# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_20033.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       ABA56915.1  [L=406]
Description: noce0 ABA56915.1 GIB00281CH01 "Polynucleotide adenylyltransferase"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    4.7e-24   87.6   0.0    9.7e-24   86.6   0.0    1.6  1  PF01743  Poly A polymerase head domain
    3.7e-09   39.3   0.3    7.6e-09   38.3   0.2    1.5  1  PF01966  HD domain
  ------ inclusion threshold ------
         17    7.7   0.0         34    6.8   0.0    1.5  1  PF02933  Cell division protein 48 (CDC48), domain 2
         21    6.8   0.0         43    5.8   0.0    1.4  1  PF11876  Protein of unknown function (DUF3396)
         22    7.7   0.4         52    6.5   0.0    1.8  1  PF03810  Importin-beta N-terminal domain
         58    6.5   0.0    1.2e+02    5.6   0.0    1.4  1  PF09713  Plant protein 1589 of unknown function (A_thal_3526
         73    5.8   0.7    1.7e+02    4.6   0.5    1.6  1  PF00807  Apidaecin
    1.1e+02    5.1   0.1    2.7e+02    3.9   0.0    1.6  1  PF03458  UPF0126 domain
    1.4e+02    4.9   0.0    3.9e+02    3.5   0.0    1.6  1  PF06831  Formamidopyrimidine-DNA glycosylase H2TH domain
    1.7e+02    4.1   0.0    2.8e+02    3.4   0.0    1.2  1  PF11187  Protein of unknown function (DUF2974)
    2.2e+02    3.9   0.0    5.8e+02    2.6   0.0    1.6  1  PF02878  Phosphoglucomutase/phosphomannomutase, alpha/beta/a
      5e+02    3.3   0.0    1.2e+03    2.1   0.0    1.6  1  PF00237  Ribosomal protein L22p/L17e
    7.3e+02    2.8   0.1    1.8e+03    1.6   0.1    1.6  1  PF10511  Trappin protein transglutaminase binding domain
    1.3e+03    1.3   0.4    3.2e+03    0.1   0.3    1.5  1  PF05924  SAMP Motif


Domain and alignment annotation for each model:
>> PF01743  Poly A polymerase head domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   86.6   0.0   1.4e-27   9.7e-24       1     126 []       3     122 ..       3     122 .. 0.90

  Alignments for each domain:
  == domain 1    score: 86.6 bits;  conditional E-value: 1.4e-27
                 EEE----HHHHH-----SEEEEEE---HHHHHHHHHHH-----EE-TT---EEEE----E.EEEEE--S---------------....-HHHHHHTSSB CS
     PF01743   1 lylvGGaVRDllLgkevkDvDlavdaapeevakefakkvkeallsgkefqtiavllkkqt.levatfrtekkesdarnpksekfte..sleeDlkrRDf 96 
                 +ylvGGaVRD+lLg++vk+ D +v   ++  a+++a+ ++    +gk      v+l++qt  e+a +rte+k+ + ++  +++++   +leeDl+rRD+
  ABA56915.1   3 VYLVGGAVRDKLLGRPVKERDYVVV--GTTPANLLAQGYRP---VGKD---FPVFLHPQTqEEYALARTERKTGPGYKGFEVDAAPdvTLEEDLQRRDL 93 
                 69**********************9..56667888666666...4555...57889998889*********************99899*********** PP

                 GGGS-EEEGG---EE------HHHHTTEE- CS
     PF01743  97 TiNalaynlekgkviDltgGlkDLksrllr 126
                 TiNa+a   ++g+++D++gG +DL +++lr
  ABA56915.1  94 TINAIAEA-ADGSLLDPFGGQQDLARGILR 122
                 ******99.9****************9997 PP

>> PF01966  HD domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   38.3   0.2   1.1e-12   7.6e-09       2     115 ..     226     323 ..     225     346 .. 0.85

  Alignments for each domain:
  == domain 1    score: 38.3 bits;  conditional E-value: 1.1e-12
                 HHHHHHHHHHHHHHHHHHHCHCCHHHHHHHHHHTTTTHHCHSS..HHHHH...CCHHHHHHHHHHHHHHHHHHHH...HHHHHHHHCCCGSCHHTS... CS
     PF01966   2 leHsleVaklarrlaedlgeeedrellrlaaLlHDiGkgpfgdsfekkee...fkaHekvgaeilrevekrlgld...ledvaklirehheswegekyp 94 
                  +H+l+V+++a+ l  d +       +r+aaL HD+Gkg++++     +e   +++H + g+ ++  +++rl+++      +++++r+h+  +      
  ABA56915.1 226 GIHTLKVLEIAAHLSSDTQ-------VRFAALTHDLGKGQTPS-----HEwphHYGHGERGVALVLTLCQRLRVPkayQALAVQVARYHNLVHQ----- 307
                 58*****************.......****************8.....336679******************999**88888899999998887..... PP

                 .HHHHHCHSHHHHHHHHHHHH CS
     PF01966  95 eglaereislearivklaDrl 115
                       +  +   i+kl+ r+
  ABA56915.1 308 -----AQELRPGTILKLLNRV 323
                 .....3455555555555444 PP

>> PF02933  Cell division protein 48 (CDC48), domain 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0    0.0047        34       9      29 ..       9      29 ..       4      64 .. 0.77

