ G +R+DLAQYRELA+FAQF SDLD+ +++ 
Sbjct: 350 YSGQRPAINAGISVSRVGGNAQIKAMKQVAGTLRIDLAQYRELASFAQFGSDLDKESKRT 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+TE++KQ QY PM+V +  + LFAA+  ++ D+ V++I +FE     YM + H 
Sbjct: 410 LEKGKRLTEILKQPQYKPMAVEKQVMILFAASRNYIMDIPVERISEFEEEFLDYMDTHHR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           E+ D+I +    SDE++ +LR AIE FK
Sbjct: 470 EIGDEIKEKQVISDELSDKLRNAIEEFK 497


>ATPA_CHLPB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 526

 Score =  573 bits (1477), Expect = e-165
 Identities = 293/519 (56%), Positives = 381/519 (73%), Gaps = 7/519 (1%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   +   E+S ++RK + GFE++ +    GTV+ + DGI RI+GL+ V  GE++EFP N
Sbjct: 1   MSTTVRPDEVSAILRKHLAGFESEADVYDVGTVLQVGDGIARIYGLSKVAAGELLEFPDN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE D+VGAV+ G    + EGD  K TG +  +PVGEA+LGRV++ LG PIDG 
Sbjct: 61  VMGMALNLEEDNVGAVMFGKSTAVKEGDTVKRTGILASIPVGEAMLGRVINPLGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPIE     P+E+ APGVI R+SV+QP+QTGLK+ID+M+P+GRGQRELIIGDRQTGKTAV
Sbjct: 121 GPIETSIRLPLERKAPGVIFRKSVNQPLQTGLKAIDAMIPIGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG  + CIYVAIGQK S++A VV  LE++GA+E+T V+         +QFIA
Sbjct: 181 AIDTIINQKGKDVFCIYVAIGQKGSTIAQVVSTLEKYGAMEYTTVIASSASDPAPMQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PYAG A+GE+FRD G  AL+IYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYAGAAIGEFFRDTGRHALVIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARV--NAEHVEKLTEGKVKGKT-----GSLTALPIIETQAGDVSAFIPTNVISITDG 353
           ER+A++  + E  +K+ +     K      GSLTALP+IETQAGDVSA+IPTNVISITDG
Sbjct: 301 ERAAKITDDLETAKKMNDLPEPLKPMVKAGGSLTALPVIETQAGDVSAYIPTNVISITDG 360

Query: 354 QIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFAS 413
           QIFLE +LFNAG RPAIN G+SVSRVGG+AQ K +KK+ G +RLDLAQ+REL AF++F S
Sbjct: 361 QIFLEPNLFNAGQRPAINVGISVSRVGGSAQIKAMKKITGTLRLDLAQFRELEAFSKFGS 420

Query: 414 DLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESAL 473
           DLD+AT+ QL+RG R+ E++KQ QY PM+V +    +FA  +G LD +++  I+      
Sbjct: 421 DLDKATKAQLDRGARLVEILKQDQYVPMAVEKQVAIIFAGTQGVLDQLDLQYIRRXXXXX 480

Query: 474 QGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
                  H ++L+ I +TG    ++A  L+   E F +T
Sbjct: 481 XXXXXHKHSDILNSIAETGQMDVDVAKRLKEVAEQFMST 519


>ATPA_SYNFM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  572 bits (1475), Expect = e-165
 Identities = 293/478 (61%), Positives = 370/478 (77%), Gaps = 14/478 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFP---G 59
           +++ A EIS++IR++I+ +E   E    G V+S+ DGI R++G+   M  E++EFP   G
Sbjct: 1   MEIRAEEISQIIREQIKDYEKQVELSETGRVLSVGDGIARVYGVEKCMSMELLEFPTEHG 60

Query: 60  NTYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDG 119
             YGLA+NLE D+VG  I+G   HI EG   K TGRI  VPVG+A+LGR++D++G P+DG
Sbjct: 61  VVYGLALNLEEDNVGVAIMGEDIHIKEGSEVKRTGRIASVPVGDAVLGRIIDSVGNPVDG 120

Query: 120 GGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTA 179
            GPIEA+  S +E +APGVI RQSV++P+ TGLK+ID+M PVGRGQRELIIGDRQ GKTA
Sbjct: 121 KGPIEAKEFSRVEVIAPGVIARQSVNEPMYTGLKAIDAMTPVGRGQRELIIGDRQIGKTA 180

Query: 180 VAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFI 239
           +A+D IINQK +GI CIYVA+GQK S+VA VV  L +HGA+++TIVV         LQ+I
Sbjct: 181 IAVDTIINQKDSGIICIYVAVGQKKSTVAQVVETLRKHGAMDYTIVVAANASDPAALQYI 240

Query: 240 APYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRL 299
           APYAGCAMGEY+RD+G  ALIIYDDL+KQA AYRQVSLLLRRPP REA+PGD+FY HSRL
Sbjct: 241 APYAGCAMGEYYRDKGRHALIIYDDLSKQAAAYRQVSLLLRRPPAREAYPGDIFYNHSRL 300

Query: 300 LERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLET 359
           LER+A++NAE         + G  GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LE 
Sbjct: 301 LERAAKLNAE---------LGG--GSLTALPIIETQAGDVSAYIPTNVISITDGQIYLEP 349

Query: 360 DLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEAT 419
           +LF AG+RPAIN GLSVSRVGGAAQTK +K++ G +RLDLAQYREL AFA+F SDLD+AT
Sbjct: 350 NLFFAGVRPAINVGLSVSRVGGAAQTKAMKQVAGRLRLDLAQYRELEAFAKFGSDLDKAT 409

Query: 420 RKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM 477
           + QL RG R+TEL+KQ QY PM   +  +SL+A   G LD++ V+K+ +FE  +  ++
Sbjct: 410 QAQLNRGMRMTELLKQPQYQPMPAEREVMSLYAGTRGHLDNIPVEKVLEFEKEMLSFV 467


>ATPA_THEM4 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 507

 Score =  572 bits (1473), Expect = e-165
 Identities = 295/510 (57%), Positives = 378/510 (74%), Gaps = 12/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEF-PGNT 61
           +++N  EI +++  +IEGF+ +      G V+ + DGI R +GL +VM  EM+EF    T
Sbjct: 1   MRINPGEIVKVLESKIEGFKEEINLNDVGKVIQVGDGIARAYGLNNVMANEMVEFVETGT 60

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
            G+A NLE D+VG +ILG Y+ I EG   K   RI++VPVGEALLGRVV+ LG P+DG G
Sbjct: 61  IGMAFNLEEDNVGIIILGDYKDIKEGYTVKRLNRIMQVPVGEALLGRVVNPLGEPLDGLG 120

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           PI+A+    +E  APGVI R+ V  P+QTG+K ID+++P+GRGQRELIIGDRQTGKTA+A
Sbjct: 121 PIDAKEYRDVEVKAPGVIYRKPVDTPLQTGIKLIDALIPIGRGQRELIIGDRQTGKTAIA 180

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           ID IINQKG G+ CIYVAIGQKAS+VA +V KL++HGA+E+T VV         LQ+IAP
Sbjct: 181 IDTIINQKGKGVYCIYVAIGQKASAVARLVDKLKQHGAMEYTTVVVASAADNASLQYIAP 240

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           YAGCAMGEYF  +G+DAL+IYDDL+K A AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLE
Sbjct: 241 YAGCAMGEYFMYKGKDALVIYDDLSKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLE 300

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR++ ++             GSLTALPIIETQA D+SA+IPTNVISITDGQI+LE  L
Sbjct: 301 RAARLDDKY-----------GGGSLTALPIIETQANDISAYIPTNVISITDGQIYLEPSL 349

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           F AG RPA+N GLSVSRVGGAAQ K +KK+ G ++LDLAQY+EL  FAQFA++LD AT+ 
Sbjct: 350 FYAGQRPAVNIGLSVSRVGGAAQVKAMKKVAGSLKLDLAQYQELETFAQFATELDPATQA 409

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           Q+ RGQR+ ELMKQ QYSP+ V +    L+A   G+LDD++V+K++DFE     Y++ + 
Sbjct: 410 QITRGQRLMELMKQEQYSPLEVEEQVAVLYAGINGYLDDLDVEKVRDFEKRFLQYLKENK 469

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKT 511
            ELL +I +T D           AIE++K+
Sbjct: 470 SELLKQIRETKDXXXXXXXXXXXAIEDYKS 499


>ATPA_PETMO RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  572 bits (1473), Expect = e-165
 Identities = 298/511 (58%), Positives = 390/511 (76%), Gaps = 16/511 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNT- 61
           +++N  E++++I +RI+ +E+  E +  G V+ ++DGIVR +GL DVM  E++E   +  
Sbjct: 1   MRVNPDELTKVIEERIKSYESG-EIKEIGWVMQVSDGIVRAYGLKDVMTNELVEIETSEG 59

Query: 62  ---YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPID 118
              YG+AMNLE D+VG + LG Y+ I EGD+   T RI+EVPVGE LLGRVV+ LG+P+D
Sbjct: 60  EKIYGIAMNLEEDNVGIITLGDYKGIKEGDKLVRTNRIIEVPVGEKLLGRVVNPLGMPLD 119

Query: 119 GGGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKT 178
           G G I      PIE+ A GV+TR+ V  P+QTGLK +D+++P+GRGQRELIIGDRQTGKT
Sbjct: 120 GKGEINTDDFYPIERKAMGVVTRKPVDTPLQTGLKVLDALIPIGRGQRELIIGDRQTGKT 179

Query: 179 AVAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQF 238
           A+A D IINQKG  + CIYV+IGQK+S +A  +  LE++GA+++T            LQ+
Sbjct: 180 AIATDTIINQKGKNVFCIYVSIGQKSSGLARTIDNLEKYGAMDYTXXXXXXXXXXXXLQY 239

Query: 239 IAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSR 298
           IAPYAG A+GEYF   G+DAL+IYDDLTK A AYR++SLLLRRPPGREA+PGD+FYLHSR
Sbjct: 240 IAPYAGAAIGEYFMFNGKDALVIYDDLTKHAAAYREISLLLRRPPGREAYPGDIFYLHSR 299

Query: 299 LLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLE 358
           LLER++R+N  +             GSLTALPIIETQA D+SA+IPTNVISITDGQI+LE
Sbjct: 300 LLERASRLNENY-----------GNGSLTALPIIETQANDISAYIPTNVISITDGQIYLE 348

Query: 359 TDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEA 418
           T LFNAGIRPA+N GLSVSRVGG AQTK +K++ G ++LDLAQYREL +F QFA+DLDEA
Sbjct: 349 TGLFNAGIRPAVNIGLSVSRVGGDAQTKAMKRVAGSLKLDLAQYRELESFTQFAADLDEA 408

Query: 419 TRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMR 478
           T+KQL +G+++TELMKQ QYSPM + +    ++AANEG+LD +  D+I DFE     Y++
Sbjct: 409 TKKQLTKGEKLTELMKQPQYSPMEMEEQVAVIYAANEGYLDQIPTDRISDFERQFLAYLK 468

Query: 479 SSHGELLDKITKTGDYSDEIAAELRAAIENF 509
            ++ + L+KI ++ D +DEI  EL  AI  F
Sbjct: 469 ENYRDTLNKIRESKDIADEIKKELNEAISKF 499


>ATPA_CLONN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  572 bits (1473), Expect = e-165
 Identities = 289/508 (56%), Positives = 384/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +I+K+IE +E   +    GT++ + DGI R++G+ D M GE++EFP + Y
Sbjct: 1   MNVKPEEITSIIKKQIESYEHKIQTVDSGTIIQIGDGIARVYGIEDCMEGELLEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LGP + I EGD  K TGR++EVPVGEAL+GRVV+ALG P+DG GP
Sbjct: 61  GMALNLEQDNVGCVLLGPEKGIKEGDVVKRTGRVVEVPVGEALIGRVVNALGQPLDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+   T  IE  APGVI R+SV +P+QTG+K+IDSMVP+G+GQRELIIGDRQ GKTA+AI
Sbjct: 121 IKCTQTRAIELEAPGVIERKSVKEPLQTGIKAIDSMVPIGKGQRELIIGDRQIGKTAIAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK   +KCIYVAIGQK S+VA +V  L E GA+++TIVV         LQF++PY
Sbjct: 181 DTIINQKDKNVKCIYVAIGQKQSTVAHIVNTLTEMGAMDYTIVVSSTASDSAPLQFLSPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           +GC+M EYF  +GED LIIYDDL+K A AYR +SLLLRRPPGREA+PGDVFY+HSRLLER
Sbjct: 241 SGCSMAEYFMLKGEDVLIIYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYIHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A+++          K+ G  GS+TALPIIET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 AAKLS---------DKLGG--GSITALPIIETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AG +PA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAFAQF SDLD +++++
Sbjct: 350 YAGQKPAVNAGISVSRVGGNAQIKAMKQVSGTLRLELAQYRELAAFAQFGSDLDNSSKER 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QY PM V +  + L+AA   +L D++V  I+ FE     Y+ + + 
Sbjct: 410 LEKGKRLVEILKQDQYKPMPVEKQIIILYAAVNNYLSDIKVSDIRTFEREFLEYVDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           +L  KI    + +D+I  EL  AI+ FK
Sbjct: 470 DLGQKILDKKELTDDIKGELNTAIQEFK 497


>ATPA_CHLTE RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 526

 Score =  572 bits (1473), Expect = e-165
 Identities = 291/517 (56%), Positives = 382/517 (73%), Gaps = 9/517 (1%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   +   E+S ++RK++ GFE++ +    GTV+ + DGI RI+GL+ V  GE++EFP N
Sbjct: 1   MSTAVRPDEVSSILRKQLAGFESEADVYDVGTVLQVGDGIARIYGLSKVAAGELLEFPHN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE D+VGAV+ G    + EGD  K T  +  +PVGEA+LGRV++ LG PIDG 
Sbjct: 61  VMGMALNLEEDNVGAVLFGESNAVKEGDTVKRTNILASIPVGEAMLGRVINPLGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           GPI      P+E+ APGVI R+SV +P+QTGLK+ID+M+P+GRGQRELIIGDRQTGKTAV
Sbjct: 121 GPINTDIRLPLERRAPGVIFRKSVHEPLQTGLKAIDAMIPIGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           A+D IINQKG G++CIYVAIG K S+VA VV  LE++GA+E+T VV         LQFIA
Sbjct: 181 ALDTIINQKGKGVQCIYVAIGLKGSTVAQVVNTLEKYGAMEYTTVVSATASDPAPLQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           P+AG  +GE+FRD G  AL++YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PFAGATIGEFFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARV--NAEHVEKLTE------GKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITD 352
           ER+A++  + E  +K+ +        VKG  GSLTALP+IETQAGDVSA+IPTNVISITD
Sbjct: 301 ERAAKITDDIEVAKKMNDLPEPLKPLVKG-GGSLTALPVIETQAGDVSAYIPTNVISITD 359

Query: 353 GQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFA 412
           GQIFLE++LFNAG RPAIN G+SVSRVGGAAQ K +KK+ G +RLDLAQ+REL AF++F 
Sbjct: 360 GQIFLESNLFNAGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFG 419

Query: 413 SDLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESA 472
           SDLD++T+ QL+RG R+ E++KQ QY PM V +    +F   +G LD V++ +++ FE  
Sbjct: 420 SDLDKSTKAQLDRGARLVEILKQGQYIPMPVEKQVAIIFIGTQGLLDSVDLKQVRRFEEE 479

Query: 473 LQGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
               +   H E+L  I + G    +IA++L+   E +
Sbjct: 480 FLAMLEQKHPEILSSIAEKGTLESDIASKLKELGEKY 516


>ATPA_ANOFW RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 507

 Score =  572 bits (1473), Expect = e-165
 Identities = 298/512 (58%), Positives = 380/512 (74%), Gaps = 15/512 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + A EIS LI+K+IE ++++ E    GTV+ + DGI R HGL +VM GE++EF     
Sbjct: 4   MSIKAEEISALIKKQIENYQSEIEVSDVGTVIQVGDGIARAHGLDNVMSGELVEFANGVM 63

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA+NLE ++VG VILGPY  I EGD  + TGRI+EVPVGEAL+GRVV+ LG P+DG GP
Sbjct: 64  GLALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGP 123

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE   T PIE  APGV+ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT+VA+
Sbjct: 124 IETTETRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAV 183

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQKG  + CIYVAIGQK S+V  VV  L ++GAL++TIVV         L F+APY
Sbjct: 184 DTIINQKGKNMICIYVAIGQKESTVRNVVETLRKYGALDYTIVVTASASQPAPLLFLAPY 243

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG  MGEYF  +G+  L++YDDL+KQA AYR++SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 244 AGVTMGEYFMYKGQHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER 303

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GSLTALP +ETQAGD+SA+IPTNVISITDGQIFL++DLF
Sbjct: 304 AA--------KLSDAK---GAGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLF 352

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAINAGLSVSRVGGAAQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 353 FSGVRPAINAGLSVSRVGGAAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAK 412

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYM-RSSH 481
           L RG R  E++KQ  + P+ V +    ++A   GFLDD+ V+ I+ FE     ++ +  +
Sbjct: 413 LARGARTVEVLKQGLHEPLPVEKQVAIIYALTRGFLDDIPVEDIRRFEKEFHAWLDKDEN 472

Query: 482 GE-LLDKITKTGDYSDEIAAELRAAIENFKTT 512
           G+ L++ I  TGD  +E   +   AIE FK T
Sbjct: 473 GQKLMEHIRTTGDLPNE--EDFNKAIEAFKKT 502