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.0047
                HHHHHHTT-EE-TT-EEEEE- CS
     PF02933  9 ylkrqFlgrpvskGdiivfef 29
                +++ ++lgrpv + d++v++ 
  ABA56915.1  9 AVRDKLLGRPVKERDYVVVGT 29
                68899************9864 PP

>> PF11876  Protein of unknown function (DUF3396)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0    0.0061        43      43      78 ..     276     311 ..     263     321 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.0061
     PF11876  43 alllelaerLpvesGyaGlavvlsplsreknepqey 78 
                 al+l l++rL v + y  lav++ ++++   ++qe 
  ABA56915.1 276 ALVLTLCQRLRVPKAYQALAVQVARYHNLVHQAQEL 311
                 899********************9999999999886 PP

>> PF03810  Importin-beta N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0073        52      16      37 ..     229     250 ..     227     252 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0073
                 HHHHHHHHHTTTSTHHHHHHHH CS
     PF03810  16 lsallqilanksldlevRqlAa 37 
                  +++l+i+a+ s+d +vR++A+
  ABA56915.1 229 TLKVLEIAAHLSSDTQVRFAAL 250
                 5789****99999********8 PP

>> PF09713  Plant protein 1589 of unknown function (A_thal_3526)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.016   1.2e+02      19      43 ..     157     181 ..     152     192 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.016
     PF09713  19 vkaLdkhanIsplvTstVWkeLeke 43 
                 ++a+ +  + ++lv + VW+eLe++
  ABA56915.1 157 MEAMVTAGEADHLVPERVWRELERA 181
                 77777888889999*********96 PP

>> PF00807  Apidaecin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.5     0.024   1.7e+02      17      27 ..     213     223 ..     212     224 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.024
     PF00807  17 IPQPRPPHPRl 27 
                 +PQPR  HP +
  ABA56915.1 213 VPQPRRYHPEI 223
                 7********77 PP

>> PF03458  UPF0126 domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.038   2.7e+02      40      54 ..       6      19 ..       5      32 .. 0.85

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.038
     PF03458 40 gGGilRDvllgeiPv 54
                +GG +RD llg+ Pv
  ABA56915.1  6 VGGAVRDKLLGR-PV 19
                7**********9.65 PP

>> PF06831  Formamidopyrimidine-DNA glycosylase H2TH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0     0.055   3.9e+02      50      74 ..     377     401 ..     372     403 .. 0.88

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.055
                 HTT--TTSBGGGS-HHHHHHHHHHH CS
     PF06831  50 lagihPeklakslsekelellhkai 74 
                 +ag+ +e +a++l++++++++ +a+
  ABA56915.1 377 AAGLRGEAIAEQLQQQRIKAIKQAV 401
                 7999****************98876 PP

>> PF11187  Protein of unknown function (DUF2974)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.039   2.8e+02       9      38 ..     229     258 ..     226     260 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.039
     PF11187   9 nlrlseyvekldeeeqkqfaavtfeleegt 38 
                  l++ e++ +l++++q +faa+t +l +g+
  ABA56915.1 229 TLKVLEIAAHLSSDTQVRFAALTHDLGKGQ 258
                 68999*******************999876 PP

>> PF02878  Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0     0.081   5.8e+02       7      30 ..     378     401 ..     375     404 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.081
                 SSB-B-HHHHTSSCCHHHHHHHHH CS
     PF02878   7 sGiRgkvgegeltpelvlklgqal 30 
                 +G+Rg++ +++l+++ ++++ qa+
  ABA56915.1 378 AGLRGEAIAEQLQQQRIKAIKQAV 401
                 8*******************9997 PP

>> PF00237  Ribosomal protein L22p/L17e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.17   1.2e+03      26      75 ..     115     164 ..     111     168 .. 0.91

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.17
     PF00237  26 eeAlaiLefvpkkaakivlklLksaeanaennkgldpdklvikeiavnkg 75 
                 + A  iL+ v+   a+   ++L+ a+  a+ n ++ p++l   e++v  g
  ABA56915.1 115 DLARGILRHVSPAFAEDPVRILRAARFAARFNFKVAPETLALMEAMVTAG 164
                 568999************************9*************999887 PP

>> PF10511  Trappin protein transglutaminase binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.1      0.25   1.8e+03       2      10 ..     252     260 ..     252     260 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.25
     PF10511   2 QDsVKGqlp 10 
                 +D  KGq p
  ABA56915.1 252 HDLGKGQTP 260
                 6999***98 PP

>> PF05924  SAMP Motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.1   0.3      0.45   3.2e+03       4       9 ..     192     197 ..     192     197 .. 0.97

  Alignments for each domain:
  == domain 1    score: 0.1 bits;  conditional E-value: 0.45
     PF05924   4 EiLrEC 9  
                 EiLr+C
  ABA56915.1 192 EILRAC 197
                 9***** PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (406 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       259  (0.0217428); expected 238.2 (0.02)
Passed bias filter:                      215  (0.018049); expected 238.2 (0.02)
Passed Vit filter:                        14  (0.00117529); expected 11.9 (0.001)
Passed Fwd filter:                        14  (0.00117529); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              14  [number of targets reported over threshold]
# CPU time: 0.25u 0.04s 00:00:00.28 Elapsed: 00:00:00
# Mc/sec: 3506.06
//