>ATPA_OCEIH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 503

 Score =  571 bits (1472), Expect = e-165
 Identities = 296/510 (58%), Positives = 374/510 (73%), Gaps = 13/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +NA EIS LI+++IE F++D E    GTV+ + DGI R HGL + M GE++EF     
Sbjct: 1   MSINAEEISTLIKQQIENFDSDIEVSDVGTVIEVGDGIARAHGLDNAMAGELLEFSNGVM 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GLA NLE  +VG VILGPY  I EGD  + TGRI++VPVGE LLGRVV+ LG PIDG GP
Sbjct: 61  GLAQNLEESNVGIVILGPYTEIKEGDEVRRTGRIMQVPVGEELLGRVVNPLGQPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IE   T PIE  APGV+ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT VA+
Sbjct: 121 IETSKTRPIEAAAPGVMDRKSVDEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTVAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQK   + CIYVAIGQK S+V   V    +HGALE+TIVV         L +++PY
Sbjct: 181 DTILNQKDQDMICIYVAIGQKESTVRNTVETFRKHGALENTIVVTAGASDPAPLLYLSPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG AMGE F   G+  L+IYDDL+KQA AYR++SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGVAMGEEFMYNGKHVLVIYDDLSKQAVAYRELSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GSLTALP +ETQAGD++A+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GGGSLTALPFVETQAGDIAAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAIN GLSVSRVGG+AQ K +KK+ G +RLDLA +REL AF+QF SDLD++T+ +
Sbjct: 350 FSGVRPAINPGLSVSRVGGSAQIKAMKKVAGTLRLDLASFRELEAFSQFGSDLDKSTQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RGQR  E++KQ  + PM V +    +++   GFLDD+ V+ IQ FE  L  ++ S+  
Sbjct: 410 LNRGQRTVEVLKQGLHKPMVVEKQVAIIYSLTRGFLDDIPVEDIQRFEEELNIWLESNRN 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
           ELL  I +TG+  DE  +E   AI++FK T
Sbjct: 470 ELLTSIRETGNLPDE--SEFNDAIDSFKKT 497


>ATPA_GEOMG RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 503

 Score =  571 bits (1472), Expect = e-165
 Identities = 294/496 (59%), Positives = 373/496 (75%), Gaps = 12/496 (2%)

Query: 16  KRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDSVGA 75
           K+I+ +  + E    GT++S+ DGI RIHGL   M GE++EFPG   G+ +NLE D+VGA
Sbjct: 14  KQIKEYGKEVEVAETGTIISVGDGIARIHGLDKAMAGELLEFPGGVSGMVLNLEEDNVGA 73

Query: 76  VILGP-YQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKV 134
            ILG   ++I EG   K TGRI+EVPVGEAL+GRVV+A+G PIDG GPI       +E  
Sbjct: 74  AILGEDNENIKEGTTVKRTGRIVEVPVGEALIGRVVNAIGQPIDGKGPINTSTFGKVEVK 133

Query: 135 APGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIK 194
           APG++ R+SV QP+QTGLK+ID+MVPVGRGQRELIIGDRQTGKTAVAID IINQKG  + 
Sbjct: 134 APGIVKRKSVHQPMQTGLKAIDAMVPVGRGQRELIIGDRQTGKTAVAIDTIINQKGGDLI 193

Query: 195 CIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDR 254
           CIYVAIGQK S+VA VV KL+EHGA+++TI+V         LQFIAPY G  MGEYFRD 
Sbjct: 194 CIYVAIGQKRSTVAQVVSKLQEHGAMDYTIIVSASASEPAPLQFIAPYTGVTMGEYFRDN 253

Query: 255 GEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNAEHVEKL 314
           G+ ALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+A+++ +     
Sbjct: 254 GKHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSDD----- 308

Query: 315 TEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGL 374
                    GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LE+DLF +G+RPAIN GL
Sbjct: 309 ------CGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGL 362

Query: 375 SVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTELMK 434
           SVSRVGG+AQ K +K++ G +RL+LAQYRE+AAFAQF SDLD+AT+ QL RG+R+ E++K
Sbjct: 363 SVSRVGGSAQVKAMKQVAGTLRLNLAQYREMAAFAQFGSDLDKATQMQLARGERLVEILK 422

Query: 435 QLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITKTGDY 494
           Q QY P+   +  + +FAAN G++DD  V  ++ +ES L  +      ++L ++      
Sbjct: 423 QPQYRPIPNEKQVLIIFAANNGYVDDYPVASLRRYESELYSFFDGRKADILAELRDKKAI 482

Query: 495 SDEIAAELRAAIENFK 510
            D++  ++ AA++ FK
Sbjct: 483 DDDLKGKIVAALDEFK 498


>ATPA_ARCB4 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  571 bits (1472), Expect = e-165
 Identities = 291/511 (56%), Positives = 377/511 (73%), Gaps = 11/511 (2%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M  ++ A EIS +I++RI+ FE + +    G ++S  DGI +++GL +VM GE++EF   
Sbjct: 1   MGAKIQADEISSIIKERIDNFELNVDVNETGKIISYADGIAQVYGLKNVMAGEIVEFENG 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             GLA NLE  SVG VILG  + + EG   K  G++LE PVGEAL+GRVV+ALG PIDG 
Sbjct: 61  EKGLASNLEESSVGVVILGKGEGLREGTSCKRVGKLLETPVGEALVGRVVNALGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G I A  T  +E+ APG++ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT V
Sbjct: 121 GAIAATETRFVEEKAPGIMARKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTTV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID I+NQKG  + CIYVAIGQK+SS+A VVR LEE GA+++TIVV         LQF+A
Sbjct: 181 AIDTILNQKGENVICIYVAIGQKSSSIASVVRTLEESGAMDYTIVVNASAADSSALQFLA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           PY G  +GEYFRD G+ ALIIYDDL+K A AYR++SL+LRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PYTGVTIGEYFRDNGKHALIIYDDLSKHAVAYREMSLILRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETD 360
           ER+A+++ E              GS+TALPIIETQAGDV+A+IPTNVISITDGQIFLET+
Sbjct: 301 ERAAKMSDER-----------GAGSMTALPIIETQAGDVAAYIPTNVISITDGQIFLETN 349

Query: 361 LFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR 420
           LFN+GIRPAIN GLSVSRVGGAAQ K  K++ G ++L LAQYREL AFAQFASDLDEATR
Sbjct: 350 LFNSGIRPAINVGLSVSRVGGAAQIKATKQVAGTLKLSLAQYRELEAFAQFASDLDEATR 409

Query: 421 KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSS 480
           ++LE GQR+ E++KQ    P+ + +  V ++A  +G+L+D+ V  +  FE+ L  +    
Sbjct: 410 RELELGQRMVEVLKQGVNKPLVIEKQIVIIYAGTKGYLNDIAVKDVVRFEAELHAFFEQK 469

Query: 481 HGELLDKITKTGDYSDEIAAELRAAIENFKT 511
           +  +L+ I  +    D    +L+AA+E FKT
Sbjct: 470 YSNILEAIKASQKIDDNTETQLKAALEEFKT 500


>ATPA_THEAB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 507

 Score =  571 bits (1471), Expect = e-165
 Identities = 296/510 (58%), Positives = 379/510 (74%), Gaps = 12/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEF-PGNT 61
           +++N  EI +++  +IEGF+ +      G V+ + DGI R +GL +VM  EM+EF    T
Sbjct: 1   MRINPGEIVKVLESKIEGFKEEINLEDVGKVIQVGDGIARAYGLNNVMANEMVEFVETGT 60

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
            G+A NLE D+VG +ILG Y+ I EG   +   +I++VPVGEALLGRVV+ LG P+DG G
Sbjct: 61  IGVAFNLEEDNVGIIILGDYKGIKEGHTVRRLKKIMQVPVGEALLGRVVNPLGEPVDGLG 120

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           PIEA+    +E  APGVI R+ V  P+QTG+K ID+++P+GRGQRELIIGDRQTGKTA+A
Sbjct: 121 PIEAKEFRDVEVKAPGVIYRKPVDTPLQTGIKIIDALIPIGRGQRELIIGDRQTGKTAIA 180

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           ID IINQKG G+ C+YVAIGQKAS+VA +V KL+E GA+E+T VV         LQ+IAP
Sbjct: 181 IDTIINQKGKGVYCVYVAIGQKASAVARLVSKLKEAGAMEYTTVVVASAADNAALQYIAP 240

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           YAGCAMGEYF   G+DAL+IYDDL+K A AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLE
Sbjct: 241 YAGCAMGEYFLYNGKDALVIYDDLSKHAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLE 300

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR++ ++             GSLTALPIIETQA D+SA+IPTNVISITDGQI+LE  L
Sbjct: 301 RAARLDEKY-----------GGGSLTALPIIETQANDISAYIPTNVISITDGQIYLEPSL 349

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           F AG RPA+N GLSVSRVGGAAQ K +KK+ G ++LDLAQY+EL  FAQFA++LD AT+ 
Sbjct: 350 FYAGQRPAVNIGLSVSRVGGAAQIKAMKKVAGSLKLDLAQYQELETFAQFATELDPATQA 409

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           Q+ RGQR+ ELMKQ QY+PM V +    L+A   G+LDD+EV+K++ FE  L  +++   
Sbjct: 410 QITRGQRLMELMKQEQYAPMEVEEQVAVLYAGINGYLDDLEVEKVRLFEKKLIEFLKDKK 469

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFKT 511
            E+L+KI +  D S+E    L+ AIE FK+
Sbjct: 470 SEILNKIREEKDLSEETEKMLKEAIEEFKS 499


>ATPA_DESOH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 505

 Score =  570 bits (1470), Expect = e-165
 Identities = 299/514 (58%), Positives = 374/514 (72%), Gaps = 15/514 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ A EIS++I+++I GF+   E    G V+S+ DGI R++GL  VM  E++EFPG   
Sbjct: 1   MEIRAEEISQIIKEQIRGFDKKVELSETGVVLSVGDGIARVYGLEKVMTMELVEFPGGIL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           GL +NLE D+VG  I+G   +I EGD  K TGRI +VPVGEA+LGRVVD  G PIDG GP
Sbjct: 61  GLVLNLEEDNVGVAIMGEDTNIKEGDIVKRTGRIAQVPVGEAVLGRVVDTTGAPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I A  T  IE VAPGVI R+SV +P  TGLK++D+M PVGRGQRELIIGDRQ GKTAVAI
Sbjct: 121 INASETRRIEVVAPGVIARKSVHEPCYTGLKAVDAMTPVGRGQRELIIGDRQIGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+ QK T + CIYVA GQK SSVA V   LE+HGA+E+T +V         LQ++APY
Sbjct: 181 DAILAQKDTDVYCIYVACGQKKSSVAQVAAILEKHGAMEYTTIVAACASDPASLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYFRD G+ ALIIYDDL+KQA AYRQVSLLLRRPPGREA+PGD+FY HSRLLER
Sbjct: 241 AGCSMGEYFRDNGKHALIIYDDLSKQAAAYRQVSLLLRRPPGREAYPGDIFYNHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A++N E              GSLTALPIIETQAGDVSAFIPTNVISITDGQI+LE +LF
Sbjct: 301 AAKLNDEL-----------GAGSLTALPIIETQAGDVSAFIPTNVISITDGQIYLEPNLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AGIRPAIN GLSVSRVGGAAQ K +K++ G +RLD+AQ+REL AFA F SDLD AT++Q
Sbjct: 350 FAGIRPAINVGLSVSRVGGAAQVKAMKQVAGTLRLDMAQFRELEAFAAFGSDLDAATQRQ 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R+ E++KQ QY P+S+ +    LFA   G LD++ +D I  +E+ L  ++ + + 
Sbjct: 410 LTRGARLVEILKQPQYKPLSMEKQVTILFAGTNGHLDELPLDAIAAYEAGLYTFIETKYP 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAI----ENFKTT 512
           ++   + +   ++DEI   L  A+    + FK T
Sbjct: 470 QVFADLKEKQAFTDEIKQTLTKALGEYGQEFKDT 503


>ATPA_CLOBJ RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  570 bits (1470), Expect = e-165
 Identities = 290/508 (57%), Positives = 387/508 (76%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T  +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QYSPM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYSPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_CLOBH RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  570 bits (1470), Expect = e-165
 Identities = 290/508 (57%), Positives = 387/508 (76%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T  +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QYSPM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYSPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_CLOB6 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  570 bits (1470), Expect = e-165
 Identities = 290/508 (57%), Positives = 387/508 (76%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T  +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QYSPM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYSPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_CLOB1 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  570 bits (1470), Expect = e-165
 Identities = 290/508 (57%), Positives = 387/508 (76%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T  +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QYSPM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYSPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_PELTS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 506

 Score =  570 bits (1469), Expect = e-164
 Identities = 287/494 (58%), Positives = 373/494 (75%), Gaps = 11/494 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + L   EIS +IR++I+ ++A  E    GTV+ + DGI R++GL D M  E++EFPG   
Sbjct: 1   MNLRPEEISSIIRQQIDKYQAQIELTDVGTVIQVGDGIARVYGLMDCMSMELLEFPGGVL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D++G VILGPY+HI EGD  K TGRI+ VPVG+AL+GRVV+ LG P+DG GP
Sbjct: 61  GMALNLEEDNIGCVILGPYKHIKEGDTVKRTGRIVSVPVGDALIGRVVNPLGQPLDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           + +    P+E +APGVI R+ V Q +QTG+K++DSM+P+GRGQRELI+GDRQTGKTA+A+
Sbjct: 121 VNSDKYRPVEVIAPGVIYRKPVHQALQTGIKAVDSMIPIGRGQRELILGDRQTGKTAIAV 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAIINQ+G  + CIYVA+GQK S+VA VV+KL E GA+++TIVV         L FIAP+
Sbjct: 181 DAIINQRGGDVICIYVAVGQKQSTVANVVQKLTETGAMDYTIVVSATASDPAPLLFIAPF 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG AMGE F  +G   LI+YDDL+KQA AYR++SLLLRRPPGREA+PGDVF LHSRLLER
Sbjct: 241 AGAAMGEEFMWQGRHVLIVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFNLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           + +++ +              GS+TALPIIETQAGDVSA+IPTNVISITDGQI+LE DLF
Sbjct: 301 ACKLDDQF-----------GGGSMTALPIIETQAGDVSAYIPTNVISITDGQIYLEPDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            AGIRPAIN G+SVSRVGGAAQ + ++++ G +RLDLAQYRELAAFAQF +DLD+AT+ +
Sbjct: 350 YAGIRPAINVGISVSRVGGAAQVRAMRQVAGRLRLDLAQYRELAAFAQFGADLDKATQAR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R+TEL+KQ QY PM V    +S+FA   G+LDD+ V+K+  FE+    YM+++  
Sbjct: 410 LIRGDRMTELLKQGQYVPMPVEDQVMSIFAGTNGYLDDLPVEKVLPFEAEFLKYMKTNKP 469

Query: 483 ELLDKITKTGDYSD 496
            + + I +TG   D
Sbjct: 470 HIGETIRRTGQLKD 483


>ATPA_GEOTN RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  569 bits (1467), Expect = e-164
 Identities = 295/510 (57%), Positives = 377/510 (73%), Gaps = 13/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + A EIS LI+++IE +E+  +    GTV+ + DGI R+HGL +VM GE++EF     
Sbjct: 1   MSIRAEEISALIKQQIENYESQIQVSDVGTVIQIGDGIARVHGLDNVMSGELVEFANGVM 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE ++VG VILGPY  I EGD  + TGRI+EVPVGEAL+GRVV+ LG P+DG GP
Sbjct: 61  GMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E   T PIE  APGV+ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKTAVAI
Sbjct: 121 VETTETRPIESPAPGVMDRKSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+V  VV  L +HGAL++TIVV         L F+APY
Sbjct: 181 DTILNQKGQDMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG +MGEYF  +G+  L++YDDL+KQA AYR++SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGVSMGEYFMYKGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GSLTALP +ETQAGD+SA+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GAGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAINAGLSVSRVGGAAQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 350 FSGVRPAINAGLSVSRVGGAAQIKAMKKVSGTLRLDLAAYRELEAFAQFGSDLDKATQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R  E++KQ  + P+ V +    ++A   GFLDD+ V+ ++ FE     ++  +  
Sbjct: 410 LARGARTVEVLKQDLHQPIPVEKQVAIIYALTRGFLDDIPVEDVRRFEKEFFLWLDQNGQ 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
            LL+ I  T D  +E   +   AIE FK T
Sbjct: 470 HLLEHIRTTKDLPNE--EDFNKAIEAFKKT 497


>ATPA_CHLL2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 526

 Score =  569 bits (1467), Expect = e-164
 Identities = 296/517 (57%), Positives = 376/517 (72%), Gaps = 9/517 (1%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   +   E+S ++RK++ GFE++ E    GTV+ + DGI R++GL+ V  GE++EFP  
Sbjct: 1   MSTTVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSLVAAGELLEFPNK 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE D+VG V+ G    + EGD  + T  +  VPVGEA+LGRVV  LG PIDG 
Sbjct: 61  VMGMALNLEEDNVGCVLFGESNTVKEGDTVRRTNILASVPVGEAMLGRVVTPLGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G IE +   P+E+ APGVI R+SV +P+QTGLK+IDSM+P+GRGQRELIIGDRQTGKTAV
Sbjct: 121 GSIETEIRVPLERRAPGVIFRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG G+ CIYVAIG K S+VA VV  LE++GA+E+T V+         LQFIA
Sbjct: 181 AIDTIINQKGKGVFCIYVAIGLKGSTVAQVVNTLEKYGAMEYTTVISATASDPAPLQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           P+AG A+GEYFRD G  AL++YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PFAGAALGEYFRDTGRHALVVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARV--NAEHVEKLTE------GKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITD 352
           ER+A++  + E   K+ +        VKG  GSLTALP+IETQAGDVSA+IPTNVISITD
Sbjct: 301 ERAAKITDDIEVARKMNDLPDALKPLVKG-GGSLTALPVIETQAGDVSAYIPTNVISITD 359

Query: 353 GQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFA 412
           GQIFLE++LFN+G RPAIN G+SVSRVGGAAQ K +KK+ G +RLDLAQ+REL AF++F 
Sbjct: 360 GQIFLESNLFNSGQRPAINVGISVSRVGGAAQIKAMKKVAGTLRLDLAQFRELEAFSKFG 419

Query: 413 SDLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESA 472
           SDLD+ T+ QL+RG R+ E++KQ QY PM V +    +F   +G LD VEV  I+ FE  
Sbjct: 420 SDLDKTTKAQLDRGARLVEILKQGQYIPMPVEKQVAIIFLGTQGLLDAVEVPHIRRFEEE 479

Query: 473 LQGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
               +   H E+L  I + G    + A +L+ A E F
Sbjct: 480 FLSMLEHKHPEILKTIAEKGTLEADTAKQLKEAAERF 516


>ATPA_RUBXD RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 526

 Score =  569 bits (1466), Expect = e-164
 Identities = 288/510 (56%), Positives = 378/510 (74%), Gaps = 15/510 (2%)

Query: 4   QLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPG---- 59
           +L   EIS +++  I  +E+       G V+ + DGI R+HGL++VM+ EM+EF      
Sbjct: 3   RLRPEEISSILKGAITDYESRVRTEEVGQVLEVGDGIARVHGLSNVMYQEMVEFEDARGE 62

Query: 60  NTYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDG 119
              GLA+NLE D+VG +I G  ++I EG   + TGR+  VPVG+ +LGRV++ALG PIDG
Sbjct: 63  KVIGLALNLEEDNVGVIIAGDDRYILEGSTVRRTGRLASVPVGQGVLGRVINALGQPIDG 122

Query: 120 GGPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTA 179
            G I+A+ T P+E +APG+I R+ V  P+QTG+K+IDSM+P+GRGQRELIIGDR+TGKTA
Sbjct: 123 RGEIQAEETRPVEIIAPGIIRRKDVDTPLQTGIKAIDSMIPIGRGQRELIIGDRKTGKTA 182

Query: 180 VAIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFI 239
           +A+D IINQ    +KCIYVA+GQK S+VAGVV +LEE+GA+E+T V+         LQ++
Sbjct: 183 LAVDTIINQHDQNVKCIYVAVGQKDSAVAGVVAQLEEYGAMEYTTVINASASQPAPLQYL 242

Query: 240 APYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRL 299
           APYAGCA+GEYF  RGEDAL+IYDDL+K A AYRQ+ LLLRRPPGREA+PGD+FYLHSRL
Sbjct: 243 APYAGCAIGEYFMHRGEDALVIYDDLSKHAVAYRQMMLLLRRPPGREAYPGDIFYLHSRL 302

Query: 300 LERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLET 359
           LER+AR++ E+             GSLTALPIIET+AGD+SA+IPTNVISITDGQIFL+ 
Sbjct: 303 LERAARMSEEY-----------GGGSLTALPIIETKAGDISAYIPTNVISITDGQIFLDL 351

Query: 360 DLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEAT 419
           DLFNA  RPAI+ GLSVSRVG +AQ K +KK+ G ++LDL+QYRELA+FAQF SDLD+AT
Sbjct: 352 DLFNANQRPAIDVGLSVSRVGSSAQIKAMKKVAGTLKLDLSQYRELASFAQFGSDLDKAT 411

Query: 420 RKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRS 479
           ++ L RG+R+T L+KQ +  PM V +    +F   +G L +VE D + D+E+ L+ Y+RS
Sbjct: 412 QETLARGERLTALLKQRERDPMPVEEQVAVIFGGTQGLLREVEPDDVPDWEAQLREYLRS 471

Query: 480 SHGELLDKITKTGDYSDEIAAELRAAIENF 509
           SH +LL  I +  + +DE A  LR AIE F
Sbjct: 472 SHEDLLKDIREKKELTDETAERLREAIERF 501


>ATPA_FERNB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 507

 Score =  569 bits (1466), Expect = e-164
 Identities = 295/509 (57%), Positives = 371/509 (72%), Gaps = 12/509 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEF-PGNT 61
           ++LN  EI  ++  +I  ++ +      G V+ + DGI R++GL +VM  EM+EF    T
Sbjct: 1   MRLNPGEIVRVLETKISDYKEEIRLEDTGKVIQVGDGIARVYGLNNVMANEMVEFVETGT 60

Query: 62  YGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGG 121
            GLA NLE D+VG +ILG Y+ I EG   +   RI+EVPVGE LLGRVV+ LG P+DG G
Sbjct: 61  KGLAFNLEEDNVGIIILGDYKDIKEGHTVRRLNRIMEVPVGEGLLGRVVNPLGEPLDGLG 120

Query: 122 PIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVA 181
           P+E + T PIE  APGVI R+ V  P+QTGLK +DS++P+GRGQRELIIGDRQTGKTA+A
Sbjct: 121 PVEYKETRPIEFKAPGVIFRKPVDTPLQTGLKVVDSLIPIGRGQRELIIGDRQTGKTAIA 180

Query: 182 IDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAP 241
           ID IINQKG G+ CIYVAIGQKAS+VA +V KL + GA+E+T VV         LQ+IAP
Sbjct: 181 IDTIINQKGKGVYCIYVAIGQKASAVARIVEKLRQTGAMEYTTVVVAASSDPATLQYIAP 240

Query: 242 YAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLE 301
           YAGCAMGEYF   G+DAL++YDDL+K A AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLE
Sbjct: 241 YAGCAMGEYFMFNGKDALVVYDDLSKHAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLE 300

Query: 302 RSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDL 361
           R+AR+N ++             GSLTALPIIETQA D+SA+IPTNVISITDGQI+LE  L
Sbjct: 301 RAARLNEKY-----------GGGSLTALPIIETQANDISAYIPTNVISITDGQIYLEPGL 349

Query: 362 FNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRK 421
           F AG RPA+N GLSVSRVGGAAQ K +K++ G ++LDLAQ++EL  FAQFA++LD AT+ 
Sbjct: 350 FYAGQRPAVNIGLSVSRVGGAAQIKAMKQVAGSLKLDLAQFQELETFAQFATELDPATQA 409

Query: 422 QLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSH 481
           Q+ RGQR+ ELMKQ QYSPM V    V LFA   G+LDD+ ++ ++ FE  L  +++  +
Sbjct: 410 QITRGQRLMELMKQPQYSPMEVEDQVVVLFAGINGYLDDLPINAVKAFEEGLLKFVKEKY 469

Query: 482 GELLDKITKTGDYSDEIAAELRAAIENFK 510
             LLD+I  T   S E   +L A I+ FK
Sbjct: 470 SSLLDEIRTTKQLSKENETKLHAVIKEFK 498


>ATPA_CLOBM RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  569 bits (1466), Expect = e-164
 Identities = 289/508 (56%), Positives = 386/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGSEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T  +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QY PM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYGPMPVEKEIIILYAAVSNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_CLOBK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  569 bits (1466), Expect = e-164
 Identities = 289/508 (56%), Positives = 386/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGAEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +    T  +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTETRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QY PM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYGPMPVEKEIIILYAAVNNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_PELPB RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 526

 Score =  568 bits (1465), Expect = e-164
 Identities = 294/519 (56%), Positives = 378/519 (72%), Gaps = 9/519 (1%)

Query: 1   MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGN 60
           M   +   E+S ++RK++ GFE++ E    GTV+ + DGI R++GL+ V  GE++EFP N
Sbjct: 1   MSTTVRPDEVSSILRKQLAGFESEAEVYDVGTVLQVGDGIARVYGLSKVAAGELLEFPNN 60

Query: 61  TYGLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGG 120
             G+A+NLE D+VGAV+ G    + EGD  K T  +  +PVGEA+LGRV++ LG PIDG 
Sbjct: 61  VMGMALNLEEDNVGAVLFGESNLVKEGDTVKRTSILASIPVGEAMLGRVINPLGEPIDGK 120

Query: 121 GPIEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAV 180
           G I+ Q   P+E+ APGVI R+SV +P+QTGLK+IDSM+P+GRGQRELIIGDRQTGKTAV
Sbjct: 121 GTIDTQIRLPLERRAPGVIYRKSVHEPLQTGLKAIDSMIPIGRGQRELIIGDRQTGKTAV 180

Query: 181 AIDAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIA 240
           AID IINQKG G+ CIYVAIG K S+VA VV  LE++ A+E+T V+         LQFIA
Sbjct: 181 AIDTIINQKGKGVFCIYVAIGLKGSTVAQVVNTLEKYDAMEYTTVISATASDPAPLQFIA 240

Query: 241 PYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLL 300
           P+AG  +GEYFRD G  AL++YDDL+KQA AYRQVSLLLRRPPGREA+PGDVFYLHSRLL
Sbjct: 241 PFAGATLGEYFRDTGRHALVVYDDLSKQAVAYRQVSLLLRRPPGREAYPGDVFYLHSRLL 300

Query: 301 ERSARV--NAEHVEKLTE------GKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITD 352
           ER+A++  + E   K+ +        VKG  GSLTALP+IETQAGDVSA+IPTNVISITD
Sbjct: 301 ERAAKITDDIEVARKMNDLPDALKSLVKG-GGSLTALPVIETQAGDVSAYIPTNVISITD 359

Query: 353 GQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFA 412
           GQIFLE++LFN+G RPAIN G+SVSRVGG+AQ K +KK+ G +RLDLAQ+REL AF++F 
Sbjct: 360 GQIFLESNLFNSGQRPAINVGISVSRVGGSAQIKAMKKVAGTLRLDLAQFRELEAFSKFG 419

Query: 413 SDLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESA 472
           SDLD+ T+ QL+RG R+ E++KQ QY PM V +    +F   +G LD V++  I+ FE  
Sbjct: 420 SDLDKTTKAQLDRGARLVEILKQGQYIPMPVEKQVAIIFLGTQGLLDTVDLRFIRKFEEE 479

Query: 473 LQGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENFKT 511
               +   H +LL KI  +G    + AA+L+     F T
Sbjct: 480 FLSLLEIKHNDLLAKIASSGALEADTAAKLKDIAVKFVT 518


>ATPA_BACSK RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  568 bits (1465), Expect = e-164
 Identities = 296/506 (58%), Positives = 374/506 (73%), Gaps = 13/506 (2%)

Query: 5   LNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGL 64
           + A EIS LI+++I+ FE     +  GTV+ + DGI   HGL +VM GE++EF     G+
Sbjct: 4   IKATEISSLIKQQIDQFETTVNVQDVGTVIRVGDGIAFAHGLDNVMAGELLEFSTGVMGM 63

Query: 65  AMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIE 124
           A NLE DSVG +ILGPY  I EGD  K TGRI+EVPVG  LLGRVV+ LG P+DG GP+ 
Sbjct: 64  AQNLEEDSVGIIILGPYTDIREGDEVKRTGRIMEVPVGSELLGRVVNPLGQPLDGLGPVH 123

Query: 125 AQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDA 184
              T PIE  APGV+ R+SV +P+QTG+KSIDSM+P+GRGQRELIIGDRQTGKTA+AID 
Sbjct: 124 TSKTRPIESPAPGVMARKSVHEPLQTGIKSIDSMIPIGRGQRELIIGDRQTGKTAIAIDT 183

Query: 185 IINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAG 244
           IINQK   + C+YVAIGQK S+V+GVV  L + GALE+TIVV         L F+APY G
Sbjct: 184 IINQKDQDMICVYVAIGQKESTVSGVVETLRQRGALEYTIVVSASASDPAPLLFLAPYTG 243

Query: 245 CAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSA 304
            +M E F   G+  L+IYDDL+KQA AYR++SLLLRRPPGREAFPGDVFYLHSRLLER+A
Sbjct: 244 VSMAEEFMYNGKHVLVIYDDLSKQAAAYREMSLLLRRPPGREAFPGDVFYLHSRLLERAA 303

Query: 305 RVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNA 364
           ++N +         + G  GS+TALP IETQAGDVSA+IPTNVISITDGQ+FL++DLF++
Sbjct: 304 KLNDD---------LGG--GSITALPFIETQAGDVSAYIPTNVISITDGQVFLQSDLFHS 352

Query: 365 GIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLE 424
           G+RPA+N G+SVSRVGG+AQ K +KK+ G +RLDLA YREL AFAQF SDLD AT+ +L 
Sbjct: 353 GVRPAVNPGISVSRVGGSAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDAATQARLN 412

Query: 425 RGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGEL 484
           RG+R  EL+KQ  + P+ V +    ++A  +G+LDDV V   + FES L  Y+ S++ EL
Sbjct: 413 RGERTVELLKQDLHQPLPVEKQVAIIYALTKGYLDDVPVADCRRFESELFTYLESNNNEL 472

Query: 485 LDKITKTGDYSDEIAAELRAAIENFK 510
           L+ I  TG+  +E  ++L+AAIE FK
Sbjct: 473 LEHIRTTGNLPEE--SDLKAAIEAFK 496


>ATPA_SULSY RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  568 bits (1464), Expect = e-164
 Identities = 290/507 (57%), Positives = 371/507 (73%), Gaps = 12/507 (2%)

Query: 5   LNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGL 64
           + A E+ E + K+IE F+        GTV+ + DG+ RI+GL   M GEM+EF     G+
Sbjct: 4   IRADEVLESLNKQIEEFQVSANLEEVGTVIQVGDGVARIYGLEKAMMGEMLEFESGIVGV 63

Query: 65  AMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIE 124
             NLE D+VGAV+LG    + EG   K TG+IL VPVG+ LLGRVVD LG PIDG GP+ 
Sbjct: 64  VFNLEEDNVGAVLLGSDVAVREGSIVKRTGKILSVPVGKGLLGRVVDGLGNPIDGKGPLT 123

Query: 125 AQAT-SPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAID 183
             A  SP+EK+APGV+ R+SV +P+QTG+K+ID+M+P+GRGQRELIIGDR TGKT +AID
Sbjct: 124 DIAYYSPVEKIAPGVVKRKSVHEPLQTGIKAIDAMIPIGRGQRELIIGDRATGKTTIAID 183

Query: 184 AIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYA 243
            I+NQKG G+ CIYVAIGQK ++V  +V  L++HGA+E+T VV         +Q+IAP+ 
Sbjct: 184 TILNQKGQGVYCIYVAIGQKRANVVHIVETLQKHGAMEYTTVVAATSSDPATMQYIAPFV 243

Query: 244 GCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERS 303
           GC +GEYFRD G  AL+IYDDLTK A+AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+
Sbjct: 244 GCTIGEYFRDNGMHALVIYDDLTKHAYAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERA 303

Query: 304 ARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFN 363
           A++N E              GSLTALPIIETQAGDV+A+IPTNVISITDGQIFLE DLF 
Sbjct: 304 AKLNDEL-----------GAGSLTALPIIETQAGDVAAYIPTNVISITDGQIFLEADLFY 352

Query: 364 AGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQL 423
            GIRPAINAG+SVSRVGGAAQ K +K++ G +RLDLAQYREL AF QFAS+LD+AT+ Q+
Sbjct: 353 KGIRPAINAGISVSRVGGAAQIKAMKQVAGTLRLDLAQYRELEAFVQFASELDKATQAQI 412

Query: 424 ERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGE 483
            RGQR+ EL+KQ    P+ V +    ++ A +G+LDDV V+ IQ FE     ++ +   +
Sbjct: 413 ARGQRMVELLKQPPNQPVPVEKQVAIIYVAGQGYLDDVSVNAIQKFEKEFYVFLDTEKPD 472

Query: 484 LLDKITKTGDYSDEIAAELRAAIENFK 510
           +L+ I +    +D+I A+L AA++ FK
Sbjct: 473 ILEAIRREKALTDDIKAKLDAAVKEFK 499


>ATPA_RHOPS RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 510

 Score =  568 bits (1463), Expect = e-164
 Identities = 292/519 (56%), Positives = 380/519 (73%), Gaps = 20/519 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + AAEIS +++ +I+ F  + E    G V+S+ DGI R++GL +V+ GEM+EF   T 
Sbjct: 1   MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLDNVLAGEMVEFENGTR 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VI G  + I EG   K T  I++ PVG+ LLGRVVDALG PIDG GP
Sbjct: 61  GMALNLETDNVGIVIFGADREIKEGQTVKRTRSIVDTPVGKGLLGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A     ++  APG+I R+SV++P+ TGLK+ID+++PVGRGQRELIIGDRQTGKTA+A+
Sbjct: 121 IQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQRELIIGDRQTGKTAIAL 180

Query: 183 DAIINQK---------GTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXX 233
           D I+NQK         G  + C+YVA+GQK S+VA  V+ LEE GALE++IVV       
Sbjct: 181 DTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLEEQGALEYSIVVAATASDP 240

Query: 234 XXLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVF 293
             +Q+IAP+ GC MGEYFRD G  A+IIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVF
Sbjct: 241 APMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVF 300

Query: 294 YLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDG 353
           YLHSRLLER+A++N +H            +GSLTALPIIETQA DVSA+IPTNVISITDG
Sbjct: 301 YLHSRLLERAAKLNEDH-----------GSGSLTALPIIETQANDVSAYIPTNVISITDG 349

Query: 354 QIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFAS 413
           QIFLETDLF  GIRPA+N GLSVSRVG +AQTK +KK+ G ++ +LAQYRE+AAFAQF S
Sbjct: 350 QIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYREMAAFAQFGS 409

Query: 414 DLDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESAL 473
           DLD +T++ L RG R+TEL+KQ Q+SP+ + +  V ++A   G+LD + V K++ FE  L
Sbjct: 410 DLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALPVAKVRSFEDGL 469

Query: 474 QGYMRSSHGELLDKITKTGDYSDEIAAELRAAIENFKTT 512
              +R     +LD I  + D SD+ AA+L+A IE++  T
Sbjct: 470 LSLLRGKESAILDAIRTSRDLSDDTAAKLKAVIESYAKT 508


>ATPA_GEOSF RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  568 bits (1463), Expect = e-164
 Identities = 292/495 (58%), Positives = 366/495 (73%), Gaps = 11/495 (2%)

Query: 16  KRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLERDSVGA 75
           K+I+ + ++ E    GT++S+ DGI RIHGL   M GE++EFPG   G+A+NLE D+VGA
Sbjct: 14  KQIKEYGSEVEVAETGTIISIGDGIARIHGLDKAMAGELLEFPGGISGMALNLEEDNVGA 73

Query: 76  VILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVA 135
            ILG +  I EGD  K T RI+EVPVGEAL+GRVV+A+G PIDG GPI       +E  A
Sbjct: 74  AILGEFSEIKEGDTVKRTNRIVEVPVGEALIGRVVNAIGQPIDGKGPINTDKFGKVEVKA 133

Query: 136 PGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKC 195
           PG++ R+SV QP+QTGLK+ID+MVP+GRGQRELIIGDRQTGKTAVAID IINQKG  + C
Sbjct: 134 PGIVKRKSVHQPMQTGLKAIDAMVPIGRGQRELIIGDRQTGKTAVAIDTIINQKGGDVVC 193

Query: 196 IYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPYAGCAMGEYFRDRG 255
           IYVAIGQK S+VA VV KL+EHGA+++TI+V         LQFI+PY G  MGEYFRD G
Sbjct: 194 IYVAIGQKRSTVAQVVSKLQEHGAMDYTIIVAATASEPAPLQFISPYTGVTMGEYFRDNG 253

Query: 256 EDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLT 315
           + ALIIYDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFYLHSRLLER+ +V+        
Sbjct: 254 KHALIIYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRLLERACKVSD------- 306

Query: 316 EGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLFNAGIRPAINAGLS 375
                   GSLTALPIIETQAGDVSA+IPTNVISITDGQI+LE+DLF +G+RPAIN GLS
Sbjct: 307 ----ACGAGSLTALPIIETQAGDVSAYIPTNVISITDGQIYLESDLFYSGVRPAINVGLS 362

Query: 376 VSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQLERGQRVTELMKQ 435
           VSRVGG+AQ K +K++ G +RL LAQYRE+AAFAQF SDLD+AT+ QL RG+R+ E++KQ
Sbjct: 363 VSRVGGSAQVKAMKQVAGTLRLSLAQYREMAAFAQFGSDLDKATQMQLARGERLVEVLKQ 422

Query: 436 LQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITKTGDYS 495
            QY P+   +  + +FAAN G++D+  V  +  +ES L  +  +   +LL ++       
Sbjct: 423 PQYRPIPNEKQVLIIFAANNGYIDEYPVASLGRYESELYSFFDARKSDLLAELRXXXXXX 482

Query: 496 DEIAAELRAAIENFK 510
                   +A+E FK
Sbjct: 483 XXXXXXXVSALEEFK 497


>ATPA_BACA2 RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  568 bits (1463), Expect = e-164
 Identities = 293/511 (57%), Positives = 377/511 (73%), Gaps = 15/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + A EIS LI+++I+ ++++ E    GTV+ + DGI R+HGL + M GE++EF     
Sbjct: 1   MSIKAEEISTLIKQQIQNYQSEIEVHDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A NLE  +VG VILGPY+ I EGD  K TGRI+EVPVGE L+GR+V+ LG P+DG GP
Sbjct: 61  GMAQNLEESNVGIVILGPYRDIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T PIE  APGV+ R+SV +P+QTG+K+ID+++P+GRGQRELIIGDRQTGKT+VAI
Sbjct: 121 ILTSKTRPIESQAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQK   + C+YVAIGQK S+V GVV  L +HGAL++TIVV         L ++APY
Sbjct: 181 DTILNQKDQDMICVYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG  MGE F   G+  L++YDDL+KQA AYR++SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGVTMGEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GS+TALP +ETQAGD+SA+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAINAGLSVSRVGG+AQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 350 FSGVRPAINAGLSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFAQFGSDLDQATQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R  E++KQ    P+ V +    L+A  +G+LDD+ V  I+ FE     Y+  +H 
Sbjct: 410 LNRGARTVEVLKQDLNKPLPVEKQVAILYALTKGYLDDIPVADIRRFEEEYYMYLDQNHK 469

Query: 483 ELLDKITKTGDY-SDEIAAELRAAIENFKTT 512
           +LLD I KTG+  +DE   + +AAIE FK T
Sbjct: 470 DLLDGIAKTGNLPADE---DFKAAIEGFKRT 497


>ATPA_GEOKA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  567 bits (1462), Expect = e-164
 Identities = 295/510 (57%), Positives = 377/510 (73%), Gaps = 13/510 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + A EIS LI+++IE +E+  +    GTV+ + DGI R HGL +VM GE++EF     
Sbjct: 1   MSIRAEEISALIKQQIENYESQIQVSDVGTVIQVGDGIARAHGLDNVMSGELVEFANGVM 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE ++VG VILGPY  I EGD  + TGRI+EVPVGEAL+GRVV+ LG P+DG GP
Sbjct: 61  GMALNLEENNVGIVILGPYTGIKEGDEVRRTGRIMEVPVGEALIGRVVNPLGQPVDGLGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +E   T PIE  APGV+ R+SV +P+QTG+K+ID++VP+GRGQRELIIGDRQTGKT+VAI
Sbjct: 121 VETTETRPIESPAPGVMDRRSVHEPLQTGIKAIDALVPIGRGQRELIIGDRQTGKTSVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D IINQK   + CIYVAIGQK S+V  VV  L +HGAL++TIVV         L F+APY
Sbjct: 181 DTIINQKDQNMICIYVAIGQKESTVRTVVETLRKHGALDYTIVVTASASQPAPLLFLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG AMGEYF  +G+  L++YDDL+KQA AYR++SLLLRRPPGREA+PGD+FYLHSRLLER
Sbjct: 241 AGVAMGEYFMYKGQHVLVVYDDLSKQAAAYRELSLLLRRPPGREAYPGDIFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GSLTALP +ETQAGD+SA+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GGGSLTALPFVETQAGDISAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAINAGLSVSRVGGAAQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 350 FSGVRPAINAGLSVSRVGGAAQIKAMKKVAGTLRLDLAAYRELEAFAQFGSDLDKATQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R  E++KQ  + P+ V +  + ++A   GFLDD+ V+ ++ FE     ++  +  
Sbjct: 410 LARGARTVEVLKQDLHQPIPVEKQVLIIYALTRGFLDDIPVEDVRRFEKEFYLWLDQNGQ 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFKTT 512
            LL+ I  T D  +E   +L  AIE FK T
Sbjct: 470 HLLEHIRTTKDLPNE--DDLNKAIEAFKKT 497


>ATPA_BACSU RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 502

 Score =  567 bits (1462), Expect = e-164
 Identities = 293/511 (57%), Positives = 377/511 (73%), Gaps = 15/511 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + + A EIS LI+++I+ +++D E +  GTV+ + DGI R+HGL + M GE++EF     
Sbjct: 1   MSIKAEEISTLIKQQIQNYQSDIEVQDVGTVIQVGDGIARVHGLDNCMAGELVEFSNGVL 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A NLE  +VG VILGP+  I EGD  K TGRI+EVPVGE L+GR+V+ LG P+DG GP
Sbjct: 61  GMAQNLEESNVGIVILGPFSEIREGDEVKRTGRIMEVPVGEELIGRIVNPLGQPVDGLGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I    T PIE  APGV+ R+SV +P+QTG+K+ID+++P+GRGQRELIIGDRQTGKT+VAI
Sbjct: 121 ILTSKTRPIESPAPGVMDRKSVHEPLQTGIKAIDALIPIGRGQRELIIGDRQTGKTSVAI 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           DAI+NQK   + C+YVAIGQK S+V GVV  L +HGAL++TIVV         L ++APY
Sbjct: 181 DAILNQKDQDMICVYVAIGQKESTVRGVVETLRKHGALDYTIVVTASASQPAPLLYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AG  M E F   G+  L++YDDL+KQA AYR++SLLLRRPPGREAFPGDVFYLHSRLLER
Sbjct: 241 AGVTMAEEFMYNGKHVLVVYDDLSKQAAAYRELSLLLRRPPGREAFPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           +A        KL++ K     GS+TALP +ETQAGD+SA+IPTNVISITDGQIFL++DLF
Sbjct: 301 AA--------KLSDAK---GAGSITALPFVETQAGDISAYIPTNVISITDGQIFLQSDLF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
            +G+RPAINAGLSVSRVGG+AQ K +KK+ G +RLDLA YREL AFAQF SDLD+AT+ +
Sbjct: 350 FSGVRPAINAGLSVSRVGGSAQIKAMKKVSGTLRLDLASYRELEAFAQFGSDLDQATQAK 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           L RG R  E++KQ    P+ V +    L+A  +G+LDD+ V  I+ FE     Y+  +H 
Sbjct: 410 LNRGARTVEVLKQDLNKPLPVEKQVAILYALTKGYLDDIPVADIRRFEEEYYMYLDQNHK 469

Query: 483 ELLDKITKTGDY-SDEIAAELRAAIENFKTT 512
           +LLD I KTG+  +DE   + +AAIE FK T
Sbjct: 470 DLLDGIAKTGNLPADE---DFKAAIEGFKRT 497


>ATPA_SPHAL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 509

 Score =  567 bits (1461), Expect = e-164
 Identities = 296/515 (57%), Positives = 373/515 (72%), Gaps = 19/515 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ AAEIS++I+ +I  F  D      G+V+S+ DGI R+HGL +V  GEM+EF     
Sbjct: 1   MEIRAAEISKVIKDQIANFGTDATVTEIGSVLSVGDGIARVHGLDNVQAGEMVEFANGVK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VI G    I EGD+ K TG I++VPVG+ LLGRVVD LG PIDG GP
Sbjct: 61  GMALNLEADNVGIVIFGSDAAIKEGDQVKRTGTIVDVPVGKGLLGRVVDGLGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           I+A     +E  APG+I R SV +PVQTGLK++D++VPVGRGQRELIIGDRQTGKTAVAI
Sbjct: 121 IKADKRMRVEVKAPGIIPRTSVHEPVQTGLKALDALVPVGRGQRELIIGDRQTGKTAVAI 180

Query: 183 DAIINQKGTG--------IKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXX 234
           D  INQK           + CIYVA+GQK S+VA +VR+LEE+GA+E++IVV        
Sbjct: 181 DTFINQKAANAGDDESKKLYCIYVAVGQKRSTVAQIVRQLEENGAMEYSIVVAATASEPA 240

Query: 235 XLQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFY 294
            LQF+APY GC MGE+FRD G  A+I+YDDL+KQA AYRQ+SLLLRRPPGREA+PGDVFY
Sbjct: 241 PLQFLAPYTGCTMGEFFRDNGMHAVIVYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFY 300

Query: 295 LHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQ 354
           LHSRLLER+A++N+++            +GSLTALPIIETQAGDVSA+IPTNVISITDGQ
Sbjct: 301 LHSRLLERAAKMNSDN-----------GSGSLTALPIIETQAGDVSAYIPTNVISITDGQ 349

Query: 355 IFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASD 414
           IFLET+LFNAGIRPAIN GLSVSRVG AAQTK +KK+ G ++L+LAQYRE+ AFAQF SD
Sbjct: 350 IFLETNLFNAGIRPAINVGLSVSRVGSAAQTKAMKKVSGSIKLELAQYREMEAFAQFGSD 409

Query: 415 LDEATRKQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQ 474
           LD +T+K L RG R+T+L+K              S+FA   G+LD V    +  +E+A+ 
Sbjct: 410 LDASTQKLLGRGARLTQLLKXXXXXXXXXXXXTASIFAGTNGYLDTVATTDVSRYEAAML 469

Query: 475 GYMRSSHGELLDKITKTGDYSDEIAAELRAAIENF 509
            Y+RS H ++L  I  + D  D+    L AA++ F
Sbjct: 470 AYLRSDHPQVLAAIRDSKDLGDDTKKALVAALDAF 504


>ATPA_CLOBL RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 504

 Score =  567 bits (1461), Expect = e-164
 Identities = 288/508 (56%), Positives = 385/508 (75%), Gaps = 11/508 (2%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           + +   EI+ +IR++IE F  + E    GT++ + DGI R++GL D M GE+IEFP + Y
Sbjct: 1   MNIKPEEITSIIRQQIENFNTNIETIDSGTIIQIGDGIARVYGLEDCMEGELIEFPNDVY 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE+D+VG V+LG  + I EG+  K T +++EVPVGEAL+GRVV++LG+PIDG GP
Sbjct: 61  GMALNLEQDNVGCVLLGAEEGIKEGNVVKRTKKVVEVPVGEALVGRVVNSLGMPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           +       +E  APGVI RQSV +P+QTG+K+IDSM+P+G+GQRELIIGDRQTGKTA+A+
Sbjct: 121 VLTTENRDVEVPAPGVIDRQSVKEPLQTGIKAIDSMIPIGKGQRELIIGDRQTGKTAIAM 180

Query: 183 DAIINQKGTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXXXLQFIAPY 242
           D I+NQKG  + CIYVAIGQK S+VA +V  L + GA+++TIVV         LQ++APY
Sbjct: 181 DTILNQKGKDVICIYVAIGQKQSTVAHIVNDLTKMGAMDYTIVVSSTASDSAPLQYLAPY 240

Query: 243 AGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLRRPPGREAFPGDVFYLHSRLLER 302
           AGC+MGEYF  +G+D LI+YDDL+K A AYR +SLLLRRPPGREA+PGDVFYLHSRLLER
Sbjct: 241 AGCSMGEYFMHKGKDVLIVYDDLSKHAVAYRTMSLLLRRPPGREAYPGDVFYLHSRLLER 300

Query: 303 SARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISITDGQIFLETDLF 362
           SAR++    EKL         GSLTALPI+ET AGDV+A+IPTNVISITDGQIFLE++LF
Sbjct: 301 SARLS----EKL-------GGGSLTALPIVETLAGDVTAYIPTNVISITDGQIFLESELF 349

Query: 363 NAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATRKQ 422
           NAG RPA+NAG+SVSRVGG AQ K +K++ G +RL+LAQYRELAAF+QF SDLD+ + K+
Sbjct: 350 NAGQRPAVNAGISVSRVGGNAQIKAMKQVAGTLRLELAQYRELAAFSQFGSDLDKESVKR 409

Query: 423 LERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHG 482
           LE+G+R+ E++KQ QY PM V +  + L+AA    L D+ V+KI++FE  L  Y+ + + 
Sbjct: 410 LEKGKRLVEILKQPQYGPMPVEKEIIILYAAVNNHLIDIPVNKIKEFEKELFNYIDTHYR 469

Query: 483 ELLDKITKTGDYSDEIAAELRAAIENFK 510
           ++   I +    +DE+ ++L  AI +FK
Sbjct: 470 DIGKDILEHKQLTDELKSKLDKAINDFK 497


>ATPA_MAGSA RecName: Full=ATP synthase subunit alpha;       
           EC=3.6.3.14;AltName: Full=F-ATPase subunit
           alpha;AltName: Full=ATP synthase F1 sector subunit
           alpha;
          Length = 509

 Score =  566 bits (1460), Expect = e-163
 Identities = 293/518 (56%), Positives = 382/518 (73%), Gaps = 19/518 (3%)

Query: 3   LQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTY 62
           +++ AAEIS +++++I  F  + E    G V+S+ DGI R+HGL  V  GEM+EFPG   
Sbjct: 1   MEIRAAEISAILKQQIATFGTEAEVAEVGQVLSVGDGIARVHGLDKVQAGEMVEFPGGIK 60

Query: 63  GLAMNLERDSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGP 122
           G+A+NLE D+VG VI G  ++I EGD  K TG I++VPVG+ LLGRVVDALG PIDG GP
Sbjct: 61  GMALNLETDNVGVVIFGDDRNIKEGDVVKRTGSIVDVPVGKGLLGRVVDALGNPIDGKGP 120

Query: 123 IEAQATSPIEKVAPGVITRQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAI 182
           IEA +   ++  APG+I R+SV +P+ TG+K++D+++P+GRGQREL+IGDRQTGKTA+ +
Sbjct: 121 IEAASRQRVDVKAPGIIPRKSVHEPMSTGIKAVDALIPIGRGQRELVIGDRQTGKTAILV 180

Query: 183 DAIINQK--------GTGIKCIYVAIGQKASSVAGVVRKLEEHGALEHTIVVXXXXXXXX 234
           D IINQK           + CIYVA+GQK S+VA +V+ L ++GA+++TIVV        
Sbj